format-version: 1.2
date: 03:11:2009 15:34
saved-by: ceci
auto-generated-by: OBO-Edit 2.0
default-namespace: pro
remark: release: 7.0, version 0

[Term]
id: MOD:00030
name: N-formyl-L-methionine residue
namespace: MOD
xref: MOD:00030
is_a: PRO:000002970 ! non-standard encoded protein residue

[Term]
id: MOD:00031
name: L-selenocysteine residue
namespace: MOD
xref: MOD:00031
is_a: PRO:000002970 ! non-standard encoded protein residue

[Term]
id: MOD:00394
name: acetylated residue
namespace: MOD
xref: MOD:00394
is_a: PRO:000002968 ! modified protein residue

[Term]
id: MOD:00427
name: methylated residue
namespace: MOD
xref: MOD:00427
is_a: PRO:000002968 ! modified protein residue

[Term]
id: MOD:00438
name: myristoylated residue
namespace: MOD
xref: MOD:00438
is_a: PRO:000002968 ! modified protein residue

[Term]
id: MOD:00693
name: glycosylated residue
namespace: MOD
xref: MOD:00693
is_a: PRO:000002968 ! modified protein residue

[Term]
id: MOD:00696
name: phosphorylated residue
namespace: MOD
xref: MOD:00696
is_a: PRO:000002968 ! modified protein residue

[Term]
id: MOD:00703
name: isoprenylated residue
namespace: MOD
xref: MOD:00703
is_a: PRO:000002968 ! modified protein residue

[Term]
id: MOD:00818
name: glycosylphosphatidylinositolated residue
namespace: MOD
xref: MOD:00818
is_a: PRO:000002968 ! modified protein residue

[Term]
id: MOD:01148
name: ubiquitinylated lysine
namespace: MOD
xref: MOD:01148
is_a: PRO:000002968 ! modified protein residue

[Term]
id: MOD:01149
name: sumoylated lysine
namespace: MOD
xref: MOD:01149
is_a: PRO:000002968 ! modified protein residue

[Term]
id: MOD:01150
name: neddylated lysine
namespace: MOD
xref: MOD:01150
is_a: PRO:000002968 ! modified protein residue

[Term]
id: MOD:01187
name: L-pyrrolysine residue
namespace: MOD
xref: MOD:00031
is_a: PRO:000002970 ! non-standard encoded protein residue

[Term]
id: PRO:000000001
name: protein
def: "A biological macromolecule that is composed of amino acids linked in a linear sequence (a polypeptide chain) and is genetically encoded. Proteins descended from a common ancestor can be classified into families and superfamilies composed of products of evolutionarily-related genes. The domain architecture of a protein is described by the order of its constituent domains. Proteins with the same domains in the same order are defined as homeomorphic." [PRO:WCB]

[Term]
id: PRO:000000002
name: E3 ubiquitin ligase SFC complex Skp1 subunit
def: "A protein with a core domain composition consisting of an N-terminal Skp1 family, tetramerisation domain (PF03931) followed by a Skp1 family, dimerisation domain (PF01466). Skp1 proteins bind several F-box-containing proteins, and are involved in the ubiquitin protein degradation pathway." [PRO:CNA]
comment: Category=family.
xref: PIRSF:PIRSF028729
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000000003
name: HLH DNA-binding protein inhibitor
def: "A protein with a core domain composition consisting of a Helix-loop-helix DNA-binding domain (PF00010) (HLH), common to the basic HLH family of transcription factors, but lacking the DNA binding domain to the consensus E box response element (CANNTG). By binding to basic HLH transcription factors, proteins in this class regulate gene expression." [PRO:CNA]
comment: Category=family.
synonym: "DNA-binding protein inhibitor ID" EXACT []
synonym: "ID protein" RELATED []
xref: PIRSF:PIRSF005808
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000000004
name: RING-box protein
def: "A protein with a core domain composition consisting of a Zinc finger, C3HC4 type (PF00097) domain." [PMID:11573242]
comment: Category=family.
xref: PIRSF:PIRSF016237
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000000005
name: TGF-beta receptor type-2
def: "A protein that is a translation product of the TGFBR2 gene. The core domain organization is composed of a signal peptide followed by a Transforming growth factor beta receptor 2 ectodomain (PF08917), a transmembrane domain and a C-terminal Protein kinase domain (PF00069)." [PRO:CNA]
comment: Category=gene.
synonym: "TGFBR2" EXACT []
xref: PIRSF:PIRSF037393
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000000006
name: TGF-beta superfamily receptor type-1
def: "A protein that is a translation product of an evolutionary-related gene with core domain composition consisting of an extracellular Activin types I and II receptor domain (PF01064), a transmembrane domain, a Transforming growth factor beta type I GS-motif (PF08515) and a Protein kinase domain (PF00069). The transforming growth factor-beta (TGF-beta) superfamily of receptors comprises two groups of transmembrane serine-threonine kinase receptors, so called type-1, and type-2 receptors, that are activated following engagement by members of the TGF-beta superfamily of ligands. These events specify diverse downstream responses that are differentially regulated by controlling access and activation of the ligands, their receptors and downstream substrates in different cell types. The type 1 receptors are characterized by the presence of a glycine-serine rich juxta-membrane domain (the GS-motif) that is critical for their activation." [PRO:CNA]
comment: Category=family.
synonym: "TRANSFORMING GROWTH FACTOR-BETA RECEPTOR TYPE I (PTHR23255:SF15)" EXACT []
xref: PANTHER:PTHR23255\:SF14
xref: PIRSF:PIRSF037391
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000000007
name: TGF-beta superfamily receptor type-2 with activin receptor domain
def: "A protein that is a translation product of an evolutionary-related gene with core domain composition consisting of an extracellular Activin types I and II receptor domain (PF01064), a transmembrane domain, and a Protein kinase domain (PF00069). The transforming growth factor-beta (TGF-beta) superfamily of receptors comprises two groups of transmembrane serine-threonine kinase receptors, so called type-1, and type-2 receptors, that are activated following engagement by members of the TGF-beta superfamily of ligands. These events specify diverse downstream responses that are differentially regulated by controlling access and activation of the ligands, their receptors and downstream substrates in different cell types." [PRO:CNA]
comment: Category=family.
xref: PIRSF:PIRSF000627
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000000008
name: TGF-beta-like cystine-knot cytokine
def: "A protein with a core domain composition consisting of a signal peptide, a variable propeptide region and a Transforming growth factor beta like domain (PF00019), which is a cystine-knot domain containing four conserved beta strands, S1-S4, which form two antiparallel beta sheets (SI-S2 and S3-S4) interconnected by three disulfide bridges in a knot-like topology. Cystines [II-V] and [III-VI] form a ring through which the remaining disulfide bond (Cys[I-IV]) penetrates. Insertion of different variable regions into this common motif has given rise to various subclasses of the growth factor cystine-knot domain." [PRO:CNA]
comment: Category=family.
synonym: "TGF-beta superfamily" RELATED []
xref: PIRSF:PIRSF800009
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000000009
name: anti-Muellerian hormone type-2 receptor
def: "A protein that is a translation product of the AMHR2 gene." [PRO:CNA]
comment: Category=gene.
synonym: "AMHR2" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000000010
name: chordin
def: "A protein that is a translation product of the CHRD gene. Chordin regulates signaling by BMP pathway." [PRO:CNA]
comment: Category=gene.
synonym: "CHRD" EXACT []
xref: PIRSF:PIRSF002496
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000000011
name: class 1 small leucine-rich proteoglycan
def: "A protein with a core domain composition consisting of eight to ten tandem leucine-rich repeat sequences that are flanked at either end by cysteine rich disulfide loops." [PMID:14562268]
comment: Category=family.
xref: PIRSF:PIRSF002490
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000000012
name: creb-binding protein/zinc finger protein HRX chimera
def: "A protein that is a translation product of the fusion of CREBBP and MYST4 genes." [PRO:CNA]
comment: Category=gene.
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000000013
name: cullin
def: "A protein with a core domain composition consisting of a cullin domain that functions as a molecular scaffold responsible for assembling the ROC1/Rbx1 RING-based E3 ubiquitin ligases." [PIRSF:PIRSF017874]
comment: Category=family.
xref: PIRSF:PIRSF017874
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000000014
name: cyclin-dependent kinase inhibitor
def: "A protein with a core domain composition consisting of four ankyrin repeats, and that functions as negative regulator of cyclin-dependent kinases." [PRO:CNA]
comment: Category=family.
xref: PIRSF:PIRSF036346
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000000015
name: follistatin
def: "A protein that is a translation product of the FST gene." [PRO:CNA]
comment: Category=gene.
synonym: "FST" EXACT []
xref: PIRSF:PIRSF002278
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000000016
name: HECT-domain-containing E3 ubiquitin-protein ligase with WW domains
def: "A protein with a core domain composition consisting of the C-terminal HECT-domain (ubiquitin-transferase) (F00632), which is catalytically involved in the attachment of ubiquitin to substrate proteins, and an N-terminal extension with a C2 domain (PF00168) and two to three copies of the WW domain (PF00397) that mediate the substrate specificity." [PMID:18047743]
comment: Category=family.
xref: PIRSF:PIRSF001569
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000000017
name: interferon gamma
def: "A protein that is a translation product of the IFNG gene. The core domain structure consists of a Interferon gamma domain (PF00714) that is four-helical cytokine domain with an additional helix in one of the crossover connections. It is a cytokine produced by lymphocytes activated by specific antigens or mitogens that has important immunoregulatory functions." [PRO:CNA]
comment: Category=gene.
synonym: "Interferon gamma" EXACT []
xref: PIRSF:PIRSF001936
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000000018
name: latent TGF-beta-binding protein
def: "A protein similar in overall domain structure to fibrillins, that is mainly composed of two types of repeated protein domains, namely epidermal growth factor (EGF-like) and TB (8-Cys-like repeats). The latent TGF-beta-binding protein is characterized by having four of the TB domains." [PRO:CNA]
comment: Category=family.
xref: PIRSF:PIRSF037569
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000000019
name: mitogen-activated protein kinase
def: "A protein that is a serine/threonine-specific protein kinase that responds to extracellular stimuli (mitogens) and regulates cellular activities such as gene expression, mitosis, differentiation, and cell survival/apoptosis. The activated form phosphorylates target substrates on Ser or Thr residues followed by a proline. A distinguishing feature is the conserved sequence TxY." [PRO:CNA, Wikipedia:Mitogen-activated_protein_kinase]
comment: Category=family.
synonym: "kinase-related transforming protein " RELATED []
xref: PIRSF:PIRSF501110
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000000020
name: myc protein
def: "A protein with a core domain composition consisting of a Myc amino-terminal region (PF01056) regulatory domain (known as TAD domain), a helix-loop-helix DNA-binding domain (PF00010), and a C-terminal Myc leucine zipper domain (PF02344). Myc proteins participate in the regulation of cell proliferation, cell differentiation, and apoptosis." [PRO:CNA]
comment: Category=family.
xref: PIRSF:PIRSF001705
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000000021
name: noggin protein
def: "A protein that is a translation product of the NOG gene." [PRO:CNA]
comment: Category=gene.
synonym: "NOG" EXACT []
xref: PANTHER:PTHR10494\:SF2
xref: PIRSF:PIRSF008129
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000000022
name: ptx homeobox protein
def: "A protein with a core domain composition consisting of an N-terminal K50 class Homeobox domain (PF00046) and a C-terminal OAR domain (PF03826). The homeobox domain consists of a self-folding, stable protein domain of 60 amino acids in which position 50 can confer a distinct DNA binding specificity. The K50 class of homeodomains recognizes a consensus DNA sequence of TAATCC. Homeodomain-containing proteins are known to play important roles in such diverse activities as embryonic pattern formation, cell-type specification, and differentiation." [PMID:15895993]
comment: Category=family.
xref: PIRSF:PIRSF000563
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000000023
name: retinoblastoma-like protein
def: "A protein with a core domain composition consisting of a Retinoblastoma-associated protein A domain (PF01858) followed by a Retinoblastoma-associated protein B domain (PF01857). The retinoblastoma-like proteins are key regulators of entry into cell division. They are directly involved in heterochromatin formation by maintaining overall chromatin structure and, in particular, that of constitutive heterochromatin by stabilizing histone methylation." [PRO:CNA]
comment: Category=family.
xref: PIRSF:PIRSF037408
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000000024
name: rho-associated protein kinase
def: "A protein that is a translation product of an evolutionary-related gene with core domain composition consisting of an N-terminal Protein kinase domain (PF00069), a Rho Binding domain (PF08912), and a PH domain (PF00169) and a Phorbol esters/diacylglycerol binding domain (C1 domain) (PF00130) at the C-terminus. Rho-associated protein kinases are mediators of many cellular processes by being effectors of the small GTP-binding protein Rho." [PRO:CNA]
comment: Category=family.
synonym: "RHO-ASSOCIATED, COILED-COIL CONTAINING PROTEIN KINASE (PTHR22988:SF3)" EXACT []
xref: PIRSF:PIRSF037568
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000000025
name: ribosomal protein S6 kinase beta
def: "A protein that specifically phosphorylates ribosomal protein S6 in response to insulin and other mitogens. It has a core domain composition consisting of a Protein kinase domain (PF00069) followed by a Protein kinase C terminal domain (PF00433)." [PRO:CNA]
comment: Category=family.
xref: PANTHER:PTHR22985\:SF83
xref: PIRSF:PIRSF000605
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000000026
name: smad anchor for receptor activation
def: "A protein with a core domain composition consisting of a FYVE zinc finger (PF01363) domain and a smad-binding domain that is involved in recruiting and presenting receptor-regulated smads to the receptor complex." [PMID:17356069]
comment: Category=family.
xref: PIRSF:PIRSF037289
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000000027
name: smad protein
def: "A protein with core domain composition consisting of one MH1 domain (PF03165) at the N-terminus and one MH2 domain (PF03166) at the C-terminus, separated by a non-conserved linker region. Smad proteins are mediators of signal transduction in transforming growth factor beta (TGF-beta) superfamily pathways." [PRO:CNA]
comment: Category=family.
xref: PIRSF:PIRSF037286
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000000028
name: small GTPase
def: "A protein with a core domain composition consisting of a Ras family domain (PF00071). The small GTPases are monomeric G-proteins which function as GDP/GTP-regulated molecular switches." [PMID:15731001]
comment: Category=family.
xref: PIRSF:PIRSF001710
xref: PIRSF:PIRSF037165
xref: PIRSF:PIRSF037166
xref: PIRSF:PIRSF037169
xref: PIRSF:PIRSF037502
xref: PIRSF:PIRSF037527
xref: PIRSF:PIRSF038017
xref: PIRSF:PIRSF038482
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000000029
name: thrombospondin subgroup A
def: "A protein with a core domain composition consisting of a procollagen homology domain and three TSR domains at the N-terminus followed by three or four EGF-type repeats, a series of seven contiguous calcium-binding repeats (the thrombospondin type 3 repeats), and a globular carboxyl-terminal domain." [PMID:10842357]
comment: Category=family.
xref: PIRSF:PIRSF002478
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000000030
name: thrombospondin subgroup B
def: "A protein with a core domain composition consisting of three or four EGF-type repeats, a series of seven contiguous calcium-binding repeats (the thrombospondin type 3 repeats), and a globular carboxyl-terminal domain." [PMID:10842357]
comment: Category=family.
xref: PIRSF:PIRSF002479
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000000031
name: transcription adapter with TAZ, KIX and bromo-domains
def: "A protein with a core domain composition consisting of a TAZ zinc finger (PF02135) domain, a KIX domain (PF02172), a Bromodomain (PF00439), a dystrophin zinc finger domain, and a second copy of the TAZ zinc finger (PF02135) domain." [PRO:CNA]
comment: Category=family.
xref: PANTHER:PTHR13808
xref: PIRSF:PIRSF036333
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000000032
name: transcription factor Sp
def: "A protein that is a translation product of an evolutionary-related gene with core domain composition consisting of N-terminal serine/threonine stretches adjacent to one or two glutamine-rich domains, which constitute the activation domains, and three copies of the Zinc finger, C2H2 type (PF00096) domain at the C-terminus that are involved in binding GC/GT-rich promoter elements." [PMID:16209919]
comment: Category=family.
xref: PIRSF:PIRSF037570
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000000033
name: tumor necrosis factor, TNF-like
def: "A protein with a core domain composition consisting of an N-terminal cytosolic domain, a type II transmembrane domain and a C-terminal TNF domain (PF00229)." [PRO:CNA]
comment: Category=family.
xref: PIRSF:PIRSF001873
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000000034
name: BMP
def: "A TGF-beta-like cystine-knot cytokine related to the transforming growth factor-beta, anti-Muellerian hormone, and activin/inhibin protein families, which are all involved in the regulation of cell growth and differentiation. These are produced as dimeric precursors and undergo post-translational processing for activation, requiring cleavage to release bioactive the C-terminal peptide. BMP is involved in body patterning and morphogenesis. BMP signals are transmitted through specific type 2 and type 1 receptors." [PIRSF:PIRSF037272]
comment: Category=family.
xref: PIRSF:PIRSF037272
is_a: PRO:000000008 ! TGF-beta-like cystine-knot cytokine

[Term]
id: PRO:000000035
name: BMP receptor type-1A
def: "A TGF-beta superfamily receptor type-1 that is a translation product of the BMPR1A gene. Bone morphogenetic protein (BMP) signals are transmitted by type 2 and type 1 serine/threonine kinase receptors. Type 2 receptors phosphorylate and activate type 1 receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for BMP2 and BMP4." [PRO:CNA]
comment: Category=gene.
synonym: "Activin receptor-like kinase 3" RELATED []
synonym: "Alk3" EXACT []
synonym: "BMPR1A" RELATED []
synonym: "bone morphogenetic protein receptor type-IA" RELATED []
synonym: "CD292" EXACT []
synonym: "Serine/threonine-protein kinase receptor R5" EXACT []
is_a: PRO:000000006 ! TGF-beta superfamily receptor type-1

[Term]
id: PRO:000000036
name: BMP receptor type-1B
def: "A TGF-beta superfamily receptor type-1 that is a translation product of the BMPR1B gene. Bone morphogenetic protein (BMP) signals are transmitted by type 2 and type 1 serine/threonine kinase receptors. Type 2 receptors phosphorylate and activate type 1 receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for BMPS/OP-1." [PRO:CNA]
comment: Category=gene.
synonym: "bone morphogenetic protein receptor type-1B" RELATED []
synonym: "bone morphogenetic protein receptor type-IB" RELATED []
is_a: PRO:000000006 ! TGF-beta superfamily receptor type-1

[Term]
id: PRO:000000037
name: BMP receptor type-2
def: "A TGF-beta superfamily receptor type-2 with activin receptor domain that is a translation product of the BMPR2 gene. Bone morphogenetic protein (BMP) signals are transmitted by type 2 and type 1 serine/threonine kinase receptors. Type 2 receptors phosphorylate and activate type 1 receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators." [PRO:CNA]
comment: Category=gene.
synonym: "Bone morphogenetic protein receptor type-2" RELATED []
xref: PIRSF:PIRSF500434
is_a: PRO:000000007 ! TGF-beta superfamily receptor type-2 with activin receptor domain

[Term]
id: PRO:000000038
name: BMP receptor-regulated smad protein
def: "A smad protein which mediates signal transduction through activation of bone morphogenetic protein (BMP) or anti-Mullerian hormone pathways." [PMID:11532220]
comment: Category=family.
xref: PANTHER:PTHR13703\:SF19
xref: PIRSF:PIRSF500500
is_a: PRO:000000027 ! smad protein

[Term]
id: PRO:000000039
name: DNA-binding protein inhibitor ID-1
def: "A HLH DNA-binding protein inhibitor that is a translation product of the ID1 gene. This gene has two conserved protein coding exons." [PRO:CNA]
comment: Category=gene.
synonym: "ID1" EXACT []
xref: PIRSF:PIRSF500477
is_a: PRO:000000003 ! HLH DNA-binding protein inhibitor

[Term]
id: PRO:000000040
name: DNA-binding protein inhibitor ID-2
def: "A HLH DNA-binding protein inhibitor that is a translation product of the ID2 gene." [PRO:CNA]
comment: Category=gene.
synonym: "ID2" EXACT []
xref: PIRSF:PIRSF500498
is_a: PRO:000000003 ! HLH DNA-binding protein inhibitor

[Term]
id: PRO:000000041
name: DNA-binding protein inhibitor ID-3
def: "A HLH DNA-binding protein inhibitor that is a translation product of the ID3 gene." [PRO:CNA]
comment: Category=gene.
synonym: "ID3" RELATED []
xref: PIRSF:PIRSF500479
is_a: PRO:000000003 ! HLH DNA-binding protein inhibitor

[Term]
id: PRO:000000042
name: DNA-binding protein inhibitor ID-4
def: "A HLH DNA-binding protein inhibitor that is a translation product of the ID4 gene." [PRO:CNA]
comment: Category=gene.
synonym: "ID4" RELATED []
xref: PIRSF:PIRSF500478
is_a: PRO:000000003 ! HLH DNA-binding protein inhibitor

[Term]
id: PRO:000000043
name: RING-box protein 1
def: "A protein that is a translation product of the RBX1 gene." [PRO:CNA]
comment: Category=gene.
synonym: "RBX1" EXACT []
is_a: PRO:000000004 ! RING-box protein

[Term]
id: PRO:000000044
name: RING-box protein 2
def: "A protein that is a translation product of the RNF7 gene." [PRO:CNA]
comment: Category=gene.
synonym: "CKII beta-binding protein 1" RELATED []
synonym: "RBX2" EXACT []
synonym: "ROC2" RELATED []
synonym: "SAG" RELATED []
synonym: "Sensitive to apoptosis gene protein" RELATED []
xref: PIRSF:PIRSF500725
is_a: PRO:000000004 ! RING-box protein

[Term]
id: PRO:000000045
name: S-phase kinase-associated protein 1A
def: "An E3 ubiquitin ligase SFC complex Skp1 subunit that is a translation product of the SKP1 gene. This gene has 5 conserved protein coding exons." [PRO:CNA]
comment: Category=gene.
synonym: "SKP1" RELATED []
synonym: "SKP1A" RELATED []
is_a: PRO:000000002 ! E3 ubiquitin ligase SFC complex Skp1 subunit

[Term]
id: PRO:000000046
name: TGF-beta
def: "A TGFB-like cystine-knot cytokine whose propeptide region is a latent associated peptide (LAP) that remains associated to the mature TGF-beta after cleavage and secretion, keeping TGF-beta inactive. TGF-beta is the founding member of the cystine-knot cytokine family, and is related to the activin/inhibin, anti-Muellerian hormone, and bone morphogenic protein families, which are all involved in the regulation of cell growth and differentiation." [PIRSF:PIRSF001787]
comment: Category=family.
synonym: "transforming growth factor beta" RELATED []
xref: PIRSF:PIRSF001787
is_a: PRO:000000008 ! TGF-beta-like cystine-knot cytokine

[Term]
id: PRO:000000047
name: TGF-beta receptor type-1
def: "A TGF-beta superfamily receptor type-1 that is a translation product of the TGFBR1 gene." [PRO:CNA]
comment: Category=gene.
synonym: "Activin receptor-like kinase 5" EXACT []
synonym: "ALK-5" EXACT []
synonym: "ESK2" EXACT []
synonym: "Serine/threonine-protein kinase receptor R4" EXACT []
synonym: "SKR4" EXACT []
synonym: "TbetaR-I" EXACT []
synonym: "TGF-beta type I receptor" EXACT []
synonym: "TGFBR1" RELATED []
synonym: "TGFR-1" EXACT []
synonym: "Transforming growth factor-beta receptor type I" EXACT []
is_a: PRO:000000006 ! TGF-beta superfamily receptor type-1

[Term]
id: PRO:000000048
name: TGF-beta receptor type-2 isoform 1
def: "A TGF-beta receptor type-2 that is a translation product of a mature transcript of the TGFBR2 gene, and that includes the core domains. This form is represented by the mouse sequence UniProtKB:Q62312-2." [PMID:7957954]
comment: Category=sequence.
synonym: "Isoform RII-1" EXACT []
is_a: PRO:000000005 ! TGF-beta receptor type-2

[Term]
id: PRO:000000049
name: TGF-beta receptor type-2 isoform 2
def: "A TGF-beta receptor type-2 that is a translation product of a mature transcript of the TGFBR2 gene, and that includes the core domains with an insertion of approximately 25 amino acids in the ectodomain just adjacent to the signal peptide. This form is represented by the mouse sequence UniProtKB:Q62312-1." [PMID:7957954]
comment: Category=sequence.
synonym: "Isoform RII-2" EXACT []
is_a: PRO:000000005 ! TGF-beta receptor type-2

[Term]
id: PRO:000000050
name: TGF-beta receptor type-2 sequence variant 1
def: "A TGF-beta receptor type-2 that is a translation product of a polymorphic sequence variant of TGFBR2 gene that has a Pro residue at the position equivalent to Leu-308 in human sequence UniProtKB:P37173-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000005 ! TGF-beta receptor type-2

[Term]
id: PRO:000000051
name: TGF-beta receptor type-2 sequence variant 10
def: "A TGF-beta receptor type-2 that is a translation product of a polymorphic sequence variant of TGFBR2 gene that has a His residue at the position equivalent to Arg-460 in human sequence UniProtKB:P37173-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000005 ! TGF-beta receptor type-2

[Term]
id: PRO:000000052
name: TGF-beta receptor type-2 sequence variant 11
def: "A TGF-beta receptor type-2 that is a translation product of a polymorphic sequence variant of TGFBR2 gene that has a Cys residue at the position equivalent to Arg-460 in human sequence UniProtKB:P37173-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000005 ! TGF-beta receptor type-2

[Term]
id: PRO:000000053
name: TGF-beta receptor type-2 sequence variant 12
def: "A TGF-beta receptor type-2 that is a translation product of a polymorphic sequence variant of TGFBR2 gene that has a Glu residue at the position equivalent to Gln-526 in human sequence UniProtKB:P37173-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000005 ! TGF-beta receptor type-2

[Term]
id: PRO:000000054
name: TGF-beta receptor type-2 sequence variant 13
def: "A TGF-beta receptor type-2 that is a translation product of a polymorphic sequence variant of TGFBR2 gene that has a Cys residue at the position equivalent to Arg-528 in human sequence UniProtKB:P37173-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000005 ! TGF-beta receptor type-2

[Term]
id: PRO:000000055
name: TGF-beta receptor type-2 sequence variant 14
def: "A TGF-beta receptor type-2 that is a translation product of a polymorphic sequence variant of TGFBR2 gene that has a His residue at the position equivalent to Arg-528 in human sequence UniProtKB:P37173-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000005 ! TGF-beta receptor type-2

[Term]
id: PRO:000000056
name: TGF-beta receptor type-2 sequence variant 15
def: "A TGF-beta receptor type-2 that is a translation product of a polymorphic sequence variant of TGFBR2 gene that has a Cys residue at the position equivalent to Arg-537 in human sequence UniProtKB:P37173-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000005 ! TGF-beta receptor type-2

[Term]
id: PRO:000000057
name: TGF-beta receptor type-2 sequence variant 16
def: "A TGF-beta receptor type-2 that is a translation product of a polymorphic sequence variant of TGFBR2 gene that has a Trp residue at the position equivalent to Gly-357 in human sequence UniProtKB:P37173-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000005 ! TGF-beta receptor type-2

[Term]
id: PRO:000000058
name: TGF-beta receptor type-2 sequence variant 2
def: "A TGF-beta receptor type-2 that is a translation product of a polymorphic sequence variant of TGFBR2 gene that has a Met residue at the position equivalent to Thr-315 in human sequence UniProtKB:P37173-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000005 ! TGF-beta receptor type-2

[Term]
id: PRO:000000059
name: TGF-beta receptor type-2 sequence variant 3
def: "A TGF-beta receptor type-2 that is a translation product of a polymorphic sequence variant of TGFBR2 gene that has a Asn residue at the position equivalent to Tyr-336 in human sequence UniProtKB:P37173-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000005 ! TGF-beta receptor type-2

[Term]
id: PRO:000000060
name: TGF-beta receptor type-2 sequence variant 4
def: "A TGF-beta receptor type-2 that is a translation product of a polymorphic sequence variant of TGFBR2 gene that has a Pro residue at the position equivalent to Ala-355 in human sequence UniProtKB:P37173-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000005 ! TGF-beta receptor type-2

[Term]
id: PRO:000000061
name: TGF-beta receptor type-2 sequence variant 5
def: "A TGF-beta receptor type-2 that is a translation product of a polymorphic sequence variant of TGFBR2 gene that has a Met residue at the position equivalent to Val-387 in human sequence UniProtKB:P37173-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000005 ! TGF-beta receptor type-2

[Term]
id: PRO:000000062
name: TGF-beta receptor type-2 sequence variant 6
def: "A TGF-beta receptor type-2 that is a translation product of a polymorphic sequence variant of TGFBR2 gene that has a Ser residue at the position equivalent to Asn-435 in human sequence UniProtKB:P37173-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000005 ! TGF-beta receptor type-2

[Term]
id: PRO:000000063
name: TGF-beta receptor type-2 sequence variant 7
def: "A TGF-beta receptor type-2 that is a translation product of a polymorphic sequence variant of TGFBR2 gene that has a Ala residue at the position equivalent to Val-447 in human sequence UniProtKB:P37173-1. This form is involved in breast tumors." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000005 ! TGF-beta receptor type-2

[Term]
id: PRO:000000064
name: TGF-beta receptor type-2 sequence variant 8
def: "A TGF-beta receptor type-2 that is a translation product of a polymorphic sequence variant of TGFBR2 gene that has a Phe residue at the position equivalent to Ser-449 in human sequence UniProtKB:P37173-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000005 ! TGF-beta receptor type-2

[Term]
id: PRO:000000065
name: TGF-beta receptor type-2 sequence variant 9
def: "A TGF-beta receptor type-2 that is a translation product of a polymorphic sequence variant of TGFBR2 gene that has a Met residue at the position equivalent to Leu-452 in human sequence UniProtKB:P37173-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000005 ! TGF-beta receptor type-2

[Term]
id: PRO:000000066
name: TGF-beta receptor-regulated smad protein
def: "A smad protein that mediates signal transduction through activation of transforming growth factor beta (TGF-beta) or activin pathways." [PMID:11532220]
comment: Category=family.
xref: PIRSF:PIRSF500455
is_a: PRO:000000027 ! smad protein

[Term]
id: PRO:000000067
name: activin receptor type-1
def: "A TGF-beta superfamily receptor type-1 that is a translation product of the ACVR1 gene." [PRO:CNA]
comment: Category=gene.
synonym: "ACTR-I " RELATED []
synonym: "ACVR1" RELATED []
synonym: "ACVRLK2" RELATED []
synonym: "ALK-2" RELATED []
synonym: "SKR1" RELATED []
synonym: "TSR-I" RELATED []
is_a: PRO:000000006 ! TGF-beta superfamily receptor type-1

[Term]
id: PRO:000000068
name: activin receptor type-1B
def: "A TGF-beta superfamily receptor type-1 that is a translation product of the ACVR1B gene." [PRO:CNA]
comment: Category=gene.
synonym: "ACVR1B" RELATED []
synonym: "ALK-4" RELATED []
is_a: PRO:000000006 ! TGF-beta superfamily receptor type-1

[Term]
id: PRO:000000069
name: activin receptor type-1C
def: "A TGF-beta superfamily receptor type-1 that is a translation product of the ACVR1C gene." [PRO:CNA]
comment: Category=gene.
synonym: "ACVR1C" RELATED []
is_a: PRO:000000006 ! TGF-beta superfamily receptor type-1

[Term]
id: PRO:000000070
name: activin receptor type-2A
def: "A TGF-beta superfamily receptor type-2 with activin receptor domain that is a translation product of the ACVR2A gene." [PRO:CNA]
comment: Category=gene.
synonym: "ACVR2A" EXACT []
xref: PIRSF:PIRSF500457
is_a: PRO:000000007 ! TGF-beta superfamily receptor type-2 with activin receptor domain

[Term]
id: PRO:000000071
name: activin receptor type-2B
def: "A TGF-beta superfamily receptor type-2 with activin receptor domain that is a translation product of the ACVR2B gene." [PRO:CNA]
comment: Category=gene.
synonym: "ActR-IIB" RELATED []
synonym: "ACVR2B" EXACT []
xref: PIRSF:PIRSF500456
is_a: PRO:000000007 ! TGF-beta superfamily receptor type-2 with activin receptor domain

[Term]
id: PRO:000000072
name: activin/inhibin beta subunit
def: "A TGF-beta-like cystine-knot cytokine that is the beta subunit of inhibin and activin complexes. Related to the transforming growth factor-beta, anti-Muellerian hormone, and bone morphogenic protein families which are all involved in the regulation of cell growth and differentiation." [PRO:CNA]
comment: Category=family.
xref: PIRSF:PIRSF037268
is_a: PRO:000000008 ! TGF-beta-like cystine-knot cytokine

[Term]
id: PRO:000000073
name: anti-Muellerian hormone
def: "A TGF-beta-like cystine-knot cytokine that is a translation product of the AMH gene. Related to the transforming growth factor-beta, activin/inhibin, and bone morphogenic protein families which are all involved in the regulation of cell growth and differentiation." [PRO:CNA]
comment: Category=gene.
synonym: "AMH" EXACT []
synonym: "MIS" RELATED []
synonym: "Muellerian-inhibiting factor" RELATED []
synonym: "Muellerian-inhibiting substance" RELATED []
xref: PIRSF:PIRSF037270
is_a: PRO:000000008 ! TGF-beta-like cystine-knot cytokine

[Term]
id: PRO:000000074
name: anti-Muellerian hormone type-2 receptor isoform 1
def: "An anti-Muellerian hormone type-2 receptor that is a translation product of a mature transcript of AMHR2 gene represented by the human sequence UniProtKB:Q16671-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000009 ! anti-Muellerian hormone type-2 receptor

[Term]
id: PRO:000000075
name: anti-Muellerian hormone type-2 receptor sequence variant 1
def: "An anti-Muellerian hormone type-2 receptor that is a translation product of a polymorphic sequence variant of AMHR2 gene that has a Cys residue at the position equivalent to Arg-54 in human sequence UniProtKB:Q16671-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000009 ! anti-Muellerian hormone type-2 receptor

[Term]
id: PRO:000000076
name: anti-Muellerian hormone type-2 receptor sequence variant 2
def: "An anti-Muellerian hormone type-2 receptor that is a translation product of a polymorphic sequence variant of AMHR2 gene that has a Val residue at the position equivalent to Gly-142 in human sequence UniProtKB:Q16671-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000009 ! anti-Muellerian hormone type-2 receptor

[Term]
id: PRO:000000077
name: anti-Muellerian hormone type-2 receptor sequence variant 3
def: "An anti-Muellerian hormone type-2 receptor that is a translation product of a polymorphic sequence variant of AMHR2 gene that has a Gln residue at the position equivalent to His-282 in human sequence UniProtKB:Q16671-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000009 ! anti-Muellerian hormone type-2 receptor

[Term]
id: PRO:000000078
name: anti-Muellerian hormone type-2 receptor sequence variant 4
def: "An anti-Muellerian hormone type-2 receptor that is a translation product of a polymorphic sequence variant of AMHR2 gene that has a Gln residue at the position equivalent to Arg-406 in human sequence UniProtKB:Q16671-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000009 ! anti-Muellerian hormone type-2 receptor

[Term]
id: PRO:000000079
name: anti-Muellerian hormone type-2 receptor sequence variant 5
def: "An anti-Muellerian hormone type-2 receptor that is a translation product of a polymorphic sequence variant of AMHR2 gene that has a Gly residue at the position equivalent to Asp-426 in human sequence UniProtKB:Q16671-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000009 ! anti-Muellerian hormone type-2 receptor

[Term]
id: PRO:000000080
name: anti-Muellerian hormone type-2 receptor sequence variant 6
def: "An anti-Muellerian hormone type-2 receptor that is a translation product of a polymorphic sequence variant of AMHR2 gene that has a Ala residue at the position equivalent to Val-458 in human sequence UniProtKB:Q16671-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000009 ! anti-Muellerian hormone type-2 receptor

[Term]
id: PRO:000000081
name: anti-Muellerian hormone type-2 receptor sequence variant 7
def: "An anti-Muellerian hormone type-2 receptor that is a translation product of a polymorphic sequence variant of AMHR2 gene that has a His residue at the position equivalent to Asp-491 in human sequence UniProtKB:Q16671-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000009 ! anti-Muellerian hormone type-2 receptor

[Term]
id: PRO:000000082
name: anti-Muellerian hormone type-2 receptor sequence variant 8
def: "An anti-Muellerian hormone type-2 receptor that is a translation product of a polymorphic sequence variant of AMHR2 gene that has a Cys residue at the position equivalent to Arg-504 in human sequence UniProtKB:Q16671-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000009 ! anti-Muellerian hormone type-2 receptor

[Term]
id: PRO:000000083
name: anti-Muellerian hormone type-2 receptor sequence variant 9
def: "An anti-Muellerian hormone type-2 receptor that is a translation product of the AMHR2 gene with a mutation causing amino acid deletion at the position equivalent to region 444-452 in the human sequence UniProtKB:Q16671-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000009 ! anti-Muellerian hormone type-2 receptor

[Term]
id: PRO:000000084
name: c-myc protein
def: "A myc protein that is a translation product of the MYC gene. The gene has 3 exons, with exon 1 lacking ATG codons." [PRO:CNA]
comment: Category=gene.
synonym: "myc proto-oncogene protein" RELATED []
synonym: "transcription factor p64" RELATED []
is_a: PRO:000000020 ! myc protein

[Term]
id: PRO:000000085
name: cartilage oligomeric matrix protein
def: "A thrombospondin subgroup B that is a translation product of the COMP gene." [PRO:CNA]
comment: Category=gene.
synonym: "COMP" RELATED []
is_a: PRO:000000030 ! thrombospondin subgroup B

[Term]
id: PRO:000000086
name: chordin isoform 1
def: "A chordin that is a translation product of a mature transcript of the CHRD gene, and that is the precursor with the signal peptide, one N-terminal and three C-terminal von Willebrand factor type C domains, and four chrd domains in between." [PMID:10479448, PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000010 ! chordin

[Term]
id: PRO:000000087
name: chordin isoform 2
def: "A chordin that is a translation product of a mature transcript of the CHRD gene that is a truncated protein with only the signal peptide and a partial N-terminal von Willebrand factor type C domain." [PMID:11472837, PRO:CNA]
comment: Category=sequence.
synonym: "P-CR1" RELATED []
is_a: PRO:000000010 ! chordin

[Term]
id: PRO:000000088
name: chordin isoform 3
def: "A chordin that is a translation product of a mature transcript of the CHRD gene that is a truncated protein with the signal peptide, the N-terminal von Willebrand factor type C domain, and one partial chrd domain." [PMID:11472837, PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000010 ! chordin

[Term]
id: PRO:000000089
name: chordin isoform 4
def: "A chordin that is a translation product of a mature transcript of the CHRD gene that is a truncated protein with the signal peptide, the N-terminal and only 1 C-terminal von Willebrand factor type C domain, and four chrd domains in between." [PRO:CNA]
comment: Category=sequence.
synonym: "CHRD sequence 4 cleaved-1" EXACT []
is_a: PRO:000000010 ! chordin

[Term]
id: PRO:000000090
name: creb-binding protein
def: "A transcription adapter with TAZ, KIX and bromo-domains that is a translation product of the CREBBP gene." [PRO:CNA]
comment: Category=gene.
synonym: "CBP" RELATED []
synonym: "CREBBP" RELATED []
is_a: PRO:000000031 ! transcription adapter with TAZ, KIX and bromo-domains

[Term]
id: PRO:000000091
name: creb-binding protein/zinc finger protein HRX
def: "A creb-binding protein/zinc finger protein HRX product which consists of part of CREBBP gene at the N-terminus and part of MYST4 gene at the C-terminus. This form is observed in some cases of acute myelogenous leukemia where chromosomal translocation occurs." [PMID:11157802]
comment: Category=sequence.
synonym: "CBP/MORF" RELATED []
is_a: PRO:000000012 ! creb-binding protein/zinc finger protein HRX chimera

[Term]
id: PRO:000000092
name: cullin 1
def: "A cullin that is a translation product of the CUL1 gene." [PRO:CNA]
comment: Category=gene.
synonym: "CUL1" RELATED []
xref: PANTHER:PTHR11932\:SF19
is_a: PRO:000000013 ! cullin

[Term]
id: PRO:000000093
name: cyclin-dependent kinase 4 inhibitor
def: "A cyclin-dependent kinase inhibitor that is a translation product of the CDKN2B gene." [PRO:CNA]
comment: Category=gene.
synonym: "CDKN2B" RELATED []
synonym: "cyclin-dependent kinase 4 inhibitor B" EXACT []
synonym: "INK4" RELATED []
synonym: "Multiple tumor suppressor 2" RELATED []
synonym: "p14-INK4b" RELATED []
synonym: "p15-INK4b" RELATED []
xref: PANTHER:PTHR18958\:SF138
is_a: PRO:000000014 ! cyclin-dependent kinase inhibitor

[Term]
id: PRO:000000094
name: decorin
def: "A class 1 small leucine-rich proteoglycan that is a translation product of the DCN gene." [PRO:CNA]
comment: Category=gene.
synonym: "bone proteoglycan 2" RELATED []
synonym: "DCN" RELATED []
synonym: "PG-S2" RELATED []
is_a: PRO:000000011 ! class 1 small leucine-rich proteoglycan

[Term]
id: PRO:000000095
name: fas ligand, TNF-like
def: "A tumor necrosis factor that is a translation product of the FASLG gene." [PRO:CNA]
comment: Category=gene.
synonym: "FAS antigen ligand" EXACT []
synonym: "FASLG" RELATED []
synonym: "Tumor necrosis factor ligand superfamily member 6" RELATED []
xref: PANTHER:PTHR11471\:SF7
is_a: PRO:000000033 ! tumor necrosis factor, TNF-like

[Term]
id: PRO:000000096
name: follistatin isoform 1
def: "A follistatin that is a translation product of a mature transcript of the FST gene including all protein coding exons, and is the precursor of the mature protein." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000015 ! follistatin

[Term]
id: PRO:000000097
name: follistatin isoform 2
def: "A follistatin that is a translation product of a mature transcript of the FST gene, without the C-terminal acidic region." [PMID:8340384]
comment: Category=sequence.
synonym: "FS288" RELATED []
is_a: PRO:000000015 ! follistatin

[Term]
id: PRO:000000098
name: growth/differentiation factor
def: "A TGF-beta-like cystine-knot cytokine closely related to the BMP family. These are produced as dimeric precursors and undergo post-translational processing for activation, requiring cleavage to release the bioactive C-terminal peptide. GDFs act as signaling molecules during embryonic tendon/ligament formation." [PRO:CNA]
comment: Category=family.
is_a: PRO:000000008 ! TGF-beta-like cystine-knot cytokine

[Term]
id: PRO:000000099
name: inhibitory smad protein
def: "A smad protein that is an antagonist of the transforming growth factor beta (TGF-beta) superfamily signaling pathways. It lacks the C-terminal SSxS motif, necessary for receptor mediated phosphorylation that is present in the receptor-regulated smads." [PMID:11532220]
comment: Category=family.
xref: PIRSF:PIRSF500412
is_a: PRO:000000027 ! smad protein

[Term]
id: PRO:000000100
name: interferon gamma isoform 1
def: "An interferon gamma that is a translation product of a mature transcript of IFNG gene represented by the human sequence UniProtKB:P01579-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000017 ! interferon gamma

[Term]
id: PRO:000000101
name: latent TGF-beta-binding protein 1
def: "A latent TGF-beta-binding protein that is a translation product of the LTBP1 gene." [PRO:CNA]
comment: Category=gene.
synonym: "LTBP1" RELATED []
synonym: "short isoform" RELATED []
is_a: PRO:000000018 ! latent TGF-beta-binding protein

[Term]
id: PRO:000000102
name: lefty protein
def: "A TGF-beta-like cystine-knot cytokine that is an antagonist of nodal signaling. The nodal and lefty genes form positive and negative regulatory loops that resemble the reaction-diffusion system. As a pair, these genes control various events of vertebrate embryonic patterning, including left-right specification and mesoderm formation." [PRO:CNA]
comment: Category=family.
xref: PIRSF:PIRSF037402
is_a: PRO:000000008 ! TGF-beta-like cystine-knot cytokine

[Term]
id: PRO:000000103
name: mitogen-activated protein kinase 1
def: "A mitogen-activated protein kinase that is a translation product of the MAPK1 gene." [PRO:CNA]
comment: Category=gene.
synonym: "ERK-2" RELATED []
synonym: "MAPK1" RELATED []
synonym: "MAPK2" RELATED []
synonym: "p38" RELATED []
is_a: PRO:000000019 ! mitogen-activated protein kinase

[Term]
id: PRO:000000104
name: mitogen-activated protein kinase 3
def: "A mitogen-activated protein kinase that is a translation product of the MAPK3 gene." [PRO:CNA]
comment: Category=gene.
synonym: "ERK-1" RELATED []
synonym: "MAPK3" RELATED []
is_a: PRO:000000019 ! mitogen-activated protein kinase

[Term]
id: PRO:000000105
name: nodal protein
def: "A TGF-beta-like cystine-knot cytokine that is a translation product of the NODAL gene. The nodal and lefty genes form positive and negative regulatory loops that resemble the reaction-diffusion system. As a pair, these genes control various events of vertebrate embryonic patterning, including left-right specification and mesoderm formation." [PRO:CNA]
comment: Category=gene.
synonym: "NODAL" EXACT []
xref: PIRSF:PIRSF037400
is_a: PRO:000000008 ! TGF-beta-like cystine-knot cytokine

[Term]
id: PRO:000000106
name: noggin isoform 1
def: "A noggin protein that is a translation product of a mature transcript of the NOG gene, that is the precursor protein and it is represented by the human sequence UniProtKB:Q13253-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000021 ! noggin protein

[Term]
id: PRO:000000107
name: noggin sequence variant 1
def: "A noggin protein that is a translation product of the NOG gene that has a Ser residue at the position equivalent to Pro-35 in the human sequence UniProtKB:Q13253-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000021 ! noggin protein

[Term]
id: PRO:000000108
name: noggin sequence variant 10
def: "A noggin protein that is a translation product of the NOG gene that has a Leu residue at the position equivalent to Pro-223 in the human sequence UniProtKB:Q13253-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000021 ! noggin protein

[Term]
id: PRO:000000109
name: noggin sequence variant 2
def: "A noggin protein that is a translation product of the NOG gene that has an Arg residue at the position equivalent to Pro-35 in the human sequence UniProtKB:Q13253-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000021 ! noggin protein

[Term]
id: PRO:000000110
name: noggin sequence variant 3
def: "A noggin protein that is a translation product of the NOG gene that has a Tyr residue at the position equivalent to Cys-184 in the human sequence UniProtKB:Q13253-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000021 ! noggin protein

[Term]
id: PRO:000000111
name: noggin sequence variant 4
def: "A noggin protein that is a translation product of the NOG gene that has a Cys residue at the position equivalent to Gly-189 in the human sequence UniProtKB:Q13253-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000021 ! noggin protein

[Term]
id: PRO:000000112
name: noggin sequence variant 5
def: "A noggin protein that is a translation product of the NOG gene that has a Leu residue at the position equivalent to Arg-204 in the human sequence UniProtKB:Q13253-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000021 ! noggin protein

[Term]
id: PRO:000000113
name: noggin sequence variant 6
def: "A noggin protein that is a translation product of the NOG gene that has a Gly residue at the position equivalent to Trp-217 in the human sequence UniProtKB:Q13253-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000021 ! noggin protein

[Term]
id: PRO:000000114
name: noggin sequence variant 7
def: "A noggin protein that is a translation product of the NOG gene that has a Asn residue at the position equivalent to Ile-220 in the human sequence UniProtKB:Q13253-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000021 ! noggin protein

[Term]
id: PRO:000000115
name: noggin sequence variant 8
def: "A noggin protein that is a translation product of the NOG gene that has a Cys residue at the position equivalent to Tyr-222 in the human sequence UniProtKB:Q13253-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000021 ! noggin protein

[Term]
id: PRO:000000116
name: noggin sequence variant 9
def: "A noggin protein that is a translation product of the NOG gene that has a Asp residue at the position equivalent to Tyr-222 in the human sequence UniProtKB:Q13253-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000021 ! noggin protein

[Term]
id: PRO:000000117
name: pituitary homeobox protein 2
def: "A ptx homeobox protein that is a translation product of the PITX2 gene. The PITX2 gene contains 6 conserved exons." [PRO:CNA]
comment: Category=gene.
synonym: "PITX2" RELATED []
is_a: PRO:000000022 ! ptx homeobox protein

[Term]
id: PRO:000000118
name: retinoblastoma-like protein 1
def: "A retinoblastoma-like protein that is a translation product of the RBL1 gene." [PRO:CNA]
comment: Category=gene.
synonym: "P107" RELATED []
synonym: "RBL1" EXACT []
is_a: PRO:000000023 ! retinoblastoma-like protein

[Term]
id: PRO:000000119
name: retinoblastoma-like protein 2
def: "A retinoblastoma-like protein that is a translation product of the RBL2 gene." [PRO:CNA]
comment: Category=gene.
synonym: "P130" RELATED []
synonym: "RBL2" EXACT []
is_a: PRO:000000023 ! retinoblastoma-like protein

[Term]
id: PRO:000000120
name: rho-associated protein kinase 1
def: "A rho-associated protein kinase that is a translation product of the ROCK1 gene." [PRO:CNA]
comment: Category=gene.
synonym: "ROCK1" RELATED []
is_a: PRO:000000024 ! rho-associated protein kinase

[Term]
id: PRO:000000121
name: rho-associated protein kinase 2
def: "A rho-associated protein kinase that is a translation product of the ROCK2 gene." [PRO:CNA]
comment: Category=gene.
synonym: "ROCK2" RELATED []
is_a: PRO:000000024 ! rho-associated protein kinase

[Term]
id: PRO:000000122
name: rho-related small GTPase
def: "A small GTPase with a short insert (approximately 13 residues) coincident with loop 8 of Ras. This insert region forms a highly charged helix without dramatic disturbance of the global structure shared with other small GTPases. Rho-related small GTPases act as key transducers of extracellular signals to regulate the actin cytoskeleton, cell cycle progression and gene expression." [PMID:11463812]
comment: Category=family.
xref: PIRSF:PIRSF037169
is_a: PRO:000000028 ! small GTPase

[Term]
id: PRO:000000123
name: ribosomal protein S6 kinase beta 1
def: "A ribosomal protein S6 kinase beta that is a translation product of the RPS6KB1 gene." [PRO:CNA]
comment: Category=gene.
synonym: "RPS6KB1" RELATED []
is_a: PRO:000000025 ! ribosomal protein S6 kinase beta

[Term]
id: PRO:000000124
name: ribosomal protein S6 kinase beta 2
def: "A ribosomal protein S6 kinase beta that is a translation product of the RPS6KB2 gene." [PRO:CNA]
comment: Category=gene.
synonym: "RPS6KB2" RELATED []
is_a: PRO:000000025 ! ribosomal protein S6 kinase beta

[Term]
id: PRO:000000125
name: sara
def: "A smad anchor for receptor activation that is a translation product of the ZFYVE9 gene." [PRO:CNA]
comment: Category=gene.
synonym: "SARA" RELATED []
synonym: "ZFYVE9" RELATED []
is_a: PRO:000000026 ! smad anchor for receptor activation

[Term]
id: PRO:000000126
name: serine/threonine-protein kinase receptor R3
def: "A TGF-beta superfamily receptor type-1 that is a translation product of the ACVRL1 gene." [PRO:CNA]
comment: Category=gene.
synonym: "Activin receptor-like kinase 1 " RELATED []
synonym: "ALK-1" RELATED []
synonym: "AVCL1" RELATED []
synonym: "SKR3" RELATED []
synonym: "TSR-I" RELATED []
is_a: PRO:000000006 ! TGF-beta superfamily receptor type-1

[Term]
id: PRO:000000127
name: smad ubiquitination regulatory factor
def: "A HECT-domain-containing E3 ubiquitin-protein ligase with WW domains that mediates smad ubiquitination." [PRO:CNA]
comment: Category=family.
synonym: "smurf" EXACT []
xref: PIRSF:PIRSF500454
is_a: PRO:000000016 ! HECT-domain-containing E3 ubiquitin-protein ligase with WW domains

[Term]
id: PRO:000000128
name: smad4
def: "A smad protein that is a translation product of the SMAD4 gene. It lacks the C-terminal SSxS motif, necessary for receptor mediated phosphorylation, that is present in the receptor-regulated smads." [PMID:10708949, PRO:CNA]
comment: Category=gene.
synonym: "Deletion target in pancreatic carcinoma 4" EXACT []
synonym: "Deletion target in pancreatic carcinoma 4 homolog" EXACT []
synonym: "DPC4" RELATED []
synonym: "MADH4" RELATED []
synonym: "Mothers against decapentaplegic homolog 4" RELATED []
synonym: "Mothers against DPP homolog 4" EXACT []
synonym: "SMAD 4" EXACT []
xref: PIRSF:PIRSF500408
is_a: PRO:000000027 ! smad protein

[Term]
id: PRO:000000129
name: thrombospondin 1
def: "A thrombospondin subgroup A that is a translation product of the THBS1 gene." [PRO:CNA]
comment: Category=gene.
synonym: "THBS1" EXACT []
xref: PANTHER:PTHR10199\:SF9
is_a: PRO:000000029 ! thrombospondin subgroup A

[Term]
id: PRO:000000130
name: thrombospondin 2
def: "A thrombospondin subgroup A that is a translation product of the THBS2 gene." [PRO:CNA]
comment: Category=gene.
synonym: "THBS2" EXACT []
is_a: PRO:000000029 ! thrombospondin subgroup A

[Term]
id: PRO:000000131
name: thrombospondin 3
def: "A thrombospondin subgroup B that is a translation product of the THBS3 gene." [PRO:CNA]
comment: Category=gene.
synonym: "THBS3" EXACT []
is_a: PRO:000000030 ! thrombospondin subgroup B

[Term]
id: PRO:000000132
name: thrombospondin 4
def: "A thrombospondin subgroup B that is a translation product of the THBS4 gene." [PRO:CNA]
comment: Category=gene.
synonym: "THSB4" RELATED []
is_a: PRO:000000030 ! thrombospondin subgroup B

[Term]
id: PRO:000000133
name: transcription factor Sp1
def: "A transcription factor Sp that is a translation product of the SP1 gene. It comprises the exons that code for an N-terminal inhibitory domain, two serine/threonine stretches adjacent to activation domains and three zinc fingers." [PRO:CNA]
comment: Category=gene.
synonym: "transcription factor Sp1" EXACT []
xref: PANTHER:PTHR23235\:SF4
xref: PIRSF:PIRSF500820
is_a: PRO:000000032 ! transcription factor Sp

[Term]
id: PRO:000000134
name: tumor necrosis factor alpha
def: "A tumor necrosis factor, TNF-like that is a translation product of the TNF gene. Tumour necrosis factor alpha (TNF) is a pleiotropic cytokine that mediates apoptosis, cell proliferation, immunomodulation, inflammation, viral replication, allergy, arthritis, septic shock, insulin resistance, autoimmune diseases, and other pathological conditions. TNF transduces these cellular responses through two distinct receptors: type I, which are expressed on all cell types, and type II, which are expressed only on cells of the immune system and endothelial cells." [PMID:11053079, PRO:CNA]
comment: Category=gene.
synonym: "TNF" EXACT []
xref: PIRSF:PIRSF500467
is_a: PRO:000000033 ! tumor necrosis factor, TNF-like

[Term]
id: PRO:000000135
name: zinc finger protein HRX/creb-binding protein
def: "A creb-binding protein/zinc finger protein HRX product which consists of part of MYST4 gene at the N-terminus and part of CREBBP gene at the C-terminus. It includes the zinc fingers, 2 nuclear localization signals, the histone acetyltransferase (HAT) domain, a portion of the acidic domain of MYST4, and the zinc fingers, KIX domain, bromodomain and CREB-binding domain from CREBBP. This form is observed in some cases of acute myelogenous leukemia where chromosomal translocation occurs." [PMID:11157802]
comment: Category=sequence.
synonym: "MORF/CBP" RELATED []
is_a: PRO:000000012 ! creb-binding protein/zinc finger protein HRX chimera

[Term]
id: PRO:000000136
name: BMP receptor type-1A isoform 1
def: "A BMP receptor type-1A that is a translation product of a mature transcript of the BMPR1A gene, represented by the human sequence UniProtKB:P36894-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000035 ! BMP receptor type-1A

[Term]
id: PRO:000000137
name: BMP receptor type-1A sequence variant 1
def: "A BMP receptor type-1A that is a translation product of a polymorphic sequence variant of BMPR1A gene that has a Asp residue at the position equivalent to Tyr-62 in human sequence UniProtKB:P36894-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000035 ! BMP receptor type-1A

[Term]
id: PRO:000000138
name: BMP receptor type-1A sequence variant 2
def: "A BMP receptor type-1A that is a translation product of a polymorphic sequence variant of BMPR1A gene that has a Tyr residue at the position equivalent to Cys-82 in human sequence UniProtKB:P36894-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000035 ! BMP receptor type-1A

[Term]
id: PRO:000000139
name: BMP receptor type-1A sequence variant 3
def: "A BMP receptor type-1A that is a translation product of a polymorphic sequence variant of BMPR1A gene that has a Arg residue at the position equivalent to Cys-124 in human sequence UniProtKB:P36894-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000035 ! BMP receptor type-1A

[Term]
id: PRO:000000140
name: BMP receptor type-1A sequence variant 4
def: "A BMP receptor type-1A that is a translation product of a polymorphic sequence variant of BMPR1A gene that has a Arg residue at the position equivalent to Cys-130 in human sequence UniProtKB:P36894-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000035 ! BMP receptor type-1A

[Term]
id: PRO:000000141
name: BMP receptor type-1A sequence variant 5
def: "A BMP receptor type-1A that is a translation product of a polymorphic sequence variant of BMPR1A gene that has a Asp residue at the position equivalent to Ala-338 in human sequence UniProtKB:P36894-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000035 ! BMP receptor type-1A

[Term]
id: PRO:000000142
name: BMP receptor type-1A sequence variant 6
def: "A BMP receptor type-1A that is a translation product of a polymorphic sequence variant of BMPR1A gene that has a Tyr residue at the position equivalent to Cys-376 in human sequence UniProtKB:P36894-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000035 ! BMP receptor type-1A

[Term]
id: PRO:000000143
name: BMP receptor type-1A sequence variant 7
def: "A BMP receptor type-1A that is a translation product of a polymorphic sequence variant of BMPR1A gene that has a Cys residue at the position equivalent to Arg-443 in human sequence UniProtKB:P36894-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000035 ! BMP receptor type-1A

[Term]
id: PRO:000000144
name: BMP receptor type-1A sequence variant 8
def: "A BMP receptor type-1A that is a translation product of a polymorphic sequence variant of BMPR1A gene that has a Thr residue at the position equivalent to Met-470 in human sequence UniProtKB:P36894-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000035 ! BMP receptor type-1A

[Term]
id: PRO:000000145
name: BMP receptor type-1B isoform 1
def: "A BMP receptor type-1B that is a translation product of a mature transcript of the BMPR1B gene, represented by the human sequence UniProtKB:O00238-1." [PRO:CNA]
comment: Category=sequence. Phosphorylation information from rat [PMID:9766532].
is_a: PRO:000000036 ! BMP receptor type-1B

[Term]
id: PRO:000000146
name: BMP receptor type-1B sequence variant 1
def: "A BMP receptor type-1B that is a translation product of a polymorphic sequence variant of BMPR1B gene that has a Lys residue at the position equivalent to Ile-200 in human sequence UniProtKB:O00238-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000036 ! BMP receptor type-1B

[Term]
id: PRO:000000147
name: BMP receptor type-1B sequence variant 2
def: "A BMP receptor type-1B that is a translation product of a polymorphic sequence variant of BMPR1B gene that has a Trp residue at the position equivalent to Arg-486 in human sequence UniProtKB:O00238-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000036 ! BMP receptor type-1B

[Term]
id: PRO:000000148
name: BMP receptor type-2 isoform 1
def: "A BMP receptor type-2 that is a translation product of a mature transcript of the BMPR2 gene represented by the human sequence UniProtKB:Q13873-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000037 ! BMP receptor type-2

[Term]
id: PRO:000000149
name: BMP receptor type-2 sequence variant 1
def: "A BMP receptor type-2 that is a translation product of a polymorphic sequence variant of BMPR2 gene that has a Tyr residue at the position equivalent to Cys-60 in human sequence UniProtKB:Q13873-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000037 ! BMP receptor type-2

[Term]
id: PRO:000000150
name: BMP receptor type-2 sequence variant 10
def: "A BMP receptor type-2 that is a translation product of a polymorphic sequence variant of BMPR2 gene that has a Gly residue at the position equivalent to Asp-485 in human sequence UniProtKB:Q13873-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000037 ! BMP receptor type-2

[Term]
id: PRO:000000151
name: BMP receptor type-2 sequence variant 11
def: "A BMP receptor type-2 that is a translation product of a polymorphic sequence variant of BMPR2 gene that has a Gln residue at the position equivalent to Arg-491 in human sequence UniProtKB:Q13873-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000037 ! BMP receptor type-2

[Term]
id: PRO:000000152
name: BMP receptor type-2 sequence variant 12
def: "A BMP receptor type-2 that is a translation product of a polymorphic sequence variant of BMPR2 gene that has a Trp residue at the position equivalent to Arg-491 in human sequence UniProtKB:Q13873-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000037 ! BMP receptor type-2

[Term]
id: PRO:000000153
name: BMP receptor type-2 sequence variant 13
def: "A BMP receptor type-2 that is a translation product of a polymorphic sequence variant of BMPR2 gene that has a Thr residue at the position equivalent to Lys-512 in human sequence UniProtKB:Q13873-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000037 ! BMP receptor type-2

[Term]
id: PRO:000000154
name: BMP receptor type-2 sequence variant 14
def: "A BMP receptor type-2 that is a translation product of a polymorphic sequence variant of BMPR2 gene that has a Lys residue at the position equivalent to Asn-519 in human sequence UniProtKB:Q13873-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000037 ! BMP receptor type-2

[Term]
id: PRO:000000155
name: BMP receptor type-2 sequence variant 2
def: "A BMP receptor type-2 that is a translation product of a polymorphic sequence variant of BMPR2 gene that has a Tyr residue at the position equivalent to Cys-117 in human sequence UniProtKB:Q13873-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000037 ! BMP receptor type-2

[Term]
id: PRO:000000156
name: BMP receptor type-2 sequence variant 3
def: "A BMP receptor type-2 that is a translation product of a polymorphic sequence variant of BMPR2 gene that has a Trp residue at the position equivalent to Cys-118 in human sequence UniProtKB:Q13873-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000037 ! BMP receptor type-2

[Term]
id: PRO:000000157
name: BMP receptor type-2 sequence variant 4
def: "A BMP receptor type-2 that is a translation product of a polymorphic sequence variant of BMPR2 gene that has a Arg residue at the position equivalent to Cys-123 in human sequence UniProtKB:Q13873-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000037 ! BMP receptor type-2

[Term]
id: PRO:000000158
name: BMP receptor type-2 sequence variant 5
def: "A BMP receptor type-2 that is a translation product of a polymorphic sequence variant of BMPR2 gene that has a Ser residue at the position equivalent to Cys-123 in human sequence UniProtKB:Q13873-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000037 ! BMP receptor type-2

[Term]
id: PRO:000000159
name: BMP receptor type-2 sequence variant 6
def: "A BMP receptor type-2 that is a translation product of a polymorphic sequence variant of BMPR2 gene that has a Asp residue at the position equivalent to Glu-224 in human sequence UniProtKB:Q13873-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000037 ! BMP receptor type-2

[Term]
id: PRO:000000160
name: BMP receptor type-2 sequence variant 7
def: "A BMP receptor type-2 that is a translation product of a polymorphic sequence variant of BMPR2 gene that has a Tyr residue at the position equivalent to Cys-347 in human sequence UniProtKB:Q13873-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000037 ! BMP receptor type-2

[Term]
id: PRO:000000161
name: BMP receptor type-2 sequence variant 8
def: "A BMP receptor type-2 that is a translation product of a polymorphic sequence variant of BMPR2 gene that has an Arg residue at the position equivalent to Cys-420 in human sequence UniProtKB:Q13873-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000037 ! BMP receptor type-2

[Term]
id: PRO:000000162
name: BMP receptor type-2 sequence variant 9
def: "A BMP receptor type-2 that is a translation product of a polymorphic sequence variant of BMPR2 gene that has a Arg residue at the position equivalent to Cys-483 in human sequence UniProtKB:Q13873-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000037 ! BMP receptor type-2

[Term]
id: PRO:000000163
name: BMP10
def: "A BMP that is a translation product of the BMP10 gene." [PRO:CNA]
comment: Category=gene.
synonym: "bone morphogenetic protein 10" RELATED []
xref: PANTHER:PTHR11848\:SF39
is_a: PRO:000000034 ! BMP

[Term]
id: PRO:000000164
name: BMP2
def: "A BMP that is a translation product of the BMP2 gene." [PRO:CNA]
comment: Category=gene.
synonym: "bone morphogenetic protein 2" EXACT []
xref: PANTHER:PTHR11848\:SF50
is_a: PRO:000000034 ! BMP

[Term]
id: PRO:000000165
name: BMP4
def: "A BMP that is a translation product of the BMP4 gene." [PRO:CNA]
comment: Category=gene.
synonym: "BMP-2B" RELATED []
synonym: "bone morphogenetic protein 4" EXACT []
xref: PANTHER:PTHR11848\:SF49
is_a: PRO:000000034 ! BMP

[Term]
id: PRO:000000166
name: BMP5
def: "A BMP that is a translation product of the BMP5 gene." [PRO:CNA]
comment: Category=gene.
synonym: "bone morphogenetic protein 5" RELATED []
is_a: PRO:000000034 ! BMP

[Term]
id: PRO:000000167
name: BMP6
def: "A BMP that is a translation product of the BMP6 gene." [PRO:CNA]
comment: Category=gene.
synonym: "bone morphogenetic protein 6" RELATED []
xref: PANTHER:PTHR11848\:SF55
is_a: PRO:000000034 ! BMP

[Term]
id: PRO:000000168
name: BMP7
def: "A BMP that is a translation product of the BMP7 gene." [PRO:CNA]
comment: Category=gene.
synonym: "bone morphogenetic protein 7" RELATED []
synonym: "OP-1" RELATED []
synonym: "osteogenic protein-1" RELATED []
is_a: PRO:000000034 ! BMP

[Term]
id: PRO:000000169
name: BMP8A
def: "A BMP that is a translation product of the BMP8A gene." [PRO:CNA]
comment: Category=gene.
synonym: "bone morphogenetic protein 8A" RELATED []
is_a: PRO:000000034 ! BMP

[Term]
id: PRO:000000170
name: BMP8B
def: "A BMP that is a translation product of the BMP8B gene." [PRO:CNA]
comment: Category=gene.
synonym: "bone morphogenetic protein 8B" RELATED []
is_a: PRO:000000034 ! BMP

[Term]
id: PRO:000000171
name: DNA-binding protein inhibitor ID-1 isoform 1
def: "A DNA-binding protein inhibitor ID-1 that is a translation product of a mature transcript of the ID1 gene including all protein coding exons. This form is represented by the human sequence UniProtKB:P41134-1." [PRO:CNA]
comment: Category=sequence.
synonym: "ID-A" RELATED []
is_a: PRO:000000039 ! DNA-binding protein inhibitor ID-1

[Term]
id: PRO:000000172
name: DNA-binding protein inhibitor ID-1 isoform 2
def: "A DNA-binding protein inhibitor ID-1 that is a translation product of a mature transcript of the ID1 gene including only the first coding exon and extending to the first stop codon. This form is represented by the human sequence UniProtKB:P41134-2." [PRO:CNA]
comment: Category=sequence.
synonym: "ID-B" RELATED []
is_a: PRO:000000039 ! DNA-binding protein inhibitor ID-1

[Term]
id: PRO:000000173
name: DNA-binding protein inhibitor ID-2 isoform 1
def: "A DNA-binding protein inhibitor ID-2 that is a translation product of a mature transcript of the ID2 gene, and that contains a HLH domain and a C-terminal nuclear export signal. This form is represented by the human sequence UniProtKB:Q02363-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000040 ! DNA-binding protein inhibitor ID-2

[Term]
id: PRO:000000174
name: DNA-binding protein inhibitor ID-3 isoform 1
def: "A DNA-binding protein inhibitor ID-3 that is a translation product of a mature transcript of the ID3 gene represented by the human sequence UniProtKB:Q02535-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000041 ! DNA-binding protein inhibitor ID-3

[Term]
id: PRO:000000175
name: DNA-binding protein inhibitor ID-4 isoform 1
def: "A DNA-binding protein inhibitor ID-4 that is a translation product of a mature transcript of the ID4 gene represented by the human sequence UniProtKB:P47928-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000042 ! DNA-binding protein inhibitor ID-4

[Term]
id: PRO:000000176
name: GTP-binding protein RhoA
def: "A rho-related small GTPase that is a translation product of the RHOA gene." [PRO:CNA]
comment: Category=gene.
synonym: "RHOA" RELATED []
is_a: PRO:000000122 ! rho-related small GTPase

[Term]
id: PRO:000000177
name: RING-box protein 1 isoform 1
def: "A RING-box protein 1 that is a translation product of a mature transcript of the RBX1 gene, comprising the core domains. This form is represented by the human sequence UniProtKB:P62877-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000043 ! RING-box protein 1

[Term]
id: PRO:000000178
name: RING-box protein 2 isoform 1
def: "A RING-box protein 2 that is a translation product of a mature transcript of the RNF7 gene, comprising the core domains. This form is represented by the human sequence UniProtKB:Q9UBF6-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000044 ! RING-box protein 2

[Term]
id: PRO:000000179
name: RING-box protein 2 isoform 2
def: "A RING-box protein 2 that is a translation product of a mature transcript of the RNF7 gene, that lacks the RING-finger domain because it has an alternative exon 2." [PMID:11506706]
comment: Category=sequence.
synonym: "SAG-v" RELATED []
is_a: PRO:000000044 ! RING-box protein 2

[Term]
id: PRO:000000180
name: S-phase kinase-associated protein 1A isoform 1
def: "A S-phase kinase-associated protein 1A that is a translation product of a mature transcript of the SKP1 gene including the five coding exons. This form is represented by the human sequence UniProtKB:P63208-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000045 ! S-phase kinase-associated protein 1A

[Term]
id: PRO:000000181
name: S-phase kinase-associated protein 1A isoform 2
def: "A S-phase kinase-associated protein 1A 1 that is a translation product of a mature transcript of the SKP1 gene lacking the most 3' coding exon. This form is represented by the human sequence UniProtKB:P63208-2." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000045 ! S-phase kinase-associated protein 1A

[Term]
id: PRO:000000182
name: TGF-beta 1
def: "A TGF-beta that is a translation product of the TGFB1 gene." [PRO:CNA]
comment: Category=gene.
synonym: "transforming growth factor beta 1" EXACT []
xref: PANTHER:PTHR11848\:SF32
is_a: PRO:000000046 ! TGF-beta

[Term]
id: PRO:000000183
name: TGF-beta 2
def: "A TGF-beta that is a translation product of the TGFB2 gene." [PRO:CNA]
comment: Category=gene.
synonym: "TGFB2" EXACT []
synonym: "transforming growth factor beta 2" RELATED []
xref: PANTHER:PTHR11848\:SF33
is_a: PRO:000000046 ! TGF-beta

[Term]
id: PRO:000000184
name: TGF-beta 3
def: "A TGF-beta that is a translation product of the TGFB3 gene." [PRO:CNA]
comment: Category=gene.
synonym: "TGFB3" EXACT []
synonym: "transforming growth factor beta 3" RELATED []
xref: PANTHER:PTHR11848\:SF34
is_a: PRO:000000046 ! TGF-beta

[Term]
id: PRO:000000185
name: TGF-beta receptor type-1 isoform 1
def: "A TGF-beta receptor type-1 that is a translation product of a mature transcript of the TGFBR1 gene, and that contains an extracellular activin types I and II receptor domain, a transmembrane domain, and an intracellular GS-motif and protein kinase domain. This form is represented by the human sequence UniProtKB:P36897-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000047 ! TGF-beta receptor type-1

[Term]
id: PRO:000000186
name: TGF-beta receptor type-1 sequence variant 1
def: "A TGF-beta receptor type-1 that is a translation product of a polymorphic sequence variant of TGFBR1 gene that has an Ile residue at the position equivalent to Thr-200 in the human sequence UniProtKB:P36897-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000047 ! TGF-beta receptor type-1

[Term]
id: PRO:000000187
name: TGF-beta receptor type-1 sequence variant 10
def: "A TGF-beta receptor type-1 that is a translation product of a polymorphic sequence variant of TGFBR1 gene that has an insertion of an Ala residue at the position equivalent to Ala-26 in the human sequence UniProtKB:P36897-1." [PRO:CNA]
comment: Category=sequence.
synonym: "TGFBR1*10A" RELATED []
is_a: PRO:000000047 ! TGF-beta receptor type-1

[Term]
id: PRO:000000188
name: TGF-beta receptor type-1 sequence variant 11
def: "A TGF-beta receptor type-1 that is a translation product of the TGFBR1 gene with a mutation causing amino acid deletion at the position equivalent to region 24-26 in the human sequence UniProtKB:P36897-1." [PRO:CNA]
comment: Category=sequence.
synonym: "TGFBR1*6A" RELATED []
is_a: PRO:000000047 ! TGF-beta receptor type-1

[Term]
id: PRO:000000189
name: TGF-beta receptor type-1 sequence variant 2
def: "A TGF-beta receptor type-1 that is a translation product of a polymorphic sequence variant of TGFBR1 gene that has a Glu residue at the position equivalent to Lys-232 in the human sequence UniProtKB:P36897-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000047 ! TGF-beta receptor type-1

[Term]
id: PRO:000000190
name: TGF-beta receptor type-1 sequence variant 3
def: "A TGF-beta receptor type-1 that is a translation product of a polymorphic sequence variant of TGFBR1 gene that has a Leu residue at the position equivalent to Ser-241 in the human sequence UniProtKB:P36897-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000047 ! TGF-beta receptor type-1

[Term]
id: PRO:000000191
name: TGF-beta receptor type-1 sequence variant 4
def: "A TGF-beta receptor type-1 that is a translation product of a polymorphic sequence variant of TGFBR1 gene that has a His residue at the position equivalent to Asn-267 in the human sequence UniProtKB:P36897-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000047 ! TGF-beta receptor type-1

[Term]
id: PRO:000000192
name: TGF-beta receptor type-1 sequence variant 5
def: "A TGF-beta receptor type-1 that is a translation product of a polymorphic sequence variant of TGFBR1 gene that has a Arg residue at the position equivalent to Met-318 in the human sequence UniProtKB:P36897-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000047 ! TGF-beta receptor type-1

[Term]
id: PRO:000000193
name: TGF-beta receptor type-1 sequence variant 6
def: "A TGF-beta receptor type-1 that is a translation product of a polymorphic sequence variant of TGFBR1 gene that has a Gly residue at the position equivalent to Asp-400 in the human sequence UniProtKB:P36897-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000047 ! TGF-beta receptor type-1

[Term]
id: PRO:000000194
name: TGF-beta receptor type-1 sequence variant 7
def: "A TGF-beta receptor type-1 that is a translation product of a polymorphic sequence variant of TGFBR1 gene that has a Pro residue at the position equivalent to Arg-487 in the human sequence UniProtKB:P36897-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000047 ! TGF-beta receptor type-1

[Term]
id: PRO:000000195
name: TGF-beta receptor type-1 sequence variant 8
def: "A TGF-beta receptor type-1 that is a translation product of a polymorphic sequence variant of TGFBR1 gene that has a Glu residue at the position equivalent to Arg-487 in the human sequence UniProtKB:P36897-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000047 ! TGF-beta receptor type-1

[Term]
id: PRO:000000196
name: TGF-beta receptor type-1 sequence variant 9
def: "A TGF-beta receptor type-1 that is a translation product of a polymorphic sequence variant of TGFBR1 gene that has a Trp residue at the position equivalent to Arg-487 in the human sequence UniProtKB:P36897-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000047 ! TGF-beta receptor type-1

[Term]
id: PRO:000000197
name: TGF-beta receptor type-2 isoform 1 cleaved form
def: "A TGF-beta receptor type-2 isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000048 ! TGF-beta receptor type-2 isoform 1
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000000198
name: TGF-beta receptor type-2 isoform 1 phosphorylated form
def: "A TGFBR2 isoform 1 that has been post-translationally modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000048 ! TGF-beta receptor type-2 isoform 1
intersection_of: has_modification MOD:00696 ! phosphorylated residue

[Term]
id: PRO:000000199
name: activin receptor type-1 isoform 1
def: "An activin receptor type-1 that is a translation product of a mature transcript of the ACVR1 gene, and that contains an extracellular activin types I and II receptor domain, a transmembrane domain, and an intracellular GS-motif and protein kinase domain. This form is represented by the human sequence UniProtKB:Q04771-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000067 ! activin receptor type-1

[Term]
id: PRO:000000200
name: activin receptor type-1 sequence variant 1
def: "An activin receptor type-1 that is a translation product of a polymorphic sequence variant of ACVR1 gene and has a His residue in the GS-motif at the position equivalent to amino acid Arg-206 in human sequence UniProtKB:Q04771-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000067 ! activin receptor type-1

[Term]
id: PRO:000000201
name: activin receptor type-1B isoform 1
def: "An activin receptor type-1B that is a translation product of a mature transcript of the ACVR1B gene, and that contains an extracellular activin types I and II receptor domain, a transmembrane domain, and an intracellular GS-motif and protein kinase domain. This form is represented by the human sequence UniProtKB:P36896-1." [PRO:CNA]
comment: Category=sequence.
synonym: "Alk4-1" RELATED []
synonym: "SKR2-1" RELATED []
is_a: PRO:000000068 ! activin receptor type-1B

[Term]
id: PRO:000000202
name: activin receptor type-1B isoform 2
def: "An activin receptor type-1B that is a translation product of a mature transcript of the ACVR1B gene that contains an alternative exon 10 (10b) and lacks exon 11, as compared to isoform 1 (PRO:000000201), rendering an receptor with a truncated kinase domain and a unique C-terminal tail. This form is represented by human sequence UniProKB:P36896-2. Predominantly expressed in pituitary adenomas." [PMID:11117535, PRO:CNA]
comment: Category=sequence.
synonym: "Alk4-2" RELATED []
synonym: "SKR2-2" RELATED []
is_a: PRO:000000068 ! activin receptor type-1B

[Term]
id: PRO:000000203
name: activin receptor type-1B isoform 3
def: "An activin receptor type-1B that is a translation product of a mature transcript of the ACVR1B gene that contains an alternative exon 9 (9b) and lacks exons 10 and 11, as compared to isoform 1 (PRO:000000201), rendering an receptor with a truncated kinase domain and a unique C-terminal tail. This form is represented by the human sequence UniProKB:P36896-3. Predominantly expressed in pituitary adenomas." [PMID:11117535, PRO:CNA]
comment: Category=sequence.
synonym: "Alk4-3" RELATED []
synonym: "SKR2-3" RELATED []
is_a: PRO:000000068 ! activin receptor type-1B

[Term]
id: PRO:000000204
name: activin receptor type-1C isoform 1
def: "An activin receptor type-1C that is a translation product of a mature transcript of the ACVR1C gene, and that contains an extracellular activin types I and II receptor domain, a transmembrane domain, and an intracellular GS-motif and protein kinase domain. This form is represented by the human sequence UniProtKB:Q8NER5-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000069 ! activin receptor type-1C

[Term]
id: PRO:000000205
name: activin receptor type-1C isoform 2
def: "An activin receptor type-1C that is a translation product of a mature transcript of the ACVR1C gene, and that lacks the transmembrane domain. This form is represented by the human sequence UniProtKB:Q8NER5-2." [PMID:12606401, PRO:CNA]
comment: Category=sequence.
synonym: "Isoform A" RELATED []
is_a: PRO:000000069 ! activin receptor type-1C

[Term]
id: PRO:000000206
name: activin receptor type-1C isoform 3
def: "An activin receptor type-1C that is a translation product of a mature transcript of the ACVR1C gene, and that lacks the transmembrane domain. This form is represented by the human sequence UniProtKB:Q8NER5-3." [PMID:12606401, PRO:CNA]
comment: Category=sequence.
synonym: "Isoform B" RELATED []
is_a: PRO:000000069 ! activin receptor type-1C

[Term]
id: PRO:000000207
name: activin receptor type-1C isoform 4
def: "An activin receptor type-1C that is a translation product of a mature transcript of the ACVR1C gene, and that has a partial deletion of the extracellular activin types I and II receptor domain. This form is represented by the human sequence UniProtKB:Q8NER5-4." [PMID:12606401, PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000069 ! activin receptor type-1C

[Term]
id: PRO:000000208
name: activin receptor type-2A isoform 1
def: "An activin receptor type-2A that is a translation product of a mature transcript of the ACVR2A gene, and that contains an extracellular activin types I and II receptor domain, a transmembrane domain, and an intracellular protein kinase domain. This form is represented by the mouse sequence UniProtKB:P27038-1." [PMID:8395525]
comment: Category=sequence.
is_a: PRO:000000070 ! activin receptor type-2A

[Term]
id: PRO:000000209
name: activin receptor type-2B isoform 1
def: "An activin receptor type-2B that is a translation product of a mature transcript of the ACVR2B gene, and that contains the cluster of proline residues in the extracellular domain located immediately before the transmembrane region (known as splicing cassette I), but lacks the intracellular segment rich in basic and acidic residues (known as splicing cassette II), located preceding a proline-rich sequence between the transmembrane region and the kinase domain." [PRO:CNA]
comment: Category=sequence.
synonym: "ActR-IIB2" RELATED []
is_a: PRO:000000071 ! activin receptor type-2B

[Term]
id: PRO:000000210
name: activin receptor type-2B isoform 2
def: "An activin receptor type-2B that is a translation product of a mature transcript of the ACVR2B gene, and that contains the cluster of proline residues in the extracellular domain located immediately before the transmembrane region (known as splicing cassette I), and the intracellular segment (known as splicing cassette II) with an insertion and frameshift that leads to protein truncation. This form may have dominant-negative properties and is represented by the human sequence UniProtKB:Q13705-2." [PMID:9916847]
comment: Category=sequence.
synonym: "ActR-IIB1" RELATED []
is_a: PRO:000000071 ! activin receptor type-2B

[Term]
id: PRO:000000211
name: activin receptor type-2B isoform 3
def: "An activin receptor type-2B that is a translation product of a mature transcript of the ACVR2B gene, and that contains the cluster of proline residues of the extracellular domain located immediately before the transmembrane region (known as splicing cassette I), and the intracellular segment rich in basic and acidic residues (known as splicing cassette II), located preceding a proline-rich sequence between the transmembrane region and the kinase domain. This form is represented by the mouse sequence UniProtKB:P27040-1." [PMID:1310075, PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000071 ! activin receptor type-2B

[Term]
id: PRO:000000212
name: activin receptor type-2B isoform 4
def: "An activin receptor type-2B that is a translation product of a mature transcript of the ACVR2B gene, that lacks the cluster of proline residues of the extracellular domain located immediately before the transmembrane region (known as splicing cassette I), but includes the intracellular segment rich in basic and acidic residues (known as splicing cassette II), located preceding a proline-rich sequence between the transmembrane region and the kinase domain. This form is represented by the mouse sequence UniProtKB:P27040-3." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000071 ! activin receptor type-2B

[Term]
id: PRO:000000213
name: activin receptor type-2B isoform 5
def: "An activin receptor type-2B that is a translation product of a mature transcript of the ACVR2B gene, that lacks both the cluster of proline residues of the extracellular domain located immediately before the transmembrane region (known as splicing cassette I), and the intracellular segment rich in basic and acidic residues (known as splicing cassette II), located preceding a proline-rich sequence between the transmembrane region and the kinase domain. This form is represented by the mouse sequence UniProtKB:P27040-4." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000071 ! activin receptor type-2B

[Term]
id: PRO:000000214
name: activin receptor type-2B sequence variant 1
def: "An activin receptor type-2B that is a translation product of a polymorphic sequence variant of ACVR2B gene that has a His residue at the position equivalent to Arg-40 of the extracellular domain in the human sequence UniProtKB:Q13705-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000071 ! activin receptor type-2B

[Term]
id: PRO:000000215
name: activin receptor type-2B sequence variant 2
def: "An activin receptor type-2B that is a translation product of a polymorphic sequence variant of ACVR2B gene that has an Ile residue at the position equivalent to Val-494 in the human sequence UniProtKB:Q13705-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000071 ! activin receptor type-2B

[Term]
id: PRO:000000216
name: activin/inhibin beta A chain
def: "An activin/inhibin beta subunit that is a translation product of the INHBA gene." [PRO:CNA]
comment: Category=gene.
synonym: "INHBA" EXACT []
xref: PANTHER:PTHR11848\:SF28
is_a: PRO:000000072 ! activin/inhibin beta subunit

[Term]
id: PRO:000000217
name: activin/inhibin beta B chain
def: "An activin/inhibin beta subunit that is a translation product of the INHBB gene." [PRO:CNA]
comment: Category=gene.
synonym: "INHBB" EXACT []
xref: PANTHER:PTHR11848\:SF29
is_a: PRO:000000072 ! activin/inhibin beta subunit

[Term]
id: PRO:000000218
name: activin/inhibin beta C chain
def: "An activin/inhibin beta subunit that is a translation product of the INHBC gene." [PRO:CNA]
comment: Category=gene.
synonym: "activin beta subunit C" EXACT []
xref: PANTHER:PTHR11848\:SF26
is_a: PRO:000000072 ! activin/inhibin beta subunit

[Term]
id: PRO:000000219
name: activin/inhibin beta E chain
def: "An activin/inhibin beta subunit that is a translation product of the INHBE gene." [PRO:CNA]
comment: Category=gene.
synonym: "INHBE" EXACT []
xref: PANTHER:PTHR11848\:SF6
is_a: PRO:000000072 ! activin/inhibin beta subunit

[Term]
id: PRO:000000220
name: anti-Muellerian hormone isoform 1
def: "An anti-Muellerian hormone that is a translation product of a mature transcript of the AMH gene, and that contains a signal peptide, anti-Mullerian hormone N-terminal domain and a TGF-beta-like cysteine knot domain. This form is represented by the human sequence represented by the human sequence UniProtKB:P27106-1. This form is the precursor." [PRO:CNA]
comment: Category=sequence.
synonym: "AMH" RELATED []
is_a: PRO:000000073 ! anti-Muellerian hormone

[Term]
id: PRO:000000221
name: anti-Muellerian hormone sequence variant 1
def: "An anti-Muellerian hormone that is a translation product of a polymorphic sequence variant of AMH gene that has a Gly residue at the position equivalent to Val-12 in the human sequence UniProtKB:P03971-1 that is part of the signal peptide." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000073 ! anti-Muellerian hormone

[Term]
id: PRO:000000222
name: anti-Muellerian hormone sequence variant 2
def: "An anti-Muellerian hormone that is a translation product of a polymorphic sequence variant of AMH gene that has a Pro residue at the position equivalent to Leu-70 in the human sequence UniProtKB:P03971-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000073 ! anti-Muellerian hormone

[Term]
id: PRO:000000223
name: anti-Muellerian hormone sequence variant 3
def: "An anti-Muellerian hormone that is a translation product of a polymorphic sequence variant of AMH gene that has a Val residue at the position equivalent to Gly-101 in the human sequence UniProtKB:P03971-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000073 ! anti-Muellerian hormone

[Term]
id: PRO:000000224
name: anti-Muellerian hormone sequence variant 4
def: "An anti-Muellerian hormone that is a translation product of a polymorphic sequence variant of AMH gene that has a Trp residue at the position equivalent to Arg-123 in the human sequence UniProtKB:P03971-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000073 ! anti-Muellerian hormone

[Term]
id: PRO:000000225
name: anti-Muellerian hormone sequence variant 5
def: "An anti-Muellerian hormone that is a translation product of a polymorphic sequence variant of AMH gene that has a Cys residue at the position equivalent to Tyr-167 in the human sequence UniProtKB:P03971-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000073 ! anti-Muellerian hormone

[Term]
id: PRO:000000226
name: anti-Muellerian hormone sequence variant 6
def: "An anti-Muellerian hormone that is a translation product of a polymorphic sequence variant of AMH gene that has a Cys residue at the position equivalent to Arg-194 in the human sequence UniProtKB:P03971-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000073 ! anti-Muellerian hormone

[Term]
id: PRO:000000227
name: anti-Muellerian hormone sequence variant 7
def: "An anti-Muellerian hormone that is a translation product of a polymorphic sequence variant of AMH gene that has an Ala residue at the position equivalent to Val-477 in the human sequence UniProtKB:P03971-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000073 ! anti-Muellerian hormone

[Term]
id: PRO:000000228
name: c-myc protein isoform 1
def: "A c-myc protein that is a translation product of a mature transcript of the MYC gene comprising the first ATG-initiated open reading frame extending from exon 2 through exon 3." [PMID:3277717]
comment: Category=sequence.
is_a: PRO:000000084 ! c-myc protein

[Term]
id: PRO:000000229
name: c-myc protein isoform 2
def: "A c-myc protein that is a translation product of a mature transcript of the MYC gene using an alternate non-ATG initiator in exon 1, rendering an N-terminal extended form." [PMID:3277717]
comment: Category=sequence.
synonym: "p67" RELATED []
synonym: "p68" RELATED []
is_a: PRO:000000084 ! c-myc protein

[Term]
id: PRO:000000230
name: cartilage oligomeric matrix protein isoform 1
def: "A cartilage oligomeric matrix protein that is a translation product of a mature transcript of the COMP gene, comprising all core domains. This form is represented by the human sequence UniProtKB:P49747-1, and is the precursor of the mature protein." [PRO:CNA]
comment: Category=sequence.
synonym: "precursor" RELATED []
is_a: PRO:000000085 ! cartilage oligomeric matrix protein

[Term]
id: PRO:000000231
name: cartilage oligomeric matrix protein sequence variant 1
def: "A cartilage oligomeric matrix protein that is a translation product of a polymorphic sequence variant of COMP gene that has an Arg residue at the position equivalent to Pro-276 in the human sequence UniProtKB:P49747-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000085 ! cartilage oligomeric matrix protein

[Term]
id: PRO:000000232
name: cartilage oligomeric matrix protein sequence variant 10
def: "A cartilage oligomeric matrix protein that is a translation product of a polymorphic sequence variant of COMP gene that has an Gly residue at the position equivalent to Cys-387 in the human sequence UniProtKB:P49747-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000085 ! cartilage oligomeric matrix protein

[Term]
id: PRO:000000233
name: cartilage oligomeric matrix protein sequence variant 11
def: "A cartilage oligomeric matrix protein that is a translation product of a polymorphic sequence variant of COMP gene that has an Tyr residue at the position equivalent to Asp-408 in the human sequence UniProtKB:P49747-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000085 ! cartilage oligomeric matrix protein

[Term]
id: PRO:000000234
name: cartilage oligomeric matrix protein sequence variant 12
def: "A cartilage oligomeric matrix protein that is a translation product of a polymorphic sequence variant of COMP gene that has an Ala residue at the position equivalent to Asp-420 in the human sequence UniProtKB:P49747-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000085 ! cartilage oligomeric matrix protein

[Term]
id: PRO:000000235
name: cartilage oligomeric matrix protein sequence variant 13
def: "A cartilage oligomeric matrix protein that is a translation product of a polymorphic sequence variant of COMP gene that has an Glu residue at the position equivalent to Gly-440 in the human sequence UniProtKB:P49747-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000085 ! cartilage oligomeric matrix protein

[Term]
id: PRO:000000236
name: cartilage oligomeric matrix protein sequence variant 14
def: "A cartilage oligomeric matrix protein that is a translation product of a polymorphic sequence variant of COMP gene that has an Arg residue at the position equivalent to Gly-440 in the human sequence UniProtKB:P49747-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000085 ! cartilage oligomeric matrix protein

[Term]
id: PRO:000000237
name: cartilage oligomeric matrix protein sequence variant 15
def: "A cartilage oligomeric matrix protein that is a translation product of a polymorphic sequence variant of COMP gene that has an Ser residue at the position equivalent to Asn-453 in the human sequence UniProtKB:P49747-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000085 ! cartilage oligomeric matrix protein

[Term]
id: PRO:000000238
name: cartilage oligomeric matrix protein sequence variant 16
def: "A cartilage oligomeric matrix protein that is a translation product of a polymorphic sequence variant of COMP gene that has an Val residue at the position equivalent to Asp-439 in the human sequence UniProtKB:P49747-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000085 ! cartilage oligomeric matrix protein

[Term]
id: PRO:000000239
name: cartilage oligomeric matrix protein sequence variant 17
def: "A cartilage oligomeric matrix protein that is a translation product of a polymorphic sequence variant of COMP gene that has an Tyr residue at the position equivalent to Cys-468 in the human sequence UniProtKB:P49747-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000085 ! cartilage oligomeric matrix protein

[Term]
id: PRO:000000240
name: cartilage oligomeric matrix protein sequence variant 18
def: "A cartilage oligomeric matrix protein that is a translation product of a polymorphic sequence variant of COMP gene that has an Tyr residue at the position equivalent to Asp-472 in the human sequence UniProtKB:P49747-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000085 ! cartilage oligomeric matrix protein

[Term]
id: PRO:000000241
name: cartilage oligomeric matrix protein sequence variant 19
def: "A cartilage oligomeric matrix protein that is a translation product of a polymorphic sequence variant of COMP gene that has an Gly residue at the position equivalent to Asp-473 in the human sequence UniProtKB:P49747-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000085 ! cartilage oligomeric matrix protein

[Term]
id: PRO:000000242
name: cartilage oligomeric matrix protein sequence variant 2
def: "A cartilage oligomeric matrix protein that is a translation product of a polymorphic sequence variant of COMP gene that has an Asn residue at the position equivalent to Asp-290 in the human sequence UniProtKB:P49747-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000085 ! cartilage oligomeric matrix protein

[Term]
id: PRO:000000243
name: cartilage oligomeric matrix protein sequence variant 20
def: "A cartilage oligomeric matrix protein that is a translation product of a polymorphic sequence variant of COMP gene that has an Gly residue at the position equivalent to Asp-482 in the human sequence UniProtKB:P49747-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000085 ! cartilage oligomeric matrix protein

[Term]
id: PRO:000000244
name: cartilage oligomeric matrix protein sequence variant 21
def: "A cartilage oligomeric matrix protein that is a translation product of a polymorphic sequence variant of COMP gene that has an Asn residue at the position equivalent to asp-518 in the human sequence UniProtKB:P49747-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000085 ! cartilage oligomeric matrix protein

[Term]
id: PRO:000000245
name: cartilage oligomeric matrix protein sequence variant 22
def: "A cartilage oligomeric matrix protein that is a translation product of a polymorphic sequence variant of COMP gene that has an Asp residue at the position equivalent to Gly-719 in the human sequence UniProtKB:P49747-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000085 ! cartilage oligomeric matrix protein

[Term]
id: PRO:000000246
name: cartilage oligomeric matrix protein sequence variant 23
def: "A cartilage oligomeric matrix protein that is a translation product of a polymorphic sequence variant of COMP gene that has an Lys residue at the position equivalent to Asn-523 in the human sequence UniProtKB:P49747-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000085 ! cartilage oligomeric matrix protein

[Term]
id: PRO:000000247
name: cartilage oligomeric matrix protein sequence variant 24
def: "A cartilage oligomeric matrix protein that is a translation product of a polymorphic sequence variant of COMP gene that has a Met residue at the position equivalent to Thr-585 in the human sequence UniProtKB:P49747-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000085 ! cartilage oligomeric matrix protein

[Term]
id: PRO:000000248
name: cartilage oligomeric matrix protein sequence variant 25
def: "A cartilage oligomeric matrix protein that is a translation product of a polymorphic sequence variant of COMP gene that has an Arg residue at the position equivalent to Thr-585 in the human sequence UniProtKB:P49747-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000085 ! cartilage oligomeric matrix protein

[Term]
id: PRO:000000249
name: cartilage oligomeric matrix protein sequence variant 26
def: "A cartilage oligomeric matrix protein that is a translation product of a polymorphic sequence variant of COMP gene that has an Val residue at the position equivalent to region 391-394 in the human sequence UniProtKB:P49747-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000085 ! cartilage oligomeric matrix protein

[Term]
id: PRO:000000250
name: cartilage oligomeric matrix protein sequence variant 27
def: "A cartilage oligomeric matrix protein that is a translation product of the COMP gene with a mutation causing amino acid deletion at the position equivalent to residue 372 in the human sequence UniProtKB:P49747-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000085 ! cartilage oligomeric matrix protein

[Term]
id: PRO:000000251
name: cartilage oligomeric matrix protein sequence variant 28
def: "A cartilage oligomeric matrix protein that is a translation product of the COMP gene with a mutation causing amino acid deletion at the position equivalent to residue 374 in the human sequence UniProtKB:P49747-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000085 ! cartilage oligomeric matrix protein

[Term]
id: PRO:000000252
name: cartilage oligomeric matrix protein sequence variant 29
def: "A cartilage oligomeric matrix protein that is a translation product of the COMP gene with a mutation causing amino acid deletion at the position equivalent to residue 459 in the human sequence UniProtKB:P49747-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000085 ! cartilage oligomeric matrix protein

[Term]
id: PRO:000000253
name: cartilage oligomeric matrix protein sequence variant 3
def: "A cartilage oligomeric matrix protein that is a translation product of a polymorphic sequence variant of COMP gene that has an Arg residue at the position equivalent to Gly-299 in the human sequence UniProtKB:P49747-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000085 ! cartilage oligomeric matrix protein

[Term]
id: PRO:000000254
name: cartilage oligomeric matrix protein sequence variant 30
def: "A cartilage oligomeric matrix protein that is a translation product of the COMP gene with a mutation causing amino acid deletion at the position equivalent to residue 469 in the human sequence UniProtKB:P49747-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000085 ! cartilage oligomeric matrix protein

[Term]
id: PRO:000000255
name: cartilage oligomeric matrix protein sequence variant 31
def: "A cartilage oligomeric matrix protein that is a translation product of the COMP gene with a mutation causing amino acid deletion at the position equivalent to residue 473 in the human sequence UniProtKB:P49747-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000085 ! cartilage oligomeric matrix protein

[Term]
id: PRO:000000256
name: cartilage oligomeric matrix protein sequence variant 32
def: "A cartilage oligomeric matrix protein that is a translation product of the COMP gene with a mutation causing amino acid deletion at the position equivalent to region 367-368 in the human sequence UniProtKB:P49747-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000085 ! cartilage oligomeric matrix protein

[Term]
id: PRO:000000257
name: cartilage oligomeric matrix protein sequence variant 33
def: "A cartilage oligomeric matrix protein that is a translation product of the COMP gene with a mutation causing amino acid deletion at the position equivalent to region 513-516 in the human sequence UniProtKB:P49747-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000085 ! cartilage oligomeric matrix protein

[Term]
id: PRO:000000258
name: cartilage oligomeric matrix protein sequence variant 4
def: "A cartilage oligomeric matrix protein that is a translation product of a polymorphic sequence variant of COMP gene that has an Arg residue at the position equivalent to Cys-328 in the human sequence UniProtKB:P49747-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000085 ! cartilage oligomeric matrix protein

[Term]
id: PRO:000000259
name: cartilage oligomeric matrix protein sequence variant 5
def: "A cartilage oligomeric matrix protein that is a translation product of a polymorphic sequence variant of COMP gene that has an Tyr residue at the position equivalent to Asp-342 in the human sequence UniProtKB:P49747-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000085 ! cartilage oligomeric matrix protein

[Term]
id: PRO:000000260
name: cartilage oligomeric matrix protein sequence variant 6
def: "A cartilage oligomeric matrix protein that is a translation product of a polymorphic sequence variant of COMP gene that has an Arg residue at the position equivalent to Cys-348 in the human sequence UniProtKB:P49747-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000085 ! cartilage oligomeric matrix protein

[Term]
id: PRO:000000261
name: cartilage oligomeric matrix protein sequence variant 7
def: "A cartilage oligomeric matrix protein that is a translation product of a polymorphic sequence variant of COMP gene that has an Val residue at the position equivalent to Asp-361 in the human sequence UniProtKB:P49747-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000085 ! cartilage oligomeric matrix protein

[Term]
id: PRO:000000262
name: cartilage oligomeric matrix protein sequence variant 8
def: "A cartilage oligomeric matrix protein that is a translation product of a polymorphic sequence variant of COMP gene that has an Tyr residue at the position equivalent to Asp-361 in the human sequence UniProtKB:P49747-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000085 ! cartilage oligomeric matrix protein

[Term]
id: PRO:000000263
name: cartilage oligomeric matrix protein sequence variant 9
def: "A cartilage oligomeric matrix protein that is a translation product of a polymorphic sequence variant of COMP gene that has an Ser residue at the position equivalent to Cys-371 in the human sequence UniProtKB:P49747-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000085 ! cartilage oligomeric matrix protein

[Term]
id: PRO:000000264
name: chordin isoform 1 cleaved form
def: "A chordin isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000086 ! chordin isoform 1
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000000265
name: creb-binding protein isoform 1
def: "A creb-binding protein that is a translation product of a mature transcript of the CREBBP gene. This form is represented by the human sequence UniProtKB:Q92793-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000090 ! creb-binding protein

[Term]
id: PRO:000000266
name: creb-binding protein sequence variant 1
def: "A creb-binding protein that is a translation product of a polymorphic sequence variant of the wild type CREBBP gene that has an Arg residue at the position equivalent to Pro-1378 in the human sequence UniProtKB:Q92793-1." [PMID:11331617]
comment: Category=sequence.
is_a: PRO:000000090 ! creb-binding protein

[Term]
id: PRO:000000267
name: cullin 1 isoform 1
def: "A cullin 1 that is a translation product of a mature transcript of the CUL1 gene. This form is represented by the human sequence UniProtKB:Q13616-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000092 ! cullin 1

[Term]
id: PRO:000000268
name: cyclin-dependent kinase 4 inhibitor B isoform 1
def: "A cyclin-dependent kinase 4 inhibitor B that is a translation product of a mature transcript of the CDKN2B gene represented by the human sequence UniProtKB:P42772-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000093 ! cyclin-dependent kinase 4 inhibitor

[Term]
id: PRO:000000269
name: cyclin-dependent kinase 4 inhibitor B sequence variant 1
def: "A cyclin-dependent kinase 4 inhibitor B that is a translation product of a polymorphic sequence variant of CDKN2B gene that has a Glu residue at the position equivalent to Gly-47 in human sequence UniProtKB:P42772-1, and is involved in lung adenocarcinoma." [PMID:7882351]
comment: Category=sequence.
is_a: PRO:000000093 ! cyclin-dependent kinase 4 inhibitor

[Term]
id: PRO:000000270
name: cyclin-dependent kinase 4 inhibitor B sequence variant 2
def: "A cyclin-dependent kinase 4 inhibitor B that is a translation product of a polymorphic sequence variant of CDKN2B gene that has a Val residue at the position equivalent to Ala-50 in human sequence UniProtKB:P42772-1, and is involved in lung adenocarcinoma." [PMID:7882351]
comment: Category=sequence.
is_a: PRO:000000093 ! cyclin-dependent kinase 4 inhibitor

[Term]
id: PRO:000000271
name: decorin isoform 1
def: "A decorin that is a translation product of a mature transcript of the DCN gene comprising all coding exons. This form is represented by the human sequence UniProtKB:P07585-1." [PRO:CNA]
comment: Category=sequence.
synonym: "isoform A precursor" RELATED []
is_a: PRO:000000094 ! decorin

[Term]
id: PRO:000000272
name: decorin isoform 2
def: "A decorin that is a translation product of a mature transcript of the DCN gene that lacks exons 3 and 4 in the coding region compared to isoform 1. This form is represented by the human sequence UniProtKB:P07585-2. This does not cause frameshift but the encoded lacks a strech of approximately 100 amino acids after the propeptide region. Thus it is not clear if cleavage takes place for the mature peptide to be produced from the proprotein." [EntrezGene:1634]
comment: Category=sequence.
synonym: "isoformB" RELATED []
is_a: PRO:000000094 ! decorin

[Term]
id: PRO:000000273
name: decorin isoform 3
def: "A decorin that is a translation product of a mature transcript of the DCN gene that lacks exons 3, 4 and 5 in the coding region compared to isoform 1. This causes an internal frameshift and the encoded isoform is shorter. This form is represented by the human sequence UniProtKB:P07585-3. Thus it is not clear if cleavage takes place for the mature peptide to be produced from the proprotein." [EntrezGene:1634]
comment: Category=sequence.
synonym: "isoformC" RELATED []
is_a: PRO:000000094 ! decorin

[Term]
id: PRO:000000274
name: decorin isoform 4
def: "A decorin that is a translation product of a mature transcript of the DCN gene that lacks exons 4, 5, 6 and 7 in the coding region compared to isoform 1. This does not cause a frameshift but the encoded isoform lacks a strech of approximately 187 amino acids. This form is represented by the human sequence UniProtKB:P07585-4. Thus it is not clear if cleavage takes place for the mature peptide to be produced from the proprotein." [EntrezGene:1634]
comment: Category=sequence.
synonym: "isoformD" RELATED []
is_a: PRO:000000094 ! decorin

[Term]
id: PRO:000000275
name: decorin isoform 5
def: "A decorin that is a translation product of a mature transcript of the DCN gene that lacks exons 3, 4, 5, 6 and 7 in the coding region compared to isoform 1. This causes a frameshift and the encoded isoform is shorter. This form is represented by the human sequence UniProtKB:P07585-5. Thus it is not clear if cleavage takes place for the mature peptide to be produced from the proprotein." [EntrezGene:1634]
comment: Category=sequence.
synonym: "isoformE" RELATED []
is_a: PRO:000000094 ! decorin

[Term]
id: PRO:000000276
name: fas ligand isoform 1
def: "A fas ligand that is a translation product of a mature transcript of the FASLG gene comprising the exons that code for the cytoplasmic, the transmembrane and the TNF (extracellular) domains." [PRO:CNA]
comment: Category=sequence.
synonym: "FasL long" RELATED []
is_a: PRO:000000095 ! fas ligand, TNF-like

[Term]
id: PRO:000000277
name: fas ligand isoform 2
def: "A fas ligand that is a translation product of a mature transcript of the FASLG gene that lacks the exons coding for the transmembrane domain." [PMID:10552956, PRO:CNA]
comment: Category=sequence.
synonym: "FasL short" RELATED []
synonym: "FasLS" RELATED []
is_a: PRO:000000095 ! fas ligand, TNF-like

[Term]
id: PRO:000000278
name: fas ligand sequence variant 1
def: "A fas ligand that is a translation product of a polymorphic sequence variant of FASLG gene that has a Leu residue at the position equivalent to Phe-273 in the mouse sequence UniProtKB:P41047-1 which leads to an immune system phenotype with enlarged lymph nodes (MP:0000702) and increased lymphocyte cell number (MP:0005013)." [PMID:7495745, PRO:CNA]
comment: Category=sequence.
synonym: "gld" RELATED []
is_a: PRO:000000095 ! fas ligand, TNF-like

[Term]
id: PRO:000000279
name: follistatin isoform 1 cleaved and glycosylated form
def: "A follistatin isoform 1 that has been processed by proteolytic cleavage and has been post-translationally modified to include a glycosylated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000096 ! follistatin isoform 1
intersection_of: has_modification MOD:00693 ! glycosylated residue
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000000280
name: follistatin isoform 2 cleaved and glycosylated form
def: "A follistatin isoform 2 that has been processed by proteolytic cleavage and has been post-translationally modified to include a glycosylated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000097 ! follistatin isoform 2
intersection_of: has_modification MOD:00693 ! glycosylated residue
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000000281
name: growth/differentiation factor 5
def: "A growth/differentiation factor that is a translation product of the GDF5 gene." [PRO:CNA]
comment: Category=gene.
synonym: "Cartilage-derived morphogenetic protein 1" RELATED []
synonym: "CDMP-1 " RELATED []
xref: PANTHER:PTHR11848\:SF44
is_a: PRO:000000098 ! growth/differentiation factor

[Term]
id: PRO:000000282
name: growth/differentiation factor 7
def: "A growth/differentiation factor that is a translation product of the GDF7 gene." [PRO:CNA]
comment: Category=gene.
synonym: "GDF-7" EXACT []
synonym: "Gdf7" RELATED []
xref: PANTHER:PTHR11848\:SF42
is_a: PRO:000000098 ! growth/differentiation factor

[Term]
id: PRO:000000283
name: interferon gamma isoform 1 cleaved and glycosylated form
def: "An interferon gamma isoform 1 that has been processed by proteolytic cleavage and has been post-translationally modified to include a glycosylated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000100 ! interferon gamma isoform 1
intersection_of: has_modification MOD:00693 ! glycosylated residue
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000000284
name: interferon gamma isoform 1 cleaved form
def: "An interferon gamma isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000100 ! interferon gamma isoform 1
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000000285
name: latent-TGF-beta-binding protein 1 isoform 1
def: "A latent-TGF-beta-binding protein 1 that is a translation product of the longest mature transcript of LTBP1 gene, and that contains a unique N-terminus consisting of a signal peptide, a conserved Cys motif C(x)3CC(x)11C, and an EGF-like domain. The presence of multiple EGF-like domains, calcium binding EGF and TB domains at the C-terminus is common with other isoforms. This form is a precursor and is represented by the human sequence UniProtKB:Q14766-1." [PMID:8537398, PRO:CNA]
comment: Category=sequence.
synonym: "long isoform" RELATED []
is_a: PRO:000000101 ! latent TGF-beta-binding protein 1

[Term]
id: PRO:000000286
name: latent-TGF-beta-binding protein 1 isoform 2
def: "A latent-TGF-beta-binding protein 1 that is a translation product of the short mature transcript of TGFB1 gene, and that contains a unique signal peptide and is multiple EGF-like domains, calcium binding EGF and TB domains at the C-terminus, that is common with other isoforms. This form is a precursor and is represented by the human sequence UniProtKB:P22064-1." [PMID:8537398, PRO:CNA]
comment: Category=sequence.
synonym: "LTBP-1S precursor" RELATED []
synonym: "LTPBP1 short isoform" RELATED []
is_a: PRO:000000101 ! latent TGF-beta-binding protein 1

[Term]
id: PRO:000000287
name: lefty 1
def: "A lefty that is a translation product of the LEFTY1 gene." [PRO:CNA]
comment: Category=gene.
synonym: "Left-right determination factor 1" RELATED []
synonym: "LEFTY1" RELATED []
is_a: PRO:000000102 ! lefty protein

[Term]
id: PRO:000000288
name: lefty 2
def: "A protein that is a translation product of the LEFTY2 gene." [PRO:CNA]
comment: Category=gene.
synonym: "Left-right determination factor 2" RELATED []
synonym: "Left-right determination factor B" RELATED []
synonym: "LEFTY2" RELATED []
is_a: PRO:000000102 ! lefty protein

[Term]
id: PRO:000000289
name: mitogen-activated protein kinase 1 isoform 1
def: "A mitogen-activated protein kinase 1 that is a translation product of a mature transcript of the MAPK1 gene, and that contains an intact protein kinase domain. This form is represented by the human sequence UniProtKB:P28482-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000103 ! mitogen-activated protein kinase 1

[Term]
id: PRO:000000290
name: mitogen-activated protein kinase 3 isoform 1
def: "A mitogen-activated protein kinase 3 that is a translation product of a mature transcript of the MAPK3 gene, and that contains an intact protein kinase domain. This form is represented by the human sequence UniProtKB:P27361-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000104 ! mitogen-activated protein kinase 3

[Term]
id: PRO:000000291
name: nodal isoform 1
def: "A nodal protein that is a translation product of a mature transcript of the NODAL gene, and that contains a signal peptide, a propeptide and a TGF-beta-like cysteine knot domain. This form is represented by the human sequence UniProtKB:Q96S42-1. This form is a precursor." [PRO:CNA]
comment: Category=sequence.
synonym: "precursor" RELATED []
is_a: PRO:000000105 ! nodal protein

[Term]
id: PRO:000000292
name: nodal sequence variant 1
def: "A nodal protein that is a translation product of the NODAL gene that has a Gln residue at the position equivalent to Arg-183 in the human sequence UniProtKB:Q96S42-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000105 ! nodal protein

[Term]
id: PRO:000000293
name: noggin isoform 1 cleaved form
def: "A noggin isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000106 ! noggin isoform 1
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000000294
name: pituitary homeobox protein 2 isoform 1
def: "A translation product of a mature transcript of the PITX2 gene comprising exons 1-2, 5 and 6. This form is represented by the human sequence UniProtKB:Q99697-3." [PMID:10585561]
comment: Category=sequence.
synonym: "ARP1A" EXACT []
synonym: "Pitx2a" EXACT []
is_a: PRO:000000117 ! pituitary homeobox protein 2

[Term]
id: PRO:000000295
name: pituitary homeobox protein 2 isoform 2
def: "A translation product of a mature transcript of the PITX2 gene that inlcudes exons 1-3, 5 and 6. This form is represented by the human sequence UniProtKB:Q99697-1." [PMID:10585561]
comment: Category=sequence.
synonym: "ARP1B" RELATED []
synonym: "BRX1B" RELATED []
synonym: "Pitx2b" RELATED []
is_a: PRO:000000117 ! pituitary homeobox protein 2

[Term]
id: PRO:000000296
name: pituitary homeobox protein 2 isoform 3
def: "A translation product of a mature transcript of the PITX2 gene that uses an alternative promoter located upstream of exon 4. This form is represented by the human sequence UniProtKB:Q99697-2." [PMID:10585561]
comment: Category=sequence.
synonym: "ARP1C" RELATED []
synonym: "BRX1A" RELATED []
synonym: "Pitx2c" RELATED []
is_a: PRO:000000117 ! pituitary homeobox protein 2

[Term]
id: PRO:000000297
name: pituitary homeobox protein 2 isoform 4
def: "A translation product of a mature transcript of the PITX2 gene that uses an alternative promoter and results from splicing of exon 4a to a cryptic 3'-splice site in exon 5, which produces a truncated homeodomain and complete C-terminal tail." [PMID:11948188, PRO:CNA]
comment: Category=sequence.
synonym: "pitx2D" RELATED []
is_a: PRO:000000117 ! pituitary homeobox protein 2

[Term]
id: PRO:000000298
name: pituitary homeobox protein 2 sequence variant 1
def: "A pituitary homeobox protein 2 that is a translation product of the PITX2 gene that has a Trp residue at the position equivalent to Arg-89 in the human sequence UniProtKB:Q99697-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000117 ! pituitary homeobox protein 2

[Term]
id: PRO:000000299
name: pituitary homeobox protein 2 sequence variant 2
def: "A pituitary homeobox protein 2 that is a translation product of the PITX2 gene that has a Gln residue at the position equivalent to Leu-100 in the human sequence UniProtKB:Q99697-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000117 ! pituitary homeobox protein 2

[Term]
id: PRO:000000300
name: pituitary homeobox protein 2 sequence variant 3
def: "A pituitary homeobox protein 2 that is a translation product of the PITX2 gene that has a Pro residue at the position equivalent to Thr-114 in the human sequence UniProtKB:Q99697-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000117 ! pituitary homeobox protein 2

[Term]
id: PRO:000000301
name: pituitary homeobox protein 2 sequence variant 4
def: "A pituitary homeobox protein 2 that is a translation product of the PITX2 gene that has a His residue at the position equivalent to Arg-115 in the human sequence UniProtKB:Q99697-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000117 ! pituitary homeobox protein 2

[Term]
id: PRO:000000302
name: pituitary homeobox protein 2 sequence variant 5
def: "A pituitary homeobox protein 2 that is a translation product of the PITX2 gene that has a Pro residue at the position equivalent to Arg-137 in the human sequence UniProtKB:Q99697-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000117 ! pituitary homeobox protein 2

[Term]
id: PRO:000000303
name: retinoblastoma-like protein 1 isoform 1
def: "A retinoblastoma-like protein 1 that is a translation product of a mature transcript of the RBL1 gene, comprising the core domains. This form is represented by the human sequence UniProtKB:P28749-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000118 ! retinoblastoma-like protein 1

[Term]
id: PRO:000000304
name: retinoblastoma-like protein 1 isoform 2
def: "A retinoblastoma-like protein 1 that is a translation product of a mature transcript of the RBL1 gene, comprising the core domains. This form is represented by the human sequence UniProtKB:P28749-2." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000118 ! retinoblastoma-like protein 1

[Term]
id: PRO:000000305
name: retinoblastoma-like protein 1 isoform 3
def: "A retinoblastoma-like protein 1 that is a translation product of a mature transcript of the RBL1 gene, that lacks the C-terminal retinoblastoma-associated protein B domain. This form is represented by the mouse sequence UniProtKB:Q64701-2." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000118 ! retinoblastoma-like protein 1

[Term]
id: PRO:000000306
name: retinoblastoma-like protein 2 isoform 1
def: "A retinoblastoma-like protein 1 that is a translation product of a mature transcript of the RBL2 gene, comprising the core domains. This form is represented by the human sequence UniProtKB:Q08999-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000119 ! retinoblastoma-like protein 2

[Term]
id: PRO:000000307
name: rho-associated protein kinase 1 isoform 1
def: "A rho-associated protein kinase 1 that is a translation product of a mature transcript of the ROCK1 gene, comprising the core domains. In resting cells, the C-terminal Rho-binding and PH domain mask the protein kinase catalytic domain, activation occurs through a conformational change." [PRO:CNA]
comment: Category=sequence.
synonym: "ROCK1 sequence 1 " EXACT []
is_a: PRO:000000120 ! rho-associated protein kinase 1

[Term]
id: PRO:000000308
name: rho-associated protein kinase 2 isoform 1
def: "A rho-associated protein kinase 1 that is a translation product of a mature transcript of the ROCK2 gene, comprising the core domains. In resting cells, the C-terminal Rho-binding and PH domain mask the protein kinase catalytic domain, activation occurs through a conformational change." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000121 ! rho-associated protein kinase 2

[Term]
id: PRO:000000309
name: rho-associated protein kinase 2 isoform 2
def: "A rho-associated protein kinase 1 that is a translation product of a mature transcript of the ROCK2 gene, comprising the core domains but with an inclusion of an extra exon (exon 27' in mouse) between the rho binding and the PH domains." [PRO:CNA]
comment: Category=sequence.
synonym: "ROCK2M" RELATED []
is_a: PRO:000000121 ! rho-associated protein kinase 2

[Term]
id: PRO:000000310
name: ribosomal protein S6 kinase beta 1 isoform 1
def: "A ribosomal protein S6 kinase beta 1 that is a translation product of a mature transcript of the RPS6KB1 gene, comprising the core domains. This form is represented by the human sequence UniProtKB:P23443-1." [PRO:CNA]
comment: Category=sequence.
synonym: "Alpha I" RELATED []
is_a: PRO:000000123 ! ribosomal protein S6 kinase beta 1

[Term]
id: PRO:000000311
name: ribosomal protein S6 kinase beta 1 isoform 2
def: "A ribosomal protein S6 kinase beta 1 that is a translation product of a mature transcript of the RPS6KB1 gene, comprising the core domains. This form is represented by the human sequence UniProtKB:P23443-2." [PRO:CNA]
comment: Category=sequence.
synonym: "Alpha II" RELATED []
is_a: PRO:000000123 ! ribosomal protein S6 kinase beta 1

[Term]
id: PRO:000000312
name: ribosomal protein S6 kinase beta 2 isoform 1
def: "A ribosomal protein S6 kinase beta 2 that is a translation product of a mature transcript of the RPS6KB2 gene, comprising the core domains. This form is represented by the human sequence UniProtKB:Q9UBS0-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000124 ! ribosomal protein S6 kinase beta 2

[Term]
id: PRO:000000313
name: sara isoform 1
def: "A sara that is a translation product of the longest mature transcript of ZFYVE9 gene, and that contains intact FYVE and smad-binding domains. This form is represented by the human sequence UniProtKB:O95405-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000125 ! sara

[Term]
id: PRO:000000314
name: sara isoform 2
def: "A sara that is a translation product of a mature transcript of the ZFYVE9 gene which lacks an in-frame exon in the coding region as compared to isoform 1, and is represented by the human sequence UniProtKB:O95405-2." [PRO:CNA]
comment: Category=sequence.
synonym: "NSP " RELATED []
is_a: PRO:000000125 ! sara

[Term]
id: PRO:000000315
name: sara isoform 3
def: "A sara that is a translation product of the mature transcript of ZFYVE9 gene, and lacks the smad-binding domain. This form is represented by the human sequence UniProtKB:O95405-3." [PRO:CNA]
comment: Category=sequence.
synonym: "NSP" RELATED []
is_a: PRO:000000125 ! sara

[Term]
id: PRO:000000316
name: serine/threonine-protein kinase receptor R3 isoform 1
def: "A serine/threonine-protein kinase receptor R3 that is a translation product of a mature transcript of the ACVRL1 gene, and that contains an extracellular activin types I and II receptor domain, a transmembrane domain, and an intracellular GS and protein kinase domains. This form is represented by the human sequence UniProtKB:P37023-1." [PRO:CNA]
comment: Category=sequence.
synonym: "ALK1" RELATED []
synonym: "Serine/threonine-protein kinase receptor R3" RELATED []
is_a: PRO:000000126 ! serine/threonine-protein kinase receptor R3

[Term]
id: PRO:000000317
name: serine/threonine-protein kinase receptor R3 sequence variant 1
def: "A serine/threonine-protein kinase receptor R3 that is a translation product of a polymorphic sequence variant of ACVRL1 gene that has a Arg residue at the position equivalent to Gly-48 in human sequence UniProtKB:P37023-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000126 ! serine/threonine-protein kinase receptor R3

[Term]
id: PRO:000000318
name: serine/threonine-protein kinase receptor R3 sequence variant 10
def: "A serine/threonine-protein kinase receptor R3 that is a translation product of a polymorphic sequence variant of ACVRL1 gene that has a Lys residue at the position equivalent to Glu-215 in human sequence UniProtKB:P37023-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000126 ! serine/threonine-protein kinase receptor R3

[Term]
id: PRO:000000319
name: serine/threonine-protein kinase receptor R3 sequence variant 11
def: "A serine/threonine-protein kinase receptor R3 that is a translation product of the ACVRL1 gene with a mutation causing amino acid deletion at the position equivalent to residue 222 in the human sequence UniProtKB:P37023-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000126 ! serine/threonine-protein kinase receptor R3

[Term]
id: PRO:000000320
name: serine/threonine-protein kinase receptor R3 sequence variant 12
def: "A serine/threonine-protein kinase receptor R3 that is a translation product of the ACVRL1 gene with a mutation causing amino acid deletion at the position equivalent to residue 233 in the human sequence UniProtKB:P37023-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000126 ! serine/threonine-protein kinase receptor R3

[Term]
id: PRO:000000321
name: serine/threonine-protein kinase receptor R3 sequence variant 13
def: "A serine/threonine-protein kinase receptor R3 that is a translation product of a polymorphic sequence variant of ACVRL1 gene that has a Arg residue at the position equivalent to Gly-223 in human sequence UniProtKB:P37023-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000126 ! serine/threonine-protein kinase receptor R3

[Term]
id: PRO:000000322
name: serine/threonine-protein kinase receptor R3 sequence variant 14
def: "A serine/threonine-protein kinase receptor R3 that is a translation product of a polymorphic sequence variant of ACVRL1 gene that has a Arg residue at the position equivalent to Lys-229 in human sequence UniProtKB:P37023-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000126 ! serine/threonine-protein kinase receptor R3

[Term]
id: PRO:000000323
name: serine/threonine-protein kinase receptor R3 sequence variant 15
def: "A serine/threonine-protein kinase receptor R3 that is a translation product of the ACVRL1 gene with a mutation causing amino acid deletion at the position equivalent to residue 254 in the human sequence UniProtKB:P37023-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000126 ! serine/threonine-protein kinase receptor R3

[Term]
id: PRO:000000324
name: serine/threonine-protein kinase receptor R3 sequence variant 16
def: "A serine/threonine-protein kinase receptor R3 that is a translation product of a polymorphic sequence variant of ACVRL1 gene that has a Val residue at the position equivalent to Met-376 in human sequence UniProtKB:P37023-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000126 ! serine/threonine-protein kinase receptor R3

[Term]
id: PRO:000000325
name: serine/threonine-protein kinase receptor R3 sequence variant 17
def: "A serine/threonine-protein kinase receptor R3 that is a translation product of a polymorphic sequence variant of ACVRL1 gene that has a Phe residue at the position equivalent to Leu-285 in human sequence UniProtKB:P37023-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000126 ! serine/threonine-protein kinase receptor R3

[Term]
id: PRO:000000326
name: serine/threonine-protein kinase receptor R3 sequence variant 18
def: "A serine/threonine-protein kinase receptor R3 that is a translation product of a polymorphic sequence variant of ACVRL1 gene that has a Pro residue at the position equivalent to Ala-306 in human sequence UniProtKB:P37023-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000126 ! serine/threonine-protein kinase receptor R3

[Term]
id: PRO:000000327
name: serine/threonine-protein kinase receptor R3 sequence variant 19
def: "A serine/threonine-protein kinase receptor R3 that is a translation product of a polymorphic sequence variant of ACVRL1 gene that has a Tyr residue at the position equivalent to His-314 in human sequence UniProtKB:P37023-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000126 ! serine/threonine-protein kinase receptor R3

[Term]
id: PRO:000000328
name: serine/threonine-protein kinase receptor R3 sequence variant 2
def: "A serine/threonine-protein kinase receptor R3 that is a translation product of a polymorphic sequence variant of ACVRL1 gene that has a Cys residue at the position equivalent to Trp-50 in human sequence UniProtKB:P37023-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000126 ! serine/threonine-protein kinase receptor R3

[Term]
id: PRO:000000329
name: serine/threonine-protein kinase receptor R3 sequence variant 20
def: "A serine/threonine-protein kinase receptor R3 that is a translation product of a polymorphic sequence variant of ACVRL1 gene that has an Ile residue at the position equivalent to Ser-333 in human sequence UniProtKB:P37023-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000126 ! serine/threonine-protein kinase receptor R3

[Term]
id: PRO:000000330
name: serine/threonine-protein kinase receptor R3 sequence variant 21
def: "A serine/threonine-protein kinase receptor R3 that is a translation product of a polymorphic sequence variant of ACVRL1 gene that has a Pro residue at the position equivalent to Leu-337 in human sequence UniProtKB:P37023-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000126 ! serine/threonine-protein kinase receptor R3

[Term]
id: PRO:000000331
name: serine/threonine-protein kinase receptor R3 sequence variant 22
def: "A serine/threonine-protein kinase receptor R3 that is a translation product of a polymorphic sequence variant of ACVRL1 gene that has a Tyr residue at the position equivalent to Cys-344 in human sequence UniProtKB:P37023-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000126 ! serine/threonine-protein kinase receptor R3

[Term]
id: PRO:000000332
name: serine/threonine-protein kinase receptor R3 sequence variant 23
def: "A serine/threonine-protein kinase receptor R3 that is a translation product of a polymorphic sequence variant of ACVRL1 gene that has a Pro residue at the position equivalent to Ala-347 in human sequence UniProtKB:P37023-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000126 ! serine/threonine-protein kinase receptor R3

[Term]
id: PRO:000000333
name: serine/threonine-protein kinase receptor R3 sequence variant 24
def: "A serine/threonine-protein kinase receptor R3 that is a translation product of a polymorphic sequence variant of ACVRL1 gene that has a Gln residue at the position equivalent to Arg-374 in human sequence UniProtKB:P37023-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000126 ! serine/threonine-protein kinase receptor R3

[Term]
id: PRO:000000334
name: serine/threonine-protein kinase receptor R3 sequence variant 25
def: "A serine/threonine-protein kinase receptor R3 that is a translation product of a polymorphic sequence variant of ACVRL1 gene that has a Trp residue at the position equivalent to Arg-374 in human sequence UniProtKB:P37023-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000126 ! serine/threonine-protein kinase receptor R3

[Term]
id: PRO:000000335
name: serine/threonine-protein kinase receptor R3 sequence variant 26
def: "A serine/threonine-protein kinase receptor R3 that is a translation product of a polymorphic sequence variant of ACVRL1 gene that has a Leu residue at the position equivalent to Pro-378 in human sequence UniProtKB:P37023-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000126 ! serine/threonine-protein kinase receptor R3

[Term]
id: PRO:000000336
name: serine/threonine-protein kinase receptor R3 sequence variant 27
def: "A serine/threonine-protein kinase receptor R3 that is a translation product of a polymorphic sequence variant of ACVRL1 gene that has a Lys residue at the position equivalent to Glu-379 in human sequence UniProtKB:P37023-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000126 ! serine/threonine-protein kinase receptor R3

[Term]
id: PRO:000000337
name: serine/threonine-protein kinase receptor R3 sequence variant 28
def: "A serine/threonine-protein kinase receptor R3 that is a translation product of a polymorphic sequence variant of ACVRL1 gene that has a Arg residue at the position equivalent to Met-376 in human sequence UniProtKB:P37023-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000126 ! serine/threonine-protein kinase receptor R3

[Term]
id: PRO:000000338
name: serine/threonine-protein kinase receptor R3 sequence variant 29
def: "A serine/threonine-protein kinase receptor R3 that is a translation product of a polymorphic sequence variant of ACVRL1 gene that has a Gly residue at the position equivalent to Asp-397 in human sequence UniProtKB:P37023-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000126 ! serine/threonine-protein kinase receptor R3

[Term]
id: PRO:000000339
name: serine/threonine-protein kinase receptor R3 sequence variant 3
def: "A serine/threonine-protein kinase receptor R3 that is a translation product of a polymorphic sequence variant of ACVRL1 gene that has a Tyr residue at the position equivalent to Cys-51 in human sequence UniProtKB:P37023-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000126 ! serine/threonine-protein kinase receptor R3

[Term]
id: PRO:000000340
name: serine/threonine-protein kinase receptor R3 sequence variant 30
def: "A serine/threonine-protein kinase receptor R3 that is a translation product of a polymorphic sequence variant of ACVRL1 gene that has a Asn residue at the position equivalent to Ile-398 in human sequence UniProtKB:P37023-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000126 ! serine/threonine-protein kinase receptor R3

[Term]
id: PRO:000000341
name: serine/threonine-protein kinase receptor R3 sequence variant 31
def: "A serine/threonine-protein kinase receptor R3 that is a translation product of a polymorphic sequence variant of ACVRL1 gene that has a Ser residue at the position equivalent to Trp-399 in human sequence UniProtKB:P37023-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000126 ! serine/threonine-protein kinase receptor R3

[Term]
id: PRO:000000342
name: serine/threonine-protein kinase receptor R3 sequence variant 32
def: "A serine/threonine-protein kinase receptor R3 that is a translation product of a polymorphic sequence variant of ACVRL1 gene that has a Asp residue at the position equivalent to Glu-407 in human sequence UniProtKB:P37023-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000126 ! serine/threonine-protein kinase receptor R3

[Term]
id: PRO:000000343
name: serine/threonine-protein kinase receptor R3 sequence variant 33
def: "A serine/threonine-protein kinase receptor R3 that is a translation product of a polymorphic sequence variant of ACVRL1 gene that has a Pro residue at the position equivalent to Arg-411 in human sequence UniProtKB:P37023-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000126 ! serine/threonine-protein kinase receptor R3

[Term]
id: PRO:000000344
name: serine/threonine-protein kinase receptor R3 sequence variant 34
def: "A serine/threonine-protein kinase receptor R3 that is a translation product of a polymorphic sequence variant of ACVRL1 gene that has a Gln residue at the position equivalent to Arg-411 in human sequence UniProtKB:P37023-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000126 ! serine/threonine-protein kinase receptor R3

[Term]
id: PRO:000000345
name: serine/threonine-protein kinase receptor R3 sequence variant 35
def: "A serine/threonine-protein kinase receptor R3 that is a translation product of a polymorphic sequence variant of ACVRL1 gene that has a Trp residue at the position equivalent to Arg-411 in human sequence UniProtKB:P37023-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000126 ! serine/threonine-protein kinase receptor R3

[Term]
id: PRO:000000346
name: serine/threonine-protein kinase receptor R3 sequence variant 36
def: "A serine/threonine-protein kinase receptor R3 that is a translation product of a polymorphic sequence variant of ACVRL1 gene that has a Thr residue at the position equivalent to Pro-424 in human sequence UniProtKB:P37023-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000126 ! serine/threonine-protein kinase receptor R3

[Term]
id: PRO:000000347
name: serine/threonine-protein kinase receptor R3 sequence variant 37
def: "A serine/threonine-protein kinase receptor R3 that is a translation product of a polymorphic sequence variant of ACVRL1 gene that has a Leu residue at the position equivalent to Phe-425 in human sequence UniProtKB:P37023-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000126 ! serine/threonine-protein kinase receptor R3

[Term]
id: PRO:000000348
name: serine/threonine-protein kinase receptor R3 sequence variant 38
def: "A serine/threonine-protein kinase receptor R3 that is a translation product of a polymorphic sequence variant of ACVRL1 gene that has a Val residue at the position equivalent to Phe-425 in human sequence UniProtKB:P37023-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000126 ! serine/threonine-protein kinase receptor R3

[Term]
id: PRO:000000349
name: serine/threonine-protein kinase receptor R3 sequence variant 39
def: "A serine/threonine-protein kinase receptor R3 that is a translation product of the ACVRL1 gene with a mutation causing amino acid deletion at the position equivalent to residue 425 in the human sequence UniProtKB:P37023-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000126 ! serine/threonine-protein kinase receptor R3

[Term]
id: PRO:000000350
name: serine/threonine-protein kinase receptor R3 sequence variant 4
def: "A serine/threonine-protein kinase receptor R3 that is a translation product of a polymorphic sequence variant of ACVRL1 gene that has a Gln residue at the position equivalent to Arg-67 in human sequence UniProtKB:P37023-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000126 ! serine/threonine-protein kinase receptor R3

[Term]
id: PRO:000000351
name: serine/threonine-protein kinase receptor R3 sequence variant 40
def: "A serine/threonine-protein kinase receptor R3 that is a translation product of a polymorphic sequence variant of ACVRL1 gene that has a Leu residue at the position equivalent to Arg-479 in human sequence UniProtKB:P37023-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000126 ! serine/threonine-protein kinase receptor R3

[Term]
id: PRO:000000352
name: serine/threonine-protein kinase receptor R3 sequence variant 41
def: "A serine/threonine-protein kinase receptor R3 that is a translation product of a polymorphic sequence variant of ACVRL1 gene that has a Val residue at the position equivalent to Ala-482 in human sequence UniProtKB:P37023-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000126 ! serine/threonine-protein kinase receptor R3

[Term]
id: PRO:000000353
name: serine/threonine-protein kinase receptor R3 sequence variant 42
def: "A serine/threonine-protein kinase receptor R3 that is a translation product of a polymorphic sequence variant of ACVRL1 gene that has a Trp residue at the position equivalent to Arg-484 in human sequence UniProtKB:P37023-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000126 ! serine/threonine-protein kinase receptor R3

[Term]
id: PRO:000000354
name: serine/threonine-protein kinase receptor R3 sequence variant 43
def: "A serine/threonine-protein kinase receptor R3 that is a translation product of a polymorphic sequence variant of ACVRL1 gene that has a Thr residue at the position equivalent to Lys-487 in human sequence UniProtKB:P37023-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000126 ! serine/threonine-protein kinase receptor R3

[Term]
id: PRO:000000355
name: serine/threonine-protein kinase receptor R3 sequence variant 44
def: "A serine/threonine-protein kinase receptor R3 that is a translation product of a polymorphic sequence variant of ACVRL1 gene that has Glu-Pro residues at the position equivalent to Gly48-Ala49 in human sequence UniProtKB:P37023-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000126 ! serine/threonine-protein kinase receptor R3

[Term]
id: PRO:000000356
name: serine/threonine-protein kinase receptor R3 sequence variant 5
def: "A serine/threonine-protein kinase receptor R3 that is a translation product of a polymorphic sequence variant of ACVRL1 gene that has a Trp residue at the position equivalent to Arg-67 in human sequence UniProtKB:P37023-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000126 ! serine/threonine-protein kinase receptor R3

[Term]
id: PRO:000000357
name: serine/threonine-protein kinase receptor R3 sequence variant 6
def: "A serine/threonine-protein kinase receptor R3 that is a translation product of a polymorphic sequence variant of ACVRL1 gene that has a Trp residue at the position equivalent to Cys-77 in human sequence UniProtKB:P37023-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000126 ! serine/threonine-protein kinase receptor R3

[Term]
id: PRO:000000358
name: serine/threonine-protein kinase receptor R3 sequence variant 7
def: "A serine/threonine-protein kinase receptor R3 that is a translation product of a polymorphic sequence variant of ACVRL1 gene that has an Asp residue at the position equivalent to Asn-96 in human sequence UniProtKB:P37023-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000126 ! serine/threonine-protein kinase receptor R3

[Term]
id: PRO:000000359
name: serine/threonine-protein kinase receptor R3 sequence variant 8
def: "A serine/threonine-protein kinase receptor R3 that is a translation product of a polymorphic sequence variant of ACVRL1 gene that has an Ala residue at the position equivalent to Asp-179 in human sequence UniProtKB:P37023-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000126 ! serine/threonine-protein kinase receptor R3

[Term]
id: PRO:000000360
name: serine/threonine-protein kinase receptor R3 sequence variant 9
def: "A serine/threonine-protein kinase receptor R3 that is a translation product of a polymorphic sequence variant of ACVRL1 gene that has a Asp residue at the position equivalent to Gly-211 in human sequence UniProtKB:P37023-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000126 ! serine/threonine-protein kinase receptor R3

[Term]
id: PRO:000000361
name: smad ubiquitination regulatory factor 1
def: "A smad ubiquitination regulatory factor that is a translation product of the SMURF1 gene." [PRO:CNA]
comment: Category=gene.
synonym: "E3 ubiquitin-protein ligase SMURF1" EXACT []
synonym: "Smad-specific E3 ubiquitin ligase 1" EXACT []
synonym: "smurf1" EXACT []
is_a: PRO:000000127 ! smad ubiquitination regulatory factor

[Term]
id: PRO:000000362
name: smad ubiquitination regulatory factor 2
def: "A smad ubiquitination regulatory factor that is a translation product of the SMURF2 gene." [PRO:CNA]
comment: Category=gene.
synonym: "E3 ubiquitin-protein ligase SMURF2" EXACT []
synonym: "Smad-specific E3 ubiquitin ligase 2" EXACT []
synonym: "SMURF2" EXACT []
synonym: "SMURF2 isoform 1" EXACT []
is_a: PRO:000000127 ! smad ubiquitination regulatory factor

[Term]
id: PRO:000000363
name: smad1
def: "A BMP receptor-regulated smad protein that is a translation product of the SMAD1 gene." [PMID:10708949, PRO:CNA]
comment: Category=gene.
synonym: "BSP-1" EXACT []
synonym: "BSP1" RELATED []
synonym: "Dwarfin-A" EXACT []
synonym: "Dwf-A" EXACT []
synonym: "JV4-1" EXACT []
synonym: "Mad-related protein 1" EXACT []
synonym: "Mad1" EXACT []
synonym: "MADH1" RELATED []
synonym: "MADR1" RELATED []
synonym: "Mothers against decapentaplegic homolog 1" EXACT []
synonym: "Mothers against DPP homolog 1" EXACT []
synonym: "Mothers-against-DPP-related 1" EXACT []
synonym: "SMAD 1" EXACT []
synonym: "SMAD1" RELATED []
synonym: "Transforming growth factor-beta-signaling protein 1" EXACT []
is_a: PRO:000000038 ! BMP receptor-regulated smad protein

[Term]
id: PRO:000000364
name: smad2
def: "A TGF-beta receptor-regulated smad protein that is a translation product of the SMAD2 gene." [PMID:9311995]
comment: Category=gene.
synonym: "JV18-1" EXACT []
synonym: "MAD homolog 2 " RELATED []
synonym: "MAD-2" EXACT []
synonym: "Mad-related protein 2" EXACT []
synonym: "Mad2" EXACT []
synonym: "MADH2" RELATED []
synonym: "Mothers against decapentaplegic homolog 2 " RELATED []
synonym: "Mothers against DPP homolog 2 " RELATED []
synonym: "SMAD 2" EXACT []
is_a: PRO:000000066 ! TGF-beta receptor-regulated smad protein

[Term]
id: PRO:000000365
name: smad3
def: "A TGF-beta receptor-regulated smad protein that is a translation product of the SMAD3 gene." [PMID:9311995]
comment: Category=gene.
synonym: "JV15-2" EXACT []
synonym: "MAD-3" EXACT []
synonym: "Mad3" EXACT []
synonym: "MADH3" RELATED []
synonym: "Mothers against decapentaplegic homolog 3" RELATED []
synonym: "Mothers against DPP homolog 3" EXACT []
synonym: "SMAD 3" EXACT []
is_a: PRO:000000066 ! TGF-beta receptor-regulated smad protein

[Term]
id: PRO:000000366
name: smad4 isoform 1
def: "A smad4 that is a translation product of a mature transcript of the SMAD4 gene, and that contains the MH1 domain and the MH2 domain. This form is represented by the human sequence UniProtKB:Q13485-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000128 ! smad4

[Term]
id: PRO:000000367
name: smad4 sequence variant 1
def: "A smad4 that is a translation product of a polymorphic sequence variant of SMAD4 gene that has a Gly residue at the position equivalent to Glu-330 in human sequence UniProtKB:Q13485-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000128 ! smad4

[Term]
id: PRO:000000368
name: smad4 sequence variant 2
def: "A smad4 that is a translation product of a polymorphic sequence variant of SMAD4 gene that has a Arg residue at the position equivalent to Gly-352 in human sequence UniProtKB:Q13485-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000128 ! smad4

[Term]
id: PRO:000000369
name: smad4 sequence variant 3
def: "A smad4 that is a translation product of a polymorphic sequence variant of SMAD4 gene that has a Cys residue at the position equivalent to Arg-361 in human sequence UniProtKB:Q13485-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000128 ! smad4

[Term]
id: PRO:000000370
name: smad4 sequence variant 4
def: "A smad4 that is a translation product of a polymorphic sequence variant of SMAD4 gene that has a Asp residue at the position equivalent to Gly-386 in human sequence UniProtKB:Q13485-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000128 ! smad4

[Term]
id: PRO:000000371
name: smad4 sequence variant 5
def: "A smad4 that is a translation product of a polymorphic sequence variant of SMAD4 gene that has a His residue at the position equivalent to Asp-493 in human sequence UniProtKB:Q13485-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000128 ! smad4

[Term]
id: PRO:000000372
name: smad5
def: "A BMP receptor-regulated smad protein that is a translation product of the SMAD5 gene." [PMID:10708949]
comment: Category=gene.
synonym: "Dwarfin-C" EXACT []
synonym: "Dwf-C" EXACT []
synonym: "JV5-1" EXACT []
synonym: "MADH5" RELATED []
synonym: "Mothers against decapentaplegic homolog 5" RELATED []
synonym: "Mothers against DPP homolog 5" EXACT []
synonym: "SMAD 5" EXACT []
is_a: PRO:000000038 ! BMP receptor-regulated smad protein

[Term]
id: PRO:000000373
name: smad6
def: "An inhibitory smad protein that is a translation product of the SMAD6 gene. Inhibitor of bone morphogenetic protein (BMP) signaling, and the interaction with BMP type 1 receptors is a critical step in the function of smad6." [PMID:17493940]
comment: Category=gene.
synonym: "Mad homolog 7" EXACT []
synonym: "MADH6" RELATED []
synonym: "Madh7" RELATED []
synonym: "Mothers against decapentaplegic homolog 6" RELATED []
synonym: "Mothers against DPP homolog 6" EXACT []
synonym: "SMAD 6" EXACT []
is_a: PRO:000000099 ! inhibitory smad protein

[Term]
id: PRO:000000374
name: smad7
def: "An inhibitory smad protein that is a translation product of the SMAD7 gene. Smad7 is a negative regulator of TGF-beta signaling." [PMID:17438144]
comment: Category=gene.
synonym: "MADH7" RELATED []
synonym: "Madh8" EXACT []
synonym: "Mothers against decapentaplegic homolog 7" RELATED []
synonym: "Mothers against DPP homolog 7" EXACT []
synonym: "SMAD 7" EXACT []
is_a: PRO:000000099 ! inhibitory smad protein

[Term]
id: PRO:000000375
name: smad9
def: "A BMP receptor-regulated smad protein that is a translation product of the SMAD9 gene." [PMID:10708948]
comment: Category=gene.
synonym: "MADH6" RELATED []
synonym: "Madh8" RELATED []
synonym: "Madh9" RELATED []
synonym: "Mothers against decapentaplegic homolog 9" RELATED []
synonym: "Mothers against DPP homolog 9" EXACT []
synonym: "SMAD 9" EXACT []
synonym: "SMAD8" RELATED []
is_a: PRO:000000038 ! BMP receptor-regulated smad protein

[Term]
id: PRO:000000376
name: thrombospondin 1 isoform 1
def: "A thrombospondin 1 that is a translation product of a mature transcript of the THBS1 gene, comprising all core domains. This form is represented by the human sequence UniProtKB:P07996-1. This form is the precursor of the mature protein." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000129 ! thrombospondin 1

[Term]
id: PRO:000000377
name: thrombospondin 2 isoform 1
def: "A thrombospondin 2 that is a translation product of a mature transcript of the THBS2 gene, comprising all core domains. This form is represented by the human sequence UniProtKB:P35442-1. This form is the precursor of the mature protein." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000130 ! thrombospondin 2

[Term]
id: PRO:000000378
name: thrombospondin 3 isoform 1
def: "A thrombospondin 3 that is a translation product of a mature transcript of the THBS3 gene, comprising all core domains. This form is represented by the human sequence UniProtKB:P49746-1. This form is the precursor of the mature protein." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000131 ! thrombospondin 3

[Term]
id: PRO:000000379
name: thrombospondin 4 isoform 1
def: "A thrombospondin 4 that is a translation product of a mature transcript of the THBS4 gene, comprising all core domains. This form is represented by the human sequence UniProtKB:P35443-1. This form is the precursor of the mature protein." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000132 ! thrombospondin 4

[Term]
id: PRO:000000380
name: transcription factor Sp1 isoform 1
def: "A transcription factor Sp1 that is a translation product of a mature transcript of the SP1 gene, including all coding exons. This form is represented by the human sequence UniProtKB:P08047-1." [PMID:10570957]
comment: Category=sequence.
is_a: PRO:000000133 ! transcription factor Sp1

[Term]
id: PRO:000000381
name: tumor necrosis factor alpha isoform 1
def: "A tumor necrosis factor alpha that is a translation product of a mature transcript of the TNF gene, and that contains a type II transmembrane domain, containing a C-terminus that is external to the cell and a cytoplasmic domain. This form is represented by the human sequence UniProtKB:P01375-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000134 ! tumor necrosis factor alpha

[Term]
id: PRO:000000382
name: BMP receptor type-1A isoform 1 phosphorylated form
def: "A BMPR1A isoform 1 that has been post-translationally modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000136 ! BMP receptor type-1A isoform 1
intersection_of: has_modification MOD:00696 ! phosphorylated residue

[Term]
id: PRO:000000383
name: BMP receptor type-1B isoform 1 phosphorylated form
def: "A BMPR1B isoform 1 that has been post-translationally modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000145 ! BMP receptor type-1B isoform 1
intersection_of: has_modification MOD:00696 ! phosphorylated residue

[Term]
id: PRO:000000384
name: BMP10 isoform 1
def: "A BMP10 that is a translation product of a mature transcript of the BMP10 gene, and that contains a signal peptide, a propeptide and a TGF-beta-like cysteine knot domain. This form is represented by the human sequence UniProtKB:O95393-1. This form is the precursor." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000163 ! BMP10

[Term]
id: PRO:000000385
name: BMP2 isoform 1
def: "A BMP2 that is a translation product of a mature transcript of the BMP2 gene, and that contains a signal peptide, a propeptide and a TGF-beta-like cysteine knot domain. This form is represented by the human sequence UniProtKB:P12643-1. This form is a precursor." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000164 ! BMP2

[Term]
id: PRO:000000386
name: BMP4 isoform 1
def: "A BMP4 that is a translation product of a mature transcript of the BMP4 gene, and that contains a signal peptide, a propeptide and a TGF-beta-like cysteine knot domain. This form is represented by the human sequence UniProtKB:P12644-1. This form is a precursor." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000165 ! BMP4

[Term]
id: PRO:000000387
name: BMP5 isoform 1
def: "A BMP5 that is a translation product of a mature transcript of the BMP5 gene, and that contains a signal peptide, a propeptide and a TGF-beta-like cysteine knot domain. This form is represented by the human sequence UniProtKB:P22003-1. This form is a precursor." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000166 ! BMP5

[Term]
id: PRO:000000388
name: BMP6 isoform 1
def: "A BMP6 that is a translation product of a mature transcript of the BMP6 gene, and that contains a signal peptide, a propeptide and a TGF-beta-like cysteine knot domain. This form is represented by the human sequence UniProtKB:P22004-1. This form is a precursor." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000167 ! BMP6

[Term]
id: PRO:000000389
name: BMP7 isoform 1
def: "A BMP7 that is a translation product of a mature transcript of the BMP7 gene, and that contains a signal peptide, a propeptide and a TGF-beta-like cysteine knot domain. This form is represented by the human sequence UniProtKB:P18075-1. This form is the precursor of the mature protein." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000168 ! BMP7

[Term]
id: PRO:000000390
name: BMP8A isoform 1
def: "A BMP8A that is a translation product of a mature transcript of the BMP8A gene, and that contains a signal peptide, a propeptide and a TGF-beta-like cysteine knot domain. This form is represented by the human sequence UniProtKB:Q7Z5Y6-1. This form is the precursor of the mature protein." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000169 ! BMP8A

[Term]
id: PRO:000000391
name: BMP8B isoform 1
def: "A BMP8B that is a translation produce to a mature transcript of BMP8B gene, and that contains a signal peptide, a propeptide and a TGF-beta-like cysteine knot domain. This form is represented by the human sequence UniProtKB:P34820-1. This form is a precursor." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000170 ! BMP8B

[Term]
id: PRO:000000392
name: DNA-binding protein inhibitor ID-2 isoform 1 phosphorylated form
def: "A DNA-binding protein inhibitor ID-2 isoform 1 that has been post-translationally modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000173 ! DNA-binding protein inhibitor ID-2 isoform 1
intersection_of: has_modification MOD:00696 ! phosphorylated residue

[Term]
id: PRO:000000393
name: DNA-binding protein inhibitor ID-3 isoform 1 phosphorylated form
def: "A DNA-binding protein inhibitor ID-3 isoform 1 that has been post-translationally modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000174 ! DNA-binding protein inhibitor ID-3 isoform 1
intersection_of: has_modification MOD:00696 ! phosphorylated residue

[Term]
id: PRO:000000394
name: DNA-binding protein inhibitor ID-3 isoform 1 ubiquitinated form
def: "A DNA-binding protein inhibitor ID-3 isoform 1 that has been post-translationally modified to include an isopeptide crosslinked residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000174 ! DNA-binding protein inhibitor ID-3 isoform 1
intersection_of: has_modification MOD:01148 ! ubiquitinylated lysine

[Term]
id: PRO:000000395
name: GTP-binding protein RhoA isoform 1
def: "A GTP-binding protein RhoA that is a translation product of a mature transcript of the RhoA gene, represented by the human sequence UniProtKB:P61586-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000176 ! GTP-binding protein RhoA

[Term]
id: PRO:000000396
name: RING-box protein 2 isoform 1 phosphorylated form
def: "A RING-box protein 2 isoform 1 that has been post-translationally modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000178 ! RING-box protein 2 isoform 1
intersection_of: has_modification MOD:00696 ! phosphorylated residue

[Term]
id: PRO:000000397
name: TGF-beta 1 isoform 1
def: "A TGF-beta 1 that is a translation product of a mature transcript of the TGFB1 gene, and includes all core domains (signal peptide, latent associated peptide and a transforming growth factor beta like domain). This form is represented by the human sequence UniProtKB:P01137-1. This form is a precursor." [PRO:CNA]
comment: Category=sequence.
synonym: "precursor" RELATED []
is_a: PRO:000000182 ! TGF-beta 1

[Term]
id: PRO:000000398
name: TGF-beta 1 sequence variant 1
def: "A TGF-beta 1 that is a translation product of a polymorphic sequence variant of TGFB1 gene that has a Pro residue at the position equivalent to Leu-10 in the human sequence UniProtKB:P01137-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000182 ! TGF-beta 1

[Term]
id: PRO:000000399
name: TGF-beta 1 sequence variant 2
def: "A TGF-beta 1 that is a translation product of a polymorphic sequence variant of TGFB1 gene that has a His residue at the position equivalent to Tyr-81 in the human sequence UniProtKB:P01137-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000182 ! TGF-beta 1

[Term]
id: PRO:000000400
name: TGF-beta 1 sequence variant 3
def: "A TGF-beta 1 that is a translation product of a polymorphic sequence variant of TGFB1 gene that has a Cys residue at the position equivalent to Arg-218 in the human sequence UniProtKB:P01137-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000182 ! TGF-beta 1

[Term]
id: PRO:000000401
name: TGF-beta 1 sequence variant 4
def: "A TGF-beta 1 that is a translation product of a polymorphic sequence variant of TGFB1 gene that has a His residue at the position equivalent to Arg-218 in the human sequence UniProtKB:P01137-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000182 ! TGF-beta 1

[Term]
id: PRO:000000402
name: TGF-beta 1 sequence variant 5
def: "A TGF-beta 1 that is a translation product of a polymorphic sequence variant of TGFB1 gene that has a Asp residue at the position equivalent to His-222 in the human sequence UniProtKB:P01137-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000182 ! TGF-beta 1

[Term]
id: PRO:000000403
name: TGF-beta 1 sequence variant 6
def: "A TGF-beta 1 that is a translation product of a polymorphic sequence variant of TGFB1 gene that has a Arg residue at the position equivalent to Cys-225 in the human sequence UniProtKB:P01137-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000182 ! TGF-beta 1

[Term]
id: PRO:000000404
name: TGF-beta 2 isoform 1
def: "A TGF-beta 2 that is a translation product of a mature transcript of the TGFB2 gene, and that contains a signal peptide, a propeptide and a TGF-beta-like cysteine knot domain. This form is represented by the human sequence UniProtKB:P61812-1. This form is a precursor and is upregulated in Alzheimer's disease." [PRO:CNA]
comment: Category=sequence.
synonym: "isoform A" RELATED []
synonym: "TGF-beta 2(414)" RELATED []
is_a: PRO:000000183 ! TGF-beta 2

[Term]
id: PRO:000000405
name: TGF-beta 2 isoform 2
def: "A TGF-beta 2 that is a translation product of a mature transcript of the TGFB2 gene, that has an insertion of around 30 amino acids in the propeptide region encoded by an additional cassette type exon, as in the exon between exons 1 and 2 (Exon 2b) in human. Represented by the human sequence UniProtKB:P61812-2." [PMID:16868931, PMID:1777240, PMID:2850146, PRO:CNA]
comment: Category=sequence.
synonym: "isoform B" RELATED []
synonym: "TGF-beta 2(442)" RELATED []
is_a: PRO:000000183 ! TGF-beta 2

[Term]
id: PRO:000000406
name: TGF-beta 3 isoform 1
def: "A TGF-beta 3 that is a translation product of a mature transcript of the TGFB3 gene, and includes all core domains (signal peptide, latent associated peptide and a transforming growth factor beta like domain). This form is represented by the human sequence UniProtKB:P10600-1. This form is a precursor." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000184 ! TGF-beta 3

[Term]
id: PRO:000000407
name: TGF-beta receptor type-1 isoform 1 cleaved form
def: "A TGF-beta receptor type-1 isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000185 ! TGF-beta receptor type-1 isoform 1
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000000408
name: TGF-beta receptor type-1 isoform 1 cleaved and phosphorylated form
def: "A TGFBR1 isoform 1 that has been post-translationally modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000185 ! TGF-beta receptor type-1 isoform 1
intersection_of: has_modification MOD:00696 ! phosphorylated residue
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000000409
name: TGF-beta receptor type-2 isoform 1 cleaved 1
def: "A TGF-beta receptor type-2 isoform 1 cleaved form that has been processed to a mature receptor by removal of the signal peptide." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000000197 ! TGF-beta receptor type-2 isoform 1 cleaved form

[Term]
id: PRO:000000410
name: TGF-beta receptor type-2 isoform 1 phosphorylated 1
def: "A TGF-beta receptor type-2 phosphorylated form that has been phosphorylated as a result of EGF signaling pathway activation." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000000198 ! TGF-beta receptor type-2 isoform 1 phosphorylated form

[Term]
id: PRO:000000411
name: activin receptor type-1 isoform 1 cleaved and phosphorylated form
def: "An activin receptor type-1 isoform 1 from which the signal peptide has been cleaved, and that has been modified to include phosphorylated residues." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000199 ! activin receptor type-1 isoform 1
intersection_of: has_modification MOD:00696 ! phosphorylated residue
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000000412
name: activin receptor type-1B isoform 1 phosphorylated form
def: "An activin receptor type-1B isoform 1 that has been post-translationally modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000201 ! activin receptor type-1B isoform 1
intersection_of: has_modification MOD:00696 ! phosphorylated residue

[Term]
id: PRO:000000413
name: activin receptor type-1C isoform 1 phosphorylated form
def: "An activin receptor type-1C isoform 1 that has been post-translationally modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000204 ! activin receptor type-1C isoform 1
intersection_of: has_modification MOD:00696 ! phosphorylated residue

[Term]
id: PRO:000000414
name: activin receptor type-2A isoform 1 glycosylated and phosphorylated form
def: "An activin receptor type-2A isoform 1 that has been post-translationally modified to include a glycosylated and a phosphorylated residues." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000208 ! activin receptor type-2A isoform 1
intersection_of: has_modification MOD:00693 ! glycosylated residue
intersection_of: has_modification MOD:00696 ! phosphorylated residue

[Term]
id: PRO:000000415
name: activin receptor type-2B isoform 1 glycosylated and phosphorylated form
def: "An ACVR2B isoform 1 that has been post-translationally modified to include a glycosylated and a phosphorylated residues." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000209 ! activin receptor type-2B isoform 1
intersection_of: has_modification MOD:00693 ! glycosylated residue
intersection_of: has_modification MOD:00696 ! phosphorylated residue

[Term]
id: PRO:000000416
name: activin/inhibin beta A chain isoform 1
def: "An activin/inhibin beta A chain that is a translation product of a mature transcript of the INHBA gene, and that contains a signal peptide, a propeptide and a TGF-beta-like cysteine knot domain. This form is represented by the human sequence UniProtKB:P08476-1. This form is the precursor." [PMID:15319829, PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000216 ! activin/inhibin beta A chain

[Term]
id: PRO:000000417
name: activin/inhibin beta B chain isoform 1
def: "An activin/inhibin beta B chain that is a translation product of a mature transcript of the INHBB gene, and that contains a signal peptide, a propeptide and a TGF-beta-like cysteine knot domain. This form is represented by the human sequence UniProtKB:P09529-1. This form is the precursor." [PMID:15319829]
comment: Category=sequence.
is_a: PRO:000000217 ! activin/inhibin beta B chain

[Term]
id: PRO:000000418
name: activin/inhibin beta E chain isoform 1
def: "An activin/inhibin beta E chain that is a translation product of a mature transcript of the INHBE gene, and that contains a signal peptide, a propeptide and a TGF-beta-like cysteine knot domain. This form is represented by the human sequence UniProtKB:P58166-1. This form is the precursor." [PMID:11134153]
comment: Category=sequence.
is_a: PRO:000000219 ! activin/inhibin beta E chain

[Term]
id: PRO:000000419
name: anti-Muellerian hormone isoform 1 cleaved and glycosylated form
def: "An anti-Muellerian hormone isoform 1 that has been processed by proteolytic cleavage and has been post-translationally modified to include a glycosylated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000220 ! anti-Muellerian hormone isoform 1
intersection_of: has_modification MOD:00693 ! glycosylated residue
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000000420
name: c-myc protein isoform 1 acetylated form
def: "A c-myc protein isoform 1 that has been post-translationally modified to include an acetylated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000228 ! c-myc protein isoform 1
intersection_of: has_modification MOD:00394 ! acetylated residue

[Term]
id: PRO:000000421
name: c-myc protein isoform 1 glycosylated form
def: "A c-myc protein isoform 1 that has been post-translationally modified to include a glycosylated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000228 ! c-myc protein isoform 1
intersection_of: has_modification MOD:00693 ! glycosylated residue

[Term]
id: PRO:000000422
name: c-myc protein isoform 1 phosphorylated form
def: "A c-myc protein isoform 1 that has been post-translationally modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000228 ! c-myc protein isoform 1
intersection_of: has_modification MOD:00696 ! phosphorylated residue

[Term]
id: PRO:000000423
name: cartilage oligomeric matrix protein isoform 1 cleaved form
def: "A cartilage oligomeric matrix protein isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000230 ! cartilage oligomeric matrix protein isoform 1
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000000424
name: chordin isoform 1 cleaved 1
def: "A chordin isoform 1 cleaved form that has processed by removal of the signal peptide." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000000264 ! chordin isoform 1 cleaved form

[Term]
id: PRO:000000425
name: chordin isoform 1 cleaved 2
def: "A chordin isoform 1 cleaved form that has been cleaved by BMP1 at two sites upstream of Asp residues. One site is within the motif Y[SN]DR, whereas the other is within the motif MQ[AS]DG. This form activates BMP signaling pathway." [PMID:10479448, UniProtKB:Q9Z0E2]
comment: Category=modification.
is_a: PRO:000000264 ! chordin isoform 1 cleaved form

[Term]
id: PRO:000000426
name: creb-binding protein isoform 1 methylated form
def: "A CREBBP isoform 1 that has been post-translationally modified to include a methylated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000265 ! creb-binding protein isoform 1
intersection_of: has_modification MOD:00427 ! methylated residue

[Term]
id: PRO:000000427
name: cullin 1 isoform 1 neddylated form
def: "A cullin 1 isoform 1 that has been post-translationally modified to include a neddylated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000267 ! cullin 1 isoform 1
intersection_of: has_modification MOD:01150 ! neddylated lysine

[Term]
id: PRO:000000428
name: cyclin-dependent kinase 4 inhibitor B isoform 1 phosphorylated form
def: "A CDKN2B isoform 1 that has been post-translationally modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000268 ! cyclin-dependent kinase 4 inhibitor B isoform 1
intersection_of: has_modification MOD:00696 ! phosphorylated residue

[Term]
id: PRO:000000429
name: decorin isoform 1 cleaved and glycosylated form
def: "A decorin isoform 1 that has been processed by proteolytic cleavage and has been post-translationally modified to include a glycosylated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000271 ! decorin isoform 1
intersection_of: has_modification MOD:00693 ! glycosylated residue
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000000430
name: decorin isoform 1 cleaved form
def: "A decorin isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000271 ! decorin isoform 1
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000000431
name: fas ligand isoform 1 cleaved form
def: "A fas ligand isoform FasL that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000276 ! fas ligand isoform 1
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000000432
name: fas ligand isoform 1 glycosylated form
def: "A fas ligand isoform FasL that has been post-translationally modified to include a glycosylated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000276 ! fas ligand isoform 1
intersection_of: has_modification MOD:00693 ! glycosylated residue

[Term]
id: PRO:000000433
name: follistatin isoform 1 cleaved and glycosylated 1
def: "A follistatin isoform 1 cleaved and glycosylated form that has been glycosylated and processed to a mature protein by removal of the signal peptide. This form is secreted and biologically active." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000000279 ! follistatin isoform 1 cleaved and glycosylated form

[Term]
id: PRO:000000434
name: follistatin isoform 1 cleaved and glycosylated 2
def: "A follistatin isoform 1 cleaved and glycosylated form that has been processed to a mature protein by cleavage after the signal peptide and further cleavage of the C-terminal residues up to, but not including, the acidic region." [PMID:8340384, PRO:CNA]
comment: Category=modification.
synonym: "FS303" RELATED []
is_a: PRO:000000279 ! follistatin isoform 1 cleaved and glycosylated form

[Term]
id: PRO:000000435
name: follistatin isoform 2 cleaved and glycosylated 1
def: "A follistatin isoform 2 cleaved and glycosylated form that has been processed to a mature protein by removal of the signal peptide." [PMID:16150905]
comment: Category=modification.
is_a: PRO:000000280 ! follistatin isoform 2 cleaved and glycosylated form

[Term]
id: PRO:000000436
name: growth/differentiation factor 5 isoform 1
def: "A growth/differentiation factor 5 that is a translation product of a mature transcript of the GDF5 gene, and that contains a signal peptide, a propeptide and a TGF-beta-like cysteine knot domain. This form is represented by the human sequence UniProtKB:P43026-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000281 ! growth/differentiation factor 5

[Term]
id: PRO:000000437
name: growth/differentiation factor 5 sequence variant 1
def: "A growth/differentiation factor 5 that is a translation product of a polymorphic sequence variant of GDF5 gene that has a Tyr residue at the position equivalent to Cys-400 in the human sequence UniProtKB:P43026-1." [PMID:9288098, PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000281 ! growth/differentiation factor 5

[Term]
id: PRO:000000438
name: growth/differentiation factor 5 sequence variant 2
def: "A growth/differentiation factor 5 that is a translation product of a polymorphic sequence variant of GDF5 gene that has a Leu residue at the position equivalent to Arg-438 in the human sequence UniProtKB:P43026-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000281 ! growth/differentiation factor 5

[Term]
id: PRO:000000439
name: growth/differentiation factor 5 sequence variant 3
def: "A growth/differentiation factor 5 that is a translation product of a polymorphic sequence variant of GDF5 gene that has a Pro residue at the position equivalent to Leu-441 in the human sequence UniProtKB:P43026-1." [PMID:12121354, PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000281 ! growth/differentiation factor 5

[Term]
id: PRO:000000440
name: growth/differentiation factor 5 sequence variant 4
def: "A growth/differentiation factor 5 that is a translation product of the GDF5 gene with a mutation causing polypeptide truncation at the position equivalent to residue 185 in the mouse sequence UniProtKB:P43027-1." [PMID:8145850, PRO:CNA]
comment: Category=sequence.
synonym: "bp-3J" RELATED []
is_a: PRO:000000281 ! growth/differentiation factor 5

[Term]
id: PRO:000000441
name: growth/differentiation factor 5 sequence variant 5
def: "A growth/differentiation factor 5 that is a translation product of the GDF5 gene with a mutation causing a frameshift at the position equivalent to residue 376 in the mouse sequence UniProtKB:P43027-1." [PMID:8145850, PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000281 ! growth/differentiation factor 5

[Term]
id: PRO:000000442
name: growth/differentiation factor 7 isoform 1
def: "A growth/differentiation factor 7 that is a translation product of a mature transcript of the GDF7 gene, and that contains a signal peptide, a propeptide and a TGF-beta-like cysteine knot domain. This form is represented by the mouse sequence UniProtKB:P43029-1. This form is a precursor." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000282 ! growth/differentiation factor 7

[Term]
id: PRO:000000443
name: growth/differentiation factor 7 isoform 2
def: "A growth/differentiation factor 7 that is a translation product of a mature transcript of the GDF7 gene, and that contains a signal peptide, a propeptide and a TGF-beta-like cysteine knot domain. This form is represented by the mouse sequence UniProtKB:P43029-2.  This form has a shorter propeptide as compared to PRO:000000442." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000282 ! growth/differentiation factor 7

[Term]
id: PRO:000000444
name: inhibin beta C chain isoform 1
def: "An inhibin beta C chain protein that is a translation product of a mature transcript of the INHBC gene, and that contains a signal peptide, a propeptide and a TGF-beta-like cysteine knot domain. This form is represented by the human sequence UniProtKB:P55103-1. This form is a precursor." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000218 ! activin/inhibin beta C chain

[Term]
id: PRO:000000445
name: interferon gamma isoform 1 cleaved 1
def: "An interferon gamma isoform 1 cleaved form that is a mature protein." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000000284 ! interferon gamma isoform 1 cleaved form

[Term]
id: PRO:000000446
name: interferon gamma isoform 1 cleaved and glycosylated 1
def: "An interferon gamma isoform 1 cleaved and glycosylated form that is a mature protein." [PMID:3109913]
comment: Category=modification.
is_a: PRO:000000283 ! interferon gamma isoform 1 cleaved and glycosylated form

[Term]
id: PRO:000000447
name: interferon gamma isoform 1 cleaved and glycosylated 2
def: "An interferon gamma isoform 1 cleaved and glycosylated form that is a mature protein with partial proteolytic degradation of the C-terminus." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000000283 ! interferon gamma isoform 1 cleaved and glycosylated form

[Term]
id: PRO:000000448
name: latent-TGF-beta-binding protein 1 isoform 1 cleaved form
def: "A latent-TGF-beta-binding protein 1 isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000285 ! latent-TGF-beta-binding protein 1 isoform 1
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000000449
name: latent-TGF-beta-binding protein 1 isoform 2 cleaved form
def: "A latent-TGF-beta-binding protein 1 isoform 1S that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000286 ! latent-TGF-beta-binding protein 1 isoform 2
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000000450
name: lefty 1 isoform 1
def: "A lefty 1 that is a translation product of a mature transcript of the LEFTY1 gene, and that contains a signal peptide, a propeptide and a TGF-beta-like cysteine knot domain. This form is represented by the human sequence UniProtKB:O75610-1. This form is a precursor." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000287 ! lefty 1

[Term]
id: PRO:000000451
name: lefty 2 isoform 1
def: "A lefty 2 that is a translation product of a mature transcript of the LEFTY2 gene, and that contains a signal peptide, a propeptide and a TGF-beta-like cysteine knot domain. This form is represented by the human sequence UniProtKB:O00292-1. This form is a precursor." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000288 ! lefty 2

[Term]
id: PRO:000000452
name: lefty 2 sequence variant 1
def: "A lefty 2 that is a translation product of the LEFTY2 gene that has a Asn residue at the position equivalent to Ser-342 in the human sequence UniProtKB:O00292-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000288 ! lefty 2

[Term]
id: PRO:000000453
name: mitogen-activated protein kinase 1 isoform 1 cleaved and acetylated form
def: "A MAPK1 isoform 1 which N-terminus methionine has been cleaved, and has been post-translationally modified to include an acetylated residue." [PMID:12665801, PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000289 ! mitogen-activated protein kinase 1 isoform 1
intersection_of: has_modification MOD:00394 ! acetylated residue
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000000454
name: mitogen-activated protein kinase 1 isoform 1 phosphorylated form
def: "A MAPK1 isoform 1 that has been post-translationally modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000289 ! mitogen-activated protein kinase 1 isoform 1
intersection_of: has_modification MOD:00696 ! phosphorylated residue

[Term]
id: PRO:000000455
name: mitogen-activated protein kinase 3 isoform 1 phosphorylated form
def: "A mitogen-activated protein kinase 3 isoform 1 that has been post-translationally modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000290 ! mitogen-activated protein kinase 3 isoform 1
intersection_of: has_modification MOD:00696 ! phosphorylated residue

[Term]
id: PRO:000000456
name: nodal isoform 1 cleaved form
def: "A nodal isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000291 ! nodal isoform 1
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000000457
name: noggin isoform 1 cleaved 1
def: "A noggin isoform 1 cleaved form whose signal peptide has been removed." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000000293 ! noggin isoform 1 cleaved form

[Term]
id: PRO:000000458
name: retinoblastoma-like protein 1 isoform 1 phosphorylated form
def: "A retinoblastoma-like protein 1 isoform 1 that has been post-translationally modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000303 ! retinoblastoma-like protein 1 isoform 1
intersection_of: has_modification MOD:00696 ! phosphorylated residue

[Term]
id: PRO:000000459
name: retinoblastoma-like protein 2 isoform 1 phosphorylated form
def: "A RBL2 isoform 1 that has been post-translationally modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000306 ! retinoblastoma-like protein 2 isoform 1
intersection_of: has_modification MOD:00696 ! phosphorylated residue

[Term]
id: PRO:000000460
name: rho-associated protein kinase 1 isoform 1 cleaved form
def: "A rho-associated protein kinase 1 isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000307 ! rho-associated protein kinase 1 isoform 1
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000000461
name: rho-associated protein kinase 2 isoform 1 cleaved form
def: "A rho-associated protein kinase 2 isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000308 ! rho-associated protein kinase 2 isoform 1
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000000462
name: rho-associated protein kinase 2 isoform 1 phosphorylated form
def: "A rho-associated protein kinase 2 isoform 1 that has been post-translationally modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000308 ! rho-associated protein kinase 2 isoform 1
intersection_of: has_modification MOD:00696 ! phosphorylated residue

[Term]
id: PRO:000000463
name: ribosomal protein S6 kinase beta 1 isoform 1 phosphorylated form
def: "A ribosomal protein S6 kinase beta 1 that has been post-translationally modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000310 ! ribosomal protein S6 kinase beta 1 isoform 1
intersection_of: has_modification MOD:00696 ! phosphorylated residue

[Term]
id: PRO:000000464
name: ribosomal protein S6 kinase beta 1 isoform 2 phosphorylated form
def: "A ribosomal protein S6 kinase beta 1 isoform 2 that has been post-translationally modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000311 ! ribosomal protein S6 kinase beta 1 isoform 2
intersection_of: has_modification MOD:00696 ! phosphorylated residue

[Term]
id: PRO:000000465
name: ribosomal protein S6 kinase beta 2 isoform 1 phosphorylated form
def: "A ribosomal protein S6 kinase beta 2 isoform 1 that has been post-translationally modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000312 ! ribosomal protein S6 kinase beta 2 isoform 1
intersection_of: has_modification MOD:00696 ! phosphorylated residue

[Term]
id: PRO:000000466
name: smad ubiquitination regulatory factor 1 isoform 1
def: "A smad ubiquitination regulatory factor 1 that is a translation product of a mature transcript of the SMURF1 gene represented by the human sequence UniProtKB:Q9HCE7-2." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000361 ! smad ubiquitination regulatory factor 1

[Term]
id: PRO:000000467
name: smad1 isoform 1
def: "A smad1 that is a translation product of a mature transcript of the SMAD1 gene, and that contains the MH1 domain and the MH2 domain. This form is represented by the human sequence UniProtKB:Q15797-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000363 ! smad1

[Term]
id: PRO:000000468
name: smad2 isoform 1
def: "A smad2 that is a translation product of a mature transcript of the SMAD2 gene, and that contains the MH1 domain with the region encoded by exon 3, and the MH2 domain. This form is represented by the human sequence UniProtKB:Q15796-1." [PRO:CNA]
comment: Category=sequence.
synonym: "long isoform" RELATED []
is_a: PRO:000000364 ! smad2

[Term]
id: PRO:000000469
name: smad2 isoform 2
def: "A smad2 that is a translation product of a mature transcript of the SMAD2 gene, and that contains the MH1 domain without the region encoded by exon 3, and the MH2 domain. This form is represented by the human sequence UniProtKB:Q15796-2." [PMID:8752209]
comment: Category=sequence.
synonym: "exon3delta" RELATED []
synonym: "short isoform" RELATED []
is_a: PRO:000000364 ! smad2

[Term]
id: PRO:000000470
name: smad2 sequence variant 1
def: "A smad2 that is a translation product of a polymorphic sequence variant of SMAD2 gene that has a Cys residue at the position equivalent to Arg-133 in the human sequence UniProtKB:Q15796-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000364 ! smad2

[Term]
id: PRO:000000471
name: smad2 sequence variant 2
def: "A smad2 that is a translation product of a polymorphic sequence variant of SMAD2 gene that has a Arg residue at the position equivalent to Leu-440 in human sequence UniProtKB:Q15796-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000364 ! smad2

[Term]
id: PRO:000000472
name: smad2 sequence variant 3
def: "A smad2 that is a translation product of a polymorphic sequence variant of SMAD2 gene that has a His residue at the position equivalent to Pro-445 in human sequence UniProtKB:Q15796-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000364 ! smad2

[Term]
id: PRO:000000473
name: smad2 sequence variant 4
def: "A smad2 that is a translation product of a polymorphic sequence variant of SMAD2 gene that has a Glu residue at the position equivalent to Asp-450 in human sequence UniProtKB:Q15796-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000364 ! smad2

[Term]
id: PRO:000000474
name: smad2 sequence variant 5
def: "A smad2 that is a translation product of the SMAD2 gene with a mutation causing amino acid deletion at the position equivalent to region 344-458 in the human sequence UniProtKB:Q15796-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000364 ! smad2

[Term]
id: PRO:000000475
name: smad3 isoform 1
def: "A smad3 that is a translation product of a mature transcript of the SMAD3 gene, and that contains the MH1 domain and the MH2 domain. This form is represented by the human sequence UniProtKB:P84022-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000365 ! smad3

[Term]
id: PRO:000000476
name: smad4 isoform 1 phosphorylated form
def: "A smad4 isoform 1 that has been post-translationally modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000366 ! smad4 isoform 1
intersection_of: has_modification MOD:00696 ! phosphorylated residue

[Term]
id: PRO:000000477
name: smad5 isoform 1
def: "A smad5 that is a translation product of a mature transcript of the SMAD5 gene, and that contains the MH1 domain and the MH2 domain. This form is represented by the human sequence UniProtKB:Q99717-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000372 ! smad5

[Term]
id: PRO:000000478
name: smad5 isoform 2
def: "A smad5 that is a translation product of a mature transcript of the SMAD5 gene comprising intron 6 generating a C-terminus truncated MH2 domain and a unique C-terminus sequence lacking the SSxS motif necessary for SMAD activation." [EST:AA169504, PMID:10845932]
comment: Category=sequence.
synonym: "smad5 beta" RELATED []
is_a: PRO:000000372 ! smad5

[Term]
id: PRO:000000479
name: smad6 isoform 1
def: "A smad6 that is a translation product of a mature transcript of the SMAD6 gene, and that contains the MH1 domain and the MH2 domain. This form is represented by the human sequence UniProtKB:O43541-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000373 ! smad6

[Term]
id: PRO:000000480
name: smad6 isoform 2
def: "A smad6 that is a translation product of a mature transcript of the SMAD6 gene, that lacks the MH1 domain. This form is exclusively expressed in coronary tissue and is upregulated in dissease heart tissue." [PMID:11284962, PRO:CNA]
comment: Category=sequence.
synonym: "isoform B" RELATED []
synonym: "short isoform" RELATED []
synonym: "smad6s" RELATED []
is_a: PRO:000000373 ! smad6

[Term]
id: PRO:000000481
name: smad7 isoform 1
def: "A smad7 that is a translation product of a mature transcript of the SMAD7 gene, and that contains the MH1 domain and the MH2 domain. This form is represented by the human sequence UniProtKB:O35253-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000374 ! smad7

[Term]
id: PRO:000000482
name: smad9 isoform 1
def: "A smad9 that is a translation product of a mature transcript of the SMAD9 gene that lacks exon 3, and it is represented by the mouse sequence UniProtKB:Q9JIW5-1." [PRO:CNA]
comment: Category=sequence.
synonym: "MADH6b" RELATED []
synonym: "SMAD8a" RELATED []
is_a: PRO:000000375 ! smad9

[Term]
id: PRO:000000483
name: smad9 isoform 2
def: "A smad9 that is a translation product of a mature transcript of the SMAD9 gene that lacks the last exon, and therefore the C-terminus SSxS motif. Inhibits BMP signaling." [PMID:10583507]
comment: Category=sequence.
synonym: "SMAD8b" RELATED []
is_a: PRO:000000375 ! smad9

[Term]
id: PRO:000000484
name: smad9 isoform 3
def: "A smad9 that is a translation product of a mature transcript of the SMAD9 gene, and that contains the MH1 domain and the MH2 domain. This form is represented by the human sequence UniProtKB:O15198-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000375 ! smad9

[Term]
id: PRO:000000485
name: thrombospondin 1 isoform 1 cleaved and glycosylated form
def: "A thrombospondin 1 isoform 1 that has been processed by proteolytic cleavage and has been post-translationally modified to include a glycosylated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000376 ! thrombospondin 1 isoform 1
intersection_of: has_modification MOD:00693 ! glycosylated residue
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000000486
name: thrombospondin 1 isoform 1 cleaved form
def: "A thrombospondin 1 isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000376 ! thrombospondin 1 isoform 1
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000000487
name: thrombospondin 2 isoform 1 cleaved form
def: "A thrombospondin 2 isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000377 ! thrombospondin 2 isoform 1
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000000488
name: thrombospondin 3 isoform 1 cleaved form
def: "A thrombospondin 3 isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000378 ! thrombospondin 3 isoform 1
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000000489
name: thrombospondin 4 isoform 1 cleaved form
def: "A thrombospondin 4 isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000379 ! thrombospondin 4 isoform 1
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000000490
name: transcription factor Sp1 isoform 1 acetylated form
def: "A transcription factor Sp1 isoform 1 that has been pos-translationally modified to include an acetylated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000380 ! transcription factor Sp1 isoform 1
intersection_of: has_modification MOD:00394 ! acetylated residue

[Term]
id: PRO:000000491
name: transcription factor Sp1 isoform 1 cleaved form
def: "A transcription factor Sp1 isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000380 ! transcription factor Sp1 isoform 1
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000000492
name: transcription factor Sp1 isoform 1 glycosylated form
def: "A transcription factor Sp1 isoform 1 that has been post-translationally modified to include a glycosylated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000380 ! transcription factor Sp1 isoform 1
intersection_of: has_modification MOD:00693 ! glycosylated residue

[Term]
id: PRO:000000493
name: transcription factor Sp1 isoform 1 phosphorylated form
def: "A SP1 isoform 1 that has been post-translationally modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000380 ! transcription factor Sp1 isoform 1
intersection_of: has_modification MOD:00696 ! phosphorylated residue

[Term]
id: PRO:000000494
name: transcription factor Sp1 isoform 1 sumoylated form
def: "A Sp1 isoform 1 that has been post-translationally modified to include a sumoylated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000380 ! transcription factor Sp1 isoform 1
intersection_of: has_modification MOD:01149 ! sumoylated lysine

[Term]
id: PRO:000000495
name: tumor necrosis factor alpha isoform 1 cleaved form
def: "A tumor necrosis factor alpha isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000381 ! tumor necrosis factor alpha isoform 1
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000000496
name: tumor necrosis factor alpha isoform 1 myristoylated form
def: "A tumor necrosis factor alpha isoform 1 that has been co-translationally modified to include a myristoylated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000381 ! tumor necrosis factor alpha isoform 1
intersection_of: has_modification MOD:00438 ! myristoylated residue

[Term]
id: PRO:000000497
name: tumor necrosis factor alpha isoform 1 phosphorylated form
def: "A tumor necrosis factor alpha isoform 1 that has been post-translationally modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000381 ! tumor necrosis factor alpha isoform 1
intersection_of: has_modification MOD:00696 ! phosphorylated residue

[Term]
id: PRO:000000498
name: BMP receptor type-1A isoform 1 phosphorylated 1
def: "A BMP receptor type-1A isoform 1 phosphorylated form that has been phosphorylated at the GS-motif by the BMP receptor type-2 upon BMP ligand binding." [PMID:12829744]
comment: Category=modification.
is_a: PRO:000000382 ! BMP receptor type-1A isoform 1 phosphorylated form

[Term]
id: PRO:000000499
name: BMP receptor type-1A isoform 1 phosphorylated 2
def: "A BMP receptor type-1A isoform 1 phosphorylated form that has been phosphorylated upon EGF induction." [PMID:17081983]
comment: Category=modification.
is_a: PRO:000000382 ! BMP receptor type-1A isoform 1 phosphorylated form

[Term]
id: PRO:000000500
name: BMP receptor type-1B isoform 1 phoshorylated 1
def: "A BMP receptor type-1B isoform 1 phosphorylated form that has been phosphorylated at the GS-motif by the BMP receptor type-2 upon BMP ligand binding." [PRO:CNA]
comment: Category=modification.
synonym: "active receptor" RELATED []
synonym: "BMP receptor type-1B isoform 1 phoshorylated by BMPR2" EXACT []
is_a: PRO:000000383 ! BMP receptor type-1B isoform 1 phosphorylated form

[Term]
id: PRO:000000501
name: BMP2 isoform 1 cleaved form
def: "A BMP2 isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000385 ! BMP2 isoform 1
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000000502
name: BMP4 isoform 1 cleaved form
def: "A BMP4 isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000386 ! BMP4 isoform 1
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000000503
name: BMP5 isoform 1 cleaved form
def: "A BMP5 isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000387 ! BMP5 isoform 1
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000000504
name: BMP6 isoform 1 cleaved form
def: "A BMP6 isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000388 ! BMP6 isoform 1
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000000505
name: BMP7 isoform 1 cleaved and glycosylated form
def: "A BMP7 isoform 1 that has been processed by proteolytic cleavage and has been post-translationally modified to include a glycosylated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000389 ! BMP7 isoform 1
intersection_of: has_modification MOD:00693 ! glycosylated residue
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000000506
name: BMP7 isoform 1 cleaved form
def: "A BMP7 isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000389 ! BMP7 isoform 1
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000000507
name: DNA-binding protein inhibitor ID-2 isoform 1 phosphorylated 1
def: "A DNA-binding protein inhibitor ID-2 isoform 1 phosphorylated form that has been phosphorylated at the Ser residue in the N-terminal SPVR motif." [PMID:9029153]
comment: Category=modification.
is_a: PRO:000000392 ! DNA-binding protein inhibitor ID-2 isoform 1 phosphorylated form

[Term]
id: PRO:000000508
name: DNA-binding protein inhibitor ID-3 isoform 1 phosphorylated 1
def: "A DNA-binding protein inhibitor ID-3 isoform 1 phosphorylated form that has been phosphorylated at the Ser residue in the N-terminal SPVR motif." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000000393 ! DNA-binding protein inhibitor ID-3 isoform 1 phosphorylated form

[Term]
id: PRO:000000509
name: DNA-binding protein inhibitor ID-3 isoform 1 ubiquitinated 1
def: "A DNA-binding protein inhibitor ID-3 isoform 1 ubiquitinated that has been ubiquitinated by COP9 signalosome complex for degradation." [PMID:15451666]
comment: Category=modification.
is_a: PRO:000000394 ! DNA-binding protein inhibitor ID-3 isoform 1 ubiquitinated form

[Term]
id: PRO:000000510
name: GTP-binding protein RhoA isoform 1 prenylated form
def: "A GTP-binding protein RhoA isoform 1 that has been post-translationally modified to include an isoprenylated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000395 ! GTP-binding protein RhoA isoform 1
intersection_of: has_modification MOD:00703 ! isoprenylated residue

[Term]
id: PRO:000000511
name: RING-box protein 2 isoform 1 phosphorylated 1
def: "A RING-box protein 2 isoform 1 phosphorylated form that has been phosphorylated at the most N-terminal Thr residue by CK2." [PMID:12748192]
comment: Category=modification.
is_a: PRO:000000396 ! RING-box protein 2 isoform 1 phosphorylated form

[Term]
id: PRO:000000512
name: TGF-beta 1 isoform 1 cleaved and glycosylated form
def: "A TGF-beta 1 isoform 1 that has been processed by proteolytic cleavage and has been post-translationally modified to include a glycosylated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000397 ! TGF-beta 1 isoform 1
intersection_of: has_modification MOD:00693 ! glycosylated residue
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000000513
name: TGF-beta 1 isoform 1 cleaved form
def: "A TGF-beta 1 isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000397 ! TGF-beta 1 isoform 1
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000000514
name: TGF-beta 1 sequence variant 2 cleaved form
def: "A TGF-beta 1 sequence variant 2 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000399 ! TGF-beta 1 sequence variant 2
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000000515
name: TGF-beta 1 sequence variant 3 cleaved form
def: "A TGF-beta 1 sequence variant 3 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000400 ! TGF-beta 1 sequence variant 3
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000000516
name: TGF-beta 1 sequence variant 4 cleaved form
def: "A TGF-beta 1 sequence variant 4 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000401 ! TGF-beta 1 sequence variant 4
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000000517
name: TGF-beta 1 sequence variant 5 cleaved form
def: "A TGF-beta 1 sequence variant 5 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000402 ! TGF-beta 1 sequence variant 5
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000000518
name: TGF-beta 1 sequence variant 6 cleaved form
def: "A TGF-beta 1 sequence variant that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000403 ! TGF-beta 1 sequence variant 6
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000000519
name: TGF-beta 2 isoform 1 cleaved form
def: "A TGF-beta 2 isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000000404 ! TGF-beta 2 isoform 1

[Term]
id: PRO:000000520
name: TGF-beta 2 isoform 2 cleaved form
def: "A TGF-beta 2 isoform 2 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000000405 ! TGF-beta 2 isoform 2

[Term]
id: PRO:000000521
name: TGF-beta 3 isoform 1 cleaved form
def: "A TGF-beta 3 isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000406 ! TGF-beta 3 isoform 1
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000000522
name: TGF-beta receptor type-1 isoform 1 cleaved 1
def: "A TGF-beta receptor type-1 isoform 1 cleaved form that has been processed to the mature protein by removal of the signal peptide." [PRO:CNA]
comment: Category=modification.
synonym: "TGFBR1 inactive" EXACT []
is_a: PRO:000000407 ! TGF-beta receptor type-1 isoform 1 cleaved form

[Term]
id: PRO:000000523
name: TGF-beta receptor type-1 isoform 1 cleaved and phosphorylated 1
def: "A TGF-beta receptor type-1 isoform 1 whose signal peptide has been removed, and has been phosphorylated in the GS-motif by TGFBR2. Phosphorylation of any of the Ser or Thr seems to be sufficient to transduce signal, however full activation is achieved when five of these residues are phosphorylated." [PMID:7774578, PMID:8947046]
comment: Category=modification.
synonym: "Phospho-TGF-beta 1 receptor" RELATED [REACTOME:REACT_7508.1]
synonym: "TGFBR1 active" EXACT []
is_a: PRO:000000408 ! TGF-beta receptor type-1 isoform 1 cleaved and phosphorylated form

[Term]
id: PRO:000000524
name: activin receptor type-1 isoform 1 cleaved and phosphorylated 1
def: "An activin receptor type-1 isoform 1 cleaved and phosphorylated form that has cleavage of the signal peptide, and has been phosphorylated at Ser/Thr residues in GS-motif by the activated activin receptor type-2 (PRO:000000528, PRO:000000529)." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000000411 ! activin receptor type-1 isoform 1 cleaved and phosphorylated form

[Term]
id: PRO:000000525
name: activin receptor type-1B isoform 1 phosphorylated 1
def: "ACVR1B isoform 1 that is phosphorylated at Ser/Thr residues in GS-motif by activated activin receptor type-2, and constitutes an active receptor subunit." [PMID:8622651, PMID:8721982, PRO:CNA]
comment: Category=modification.
is_a: PRO:000000412 ! activin receptor type-1B isoform 1 phosphorylated form

[Term]
id: PRO:000000526
name: activin receptor type-1B isoform 1 phosphorylated 2
def: "An activin receptor type-1B isoform 1 that is phosphorylated at a Tyr residue within the protein kinase domain, as a result of platelet activation." [PMID:12112843, PRO:CNA]
comment: Category=modification.
is_a: PRO:000000412 ! activin receptor type-1B isoform 1 phosphorylated form

[Term]
id: PRO:000000527
name: activin receptor type-1C isoform 1 phosphorylated 1
def: "An activin receptor type-1C isoform 1 that is phosphorylated at Ser/Thr residues in the GS-motif by activated activin receptor type-2, and constitutes an active receptor subunit." [PMID:15196700]
comment: Category=modification.
is_a: PRO:000000413 ! activin receptor type-1C isoform 1 phosphorylated form

[Term]
id: PRO:000000528
name: activin receptor type-2A isoform 1 glycosylated and phosphorylated 1
def: "An activin receptor type-2A isoform 1 glycosylated and phosphorylated form that has been phosphorylated at Ser/Thr residues, and constitutes an active receptor subunit." [PMID:8395525]
comment: Category=modification.
is_a: PRO:000000414 ! activin receptor type-2A isoform 1 glycosylated and phosphorylated form

[Term]
id: PRO:000000529
name: activin receptor type-2B isoform 1 glycosylated and phosphorylated 1
def: "An activin receptor type-2B isoform 1 glycosylated and phosphorylated form that has been glycosylated and has been phosphorylated at Ser/Thr residues, and constitutes an active activin receptor subunit." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000000415 ! activin receptor type-2B isoform 1 glycosylated and phosphorylated form

[Term]
id: PRO:000000530
name: activin/inhibin beta A chain isoform 1 cleaved form
def: "An activin/inhibin beta A chain isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000416 ! activin/inhibin beta A chain isoform 1
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000000531
name: activin/inhibin beta B chain isoform 1 cleaved form
def: "An activin/inhibin beta B chain isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000417 ! activin/inhibin beta B chain isoform 1
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000000532
name: activin/inhibin beta E chain isoform 1 cleaved form
def: "An activin/inhibin beta E chain isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000418 ! activin/inhibin beta E chain isoform 1
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000000533
name: anti-Muellerian hormone isoform 1 cleaved and glycosylated 1
def: "An anti-Muellerian hormone isoform 1 cleaved and glycosylated form that has been cleaved after the signal peptide and also at the RxxR dibasic cleavage site releasing the propeptide. This form is the mature protein." [PMID:8755541, PRO:CNA]
comment: The mature sequence in UniProtKb is not correct, therefore there is no glycosylation of the mature protein. This term has been replaced by PRO:000000534.
is_obsolete: true

[Term]
id: PRO:000000534
name: anti-Muellerian hormone isoform 1 cleaved and glycosylated 2
def: "An anti-Muellerian hormone isoform 1 cleaved and glycosylated form that has been cleaved at the signal peptide and also at the RxxR dibasic cleavage site rendering the propeptide and the mature protein non-covalently bound." [PMID:14673134]
comment: Category=modification.
is_a: PRO:000000419 ! anti-Muellerian hormone isoform 1 cleaved and glycosylated form

[Term]
id: PRO:000000535
name: c-myc protein isoform 1 acetylated 1
def: "A c-myc protein isoform 1 acetylated form that has been acetylated at Lys residues by histone acetyltransferase PCAF." [PMID:16126174]
comment: Category=modification.
is_a: PRO:000000420 ! c-myc protein isoform 1 acetylated form

[Term]
id: PRO:000000536
name: c-myc protein isoform 1 glycosylated 1
def: "A c-myc protein isoform 1 glycosylated form that has been O-glycosylated at the Thr residue within the L[LY]PTLTPPLS sequence of the myc box I in the amino-terminal regulatory domain, as in Thr-58 of the human isoform 1." [PMID:11904304, PMID:7642555]
comment: Category=modification.
is_a: PRO:000000421 ! c-myc protein isoform 1 glycosylated form

[Term]
id: PRO:000000537
name: c-myc protein isoform 1 phosphorylated 1
def: "A c-myc protein isoform 1 phosphorylated form that has been phosphorylated at the Ser residue within the L[LY]PTLTPPLS sequence of the myc box I in the amino-terminal regulatory domain by ERK through activation of Raf signaling pathway, as in Ser-62 of the human isoform 1." [PMID:11018017]
comment: Category=modification.
is_a: PRO:000000422 ! c-myc protein isoform 1 phosphorylated form

[Term]
id: PRO:000000538
name: c-myc protein isoform 1 phosphorylated 2
def: "A c-myc protein isoform 1 phosphorylated form that has been phosphorylated at the Ser and Thr residues within the L[LY]PTLTPPLS sequence of the myc box I in the amino-terminal regulatory domain, by ERK and GSK3, respectively. As in residues Thr-58/Ser-62 of the human isoform 1. This form is not stable and is degraded through the proteosome pathway." [PMID:14563837, PMID:8386367]
comment: Category=modification.
is_a: PRO:000000422 ! c-myc protein isoform 1 phosphorylated form

[Term]
id: PRO:000000539
name: c-myc protein isoform 1 phosphorylated 3
def: "A c-myc protein isoform 1 phosphorylated form that has been phosphorylated at Ser residues of the myc box I in the amino-terminal regulatory domain by activation of ROCK proteins through Ras signaling pathway, as in Ser-62/Ser-71 of the human isoform 1." [PMID:12676581, UniProtKB:P01106]
comment: Category=modification.
is_a: PRO:000000422 ! c-myc protein isoform 1 phosphorylated form

[Term]
id: PRO:000000540
name: cartilage oligomeric matrix protein isoform 1 cleaved 1
def: "A cartilage oligomeric matrix protein isoform 1 cleaved form whose signal peptide has been removed and is a mature protein." [PRO:CNA]
comment: Category=modification.
synonym: "mature protein" RELATED []
is_a: PRO:000000423 ! cartilage oligomeric matrix protein isoform 1 cleaved form

[Term]
id: PRO:000000541
name: creb-binding protein isoform 1 methylated 1
def: "A creb-binding protein isoform 1 methylated form that has been methylated at arginine residues within the KIX domain, as in Arg-600/Arg-624 of mouse isoform 1." [PMID:11701890]
comment: Category=modification.
is_a: PRO:000000426 ! creb-binding protein isoform 1 methylated form

[Term]
id: PRO:000000542
name: cullin 1 isoform 1 neddylated 1
def: "A cullin 1 isoform 1 neddylated form that has been neddylated in the conserved Lys residue within the IVR[ILV]MKxR[RK] motif. Example: UniProtKB:Q13616-1 has_modification MOD:01150 neddylated lysine, Lys-720." [PMID:10713156]
comment: Category=modification.
is_a: PRO:000000427 ! cullin 1 isoform 1 neddylated form

[Term]
id: PRO:000000543
name: cyclin-dependent kinase 4 inhibitor B isoform 1 phosphorylated 1
def: "CDKN2B phosphorylated in residue equivalent to Thr-12 in mouse sequence." [UniProtKB:P55271]
comment: Category=modification.
is_a: PRO:000000428 ! cyclin-dependent kinase 4 inhibitor B isoform 1 phosphorylated form

[Term]
id: PRO:000000544
name: decorin isoform 1 cleaved 1
def: "A decorin isoform 1 cleaved that has been processed to a mature protein by cleaveage of the signal peptide and propeptide, rendering the decorin protein core." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000000430 ! decorin isoform 1 cleaved form

[Term]
id: PRO:000000545
name: decorin isoform 1 cleaved and glycosylated 1
def: "A decorin isoform 1 cleaved and glycosylated form that has been processed to a mature protein by cleaveage of the signal peptide and propeptide, and has been modified with O-linked glycosaminoglycan at the most N-terminal SG site and additional N-linked glycosylated Asn residues." [PMID:16258169]
comment: Category=modification.
is_a: PRO:000000429 ! decorin isoform 1 cleaved and glycosylated form

[Term]
id: PRO:000000546
name: fas ligand isoform 1 glycosylated 1
def: "A fas ligand isoform 1 glycosylated form that has been glycosylated at the Asn residues within the N-glycosylation sites located in the C-terminal extracellular region. This glycosylation does not appear to be required for receptor binding or biological activity." [PMID:9405425]
comment: Category=modification.
is_a: PRO:000000432 ! fas ligand isoform 1 glycosylated form

[Term]
id: PRO:000000547
name: fas ligand isoform FasL soluble
def: "A fas ligand isoform 1 cleaved form that has been processed to the soluble form." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000000431 ! fas ligand isoform 1 cleaved form

[Term]
id: PRO:000000548
name: growth/differentiation factor 5 isoform 1 cleaved form
def: "A growth/differentiation factor 5 isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000436 ! growth/differentiation factor 5 isoform 1
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000000549
name: growth/differentiation factor 7 isoform 1 cleaved form
def: "A growth/differentiation factor 7 isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000442 ! growth/differentiation factor 7 isoform 1
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000000550
name: decorin isoform 1 cleaved 2
def: "A decorin isoform 1 cleaved form that has been cleaved after the Phe residue within the F[NS]GLN motif as a result of the catabolic processing of decorin. This form lacks most of the leucine-rich domains and is abundant in adult skin tissue." [PMID:12621051]
comment: Category=modification.
synonym: "decorunt" RELATED []
is_a: PRO:000000430 ! decorin isoform 1 cleaved form

[Term]
id: PRO:000000551
name: inhibin beta C chain isoform 1 cleaved form
def: "An inhibin beta C chain isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000444 ! inhibin beta C chain isoform 1
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000000552
name: latent-TGF-beta-binding protein 1 isoform 2 cleaved 1
def: "A latent-TGF-beta-binding protein 1 isoform 2 cleaved whose signal peptide has been removed. This form binds covalently to the latent associated peptide of the transforming growth factors through the third TB domain by disulfide bridging." [PMID:14607119, PRO:CNA]
comment: Category=modification.
is_a: PRO:000000449 ! latent-TGF-beta-binding protein 1 isoform 2 cleaved form

[Term]
id: PRO:000000553
name: latent-TGF-beta-binding protein 1 isoform 1 cleaved 1
def: "A latent-TGF-beta-binding protein 1 isoform 1 cleaved whose signal peptide has been removed. This form binds covalently to the latent associated peptide of the transforming growth factors through the third TB domain by disulfide bridging." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000000448 ! latent-TGF-beta-binding protein 1 isoform 1 cleaved form

[Term]
id: PRO:000000554
name: lefty 1 isoform 1 cleaved form
def: "A lefty 1 isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000450 ! lefty 1 isoform 1
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000000555
name: lefty 2 isoform 1 cleaved form
def: "A lefty 2 isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000451 ! lefty 2 isoform 1
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000000556
name: mitogen-activated protein kinase 1 isoform 1 phosphorylated 1
def: "A MAPK1 isoform 1 phosphorylated form that is phosphorylated at both Thr and Tyr of the TxY motif within the protein kinase domain." [PMID:17192257, PMID:1849075, PRO:CNA]
comment: Category=modification.
synonym: "ERK-2 active form" RELATED []
is_a: PRO:000000454 ! mitogen-activated protein kinase 1 isoform 1 phosphorylated form

[Term]
id: PRO:000000557
name: mitogen-activated protein kinase 3 isoform 1 phosphorylated 1
def: "A mitogen-activated protein kinase 3 isoform 1 phosphorylated form that is phosphorylated at both Thr and Tyr of the TxY motif within the protein kinase domain." [PMID:17192257, PRO:CNA]
comment: Category=modification.
synonym: "ERK1 active" RELATED []
synonym: "MAPK3 active form" RELATED []
is_a: PRO:000000455 ! mitogen-activated protein kinase 3 isoform 1 phosphorylated form

[Term]
id: PRO:000000558
name: nodal isoform 1 cleaved 1
def: "A nodal isoform 1 cleaved form that has been processed to the mature peptide by removal of the signal peptide." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000000456 ! nodal isoform 1 cleaved form

[Term]
id: PRO:000000559
name: retinoblastoma-like protein 1 isoform 1 phosphorylated 1
def: "A retinoblastoma-like protein 1 phosphorylated form that has been phosphorylated in a RxL motif-dependent fashion by cyclin Cdk4." [PMID:11884610]
comment: Category=modification.
is_a: PRO:000000458 ! retinoblastoma-like protein 1 isoform 1 phosphorylated form

[Term]
id: PRO:000000560
name: retinoblastoma-like protein 2 isoform 1 phosphorylated 1
def: "A retinoblastoma-like protein 2 isoform 1 phosphorylated form that has been phosphorylated during Go/G1-S phase progression." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000000459 ! retinoblastoma-like protein 2 isoform 1 phosphorylated form

[Term]
id: PRO:000000561
name: retinoblastoma-like protein 2 isoform 1 phosphorylated 2
def: "A retinoblastoma-like protein 2 isoform 1 phosphorylated form that has Cdk-dependent G1 phosphorylation, and additionally phosphorylated at a Ser residue within the region linking the retinoblastoma-associated protein A and B domains, by cyclin Cdk4(6). This phosphorylation leads to ubiquitin-dependent proteolysis." [PMID:12006580, PMID:12435635]
comment: Category=modification.
is_a: PRO:000000459 ! retinoblastoma-like protein 2 isoform 1 phosphorylated form

[Term]
id: PRO:000000562
name: retinoblastoma-like protein 2 isoform 1 phosphorylated 3
def: "A retinoblastoma-like protein 2 isoform 1 phosphorylated form as observed in quiescent cells." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000000459 ! retinoblastoma-like protein 2 isoform 1 phosphorylated form

[Term]
id: PRO:000000563
name: rho-associated protein kinase 1 isoform 1 cleaved 1
def: "A rho-associated protein kinase 1 isoform 1 cleaved form that has been processed by caspase-3 downstream the sequence motif DETD, removing the inhibitory C-terminus. This form has been found significantly elevated in mouse myopathy model and human heart failure patients." [PMID:11283607, PMID:16983089]
comment: Category=modification.
synonym: "constitutively active ROCK-1" EXACT []
is_a: PRO:000000460 ! rho-associated protein kinase 1 isoform 1 cleaved form

[Term]
id: PRO:000000564
name: rho-associated protein kinase 2 isoform 1 cleaved 1
def: "A rho-associated protein kinase 1 isoform 2 cleaved form that has been cleaved in the granzyme B consensus motif [IVL][GE]xD located between the rho binding and the PH domains, removing the C-terminus. This form has constitutive kinase activity." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000000461 ! rho-associated protein kinase 2 isoform 1 cleaved form

[Term]
id: PRO:000000565
name: rho-associated protein kinase 2 isoform 1 phosphorylated 1
def: "A rho-associated protein kinase 2 isoform 1 phosphorylated form that has been phosphorylated by the serine/threonine-protein kinase PLK1 in the C-terminal region." [PMID:17446864]
comment: Category=modification.
is_a: PRO:000000462 ! rho-associated protein kinase 2 isoform 1 phosphorylated form

[Term]
id: PRO:000000566
name: rho-associated protein kinase 2 isoform 1 phosphorylated 2
def: "A rho-associated protein kinase 2 isoform 1 phosphorylated form that has been induced by DNA damage." [PMID:17525332]
comment: Category=modification.
is_a: PRO:000000462 ! rho-associated protein kinase 2 isoform 1 phosphorylated form

[Term]
id: PRO:000000567
name: ribosomal protein S6 kinase beta 1 isoform 1 phosphorylated 1
def: "A ribosomal protein S6 kinase beta 1 isoform 1 phosphorylated within the AGC-kinase C-terminal domain. These sites serves as phosphorylation-regulated switches to control both intra- and inter-molecular interactions. Without these priming phosphorylations, the kinases are catalytically inactive." [PMID:1922062]
comment: Category=modification.
is_a: PRO:000000463 ! ribosomal protein S6 kinase beta 1 isoform 1 phosphorylated form

[Term]
id: PRO:000000568
name: ribosomal protein S6 kinase beta 1 isoform 2 phosphorylated 1
def: "A ribosomal protein S6 kinase beta 1 isoform 2 phosphorylated form that has been phosphorylated within the AGC-kinase C-terminal domain. These sites serve as phosphorylation-regulated switches to control both intra- and inter-molecular interactions. Without these priming phosphorylations, the kinases are catalytically inactive." [PMID:1922062]
comment: Category=modification.
is_a: PRO:000000464 ! ribosomal protein S6 kinase beta 1 isoform 2 phosphorylated form

[Term]
id: PRO:000000569
name: ribosomal protein S6 kinase beta 2 isoform 1 phosphorylated 1
def: "A ribosomal protein S6 kinase beta 2 phosphorylated form that has been phosphorylated upon activation of EGF receptor signaling pathway." [PMID:17081983]
comment: Category=modification.
is_a: PRO:000000465 ! ribosomal protein S6 kinase beta 2 isoform 1 phosphorylated form

[Term]
id: PRO:000000570
name: smad1 isoform 1 phosphorylated and ubiquitinated form
def: "A smad1 isoform 1 that has been post-translationally modified to include phosphorylated and ubiquitinated residues." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000467 ! smad1 isoform 1
intersection_of: has_modification MOD:00696 ! phosphorylated residue
intersection_of: has_modification MOD:01148 ! ubiquitinylated lysine

[Term]
id: PRO:000000571
name: smad1 isoform 1 phosphorylated form
def: "A smad1 isoform 1 that has been post-translationally modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000467 ! smad1 isoform 1
intersection_of: has_modification MOD:00696 ! phosphorylated residue

[Term]
id: PRO:000000572
name: smad2 isoform 1 acetylated and phosphorylated form
def: "A smad2 isoform 1 that has been post-translationally modified to include acetylated and phosphorylated residues." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000468 ! smad2 isoform 1
intersection_of: has_modification MOD:00394 ! acetylated residue
intersection_of: has_modification MOD:00696 ! phosphorylated residue

[Term]
id: PRO:000000573
name: smad2 isoform 1 phosphorylated and ubiquitinated form
def: "A smad2 isoform 1 that has been post-translationally modified to include phosphorylated and ubiquitinated residues." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000468 ! smad2 isoform 1
intersection_of: has_modification MOD:00696 ! phosphorylated residue
intersection_of: has_modification MOD:01148 ! ubiquitinylated lysine

[Term]
id: PRO:000000574
name: smad2 isoform 1 phosphorylated form
def: "A smad2 isoform 1 that has been post-translationally modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000468 ! smad2 isoform 1
intersection_of: has_modification MOD:00696 ! phosphorylated residue

[Term]
id: PRO:000000575
name: smad2 isoform 2 acetylated and phosphorylated form
def: "A smad2 isoform 2 that has been post-translationally modified to include acetylated and phosphorylated residues." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000469 ! smad2 isoform 2
intersection_of: has_modification MOD:00394 ! acetylated residue
intersection_of: has_modification MOD:00696 ! phosphorylated residue

[Term]
id: PRO:000000576
name: smad2 isoform 2 phosphorylated form
def: "A smad2 isoform 2 that has been post-translationally modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000469 ! smad2 isoform 2
intersection_of: has_modification MOD:00696 ! phosphorylated residue

[Term]
id: PRO:000000577
name: smad3 isoform 1 acetylated and phosphorylated form
def: "A smad3 isoform 1 that has been post-translationally modified to include acetylated and phosphorylated residues." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000475 ! smad3 isoform 1
intersection_of: has_modification MOD:00394 ! acetylated residue
intersection_of: has_modification MOD:00696 ! phosphorylated residue

[Term]
id: PRO:000000578
name: smad3 isoform 1 phosphorylated form
def: "A smad3 isoform 1 that has been post-translationally modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000475 ! smad3 isoform 1
intersection_of: has_modification MOD:00696 ! phosphorylated residue

[Term]
id: PRO:000000579
name: smad4 isoform 1 phosphorylated 1
def: "A smad4 isoform 1 phosphorylated form that has been phosphorylated at the PxTP motif within the MH1-MH2 domain linker region." [PMID:12801888]
comment: Category=modification.
is_a: PRO:000000476 ! smad4 isoform 1 phosphorylated form

[Term]
id: PRO:000000580
name: smad5 isoform 1 phosphorylated form
def: "A smad5 isoform 1 that has been post-translationally modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000477 ! smad5 isoform 1
intersection_of: has_modification MOD:00696 ! phosphorylated residue

[Term]
id: PRO:000000581
name: smad6 isoform 1 methylated form
def: "A smad6 isoform 1 that has been post-translationally modified to include a methylated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000479 ! smad6 isoform 1
intersection_of: has_modification MOD:00427 ! methylated residue

[Term]
id: PRO:000000582
name: smad7 isoform 1 acetylated form
def: "A smad7 isoform 1 that has been post-translationally modified to include an acetylated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000481 ! smad7 isoform 1
intersection_of: has_modification MOD:00394 ! acetylated residue

[Term]
id: PRO:000000583
name: smad7 isoform 1 phosphorylated form
def: "A smad7 isoform 1 that has been post-translationally modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000481 ! smad7 isoform 1
intersection_of: has_modification MOD:00696 ! phosphorylated residue

[Term]
id: PRO:000000584
name: smad7 isoform 1 ubiquitinated form
def: "A smad7 isoform 1 that has been post-translationally modified to include a ubiquitinated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000481 ! smad7 isoform 1
intersection_of: has_modification MOD:01148 ! ubiquitinylated lysine

[Term]
id: PRO:000000585
name: smad9 isoform 1 phosphorylated form
def: "A smad9 isoform 1 that has been post-translationally modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000482 ! smad9 isoform 1
intersection_of: has_modification MOD:00696 ! phosphorylated residue

[Term]
id: PRO:000000586
name: smad9 isoform 3 phosphorylated form
def: "A smad9 isoform 3 that has been post-translationally modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000484 ! smad9 isoform 3
intersection_of: has_modification MOD:00696 ! phosphorylated residue

[Term]
id: PRO:000000587
name: thrombospondin 1 isoform 1 cleaved 1
def: "A thrombospondin 1 isoform 1 cleaved form whose signal peptide has been removed, and is a mature protein." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000000486 ! thrombospondin 1 isoform 1 cleaved form

[Term]
id: PRO:000000588
name: thrombospondin 1 isoform 1 cleaved 2
def: "A thrombospondin 1 isoform 1 cleaved form that has been proteolytically processed by ADAMTS1 rendering an N-terminal domain product." [PMID:17082774]
comment: Category=modification.
is_a: PRO:000000486 ! thrombospondin 1 isoform 1 cleaved form

[Term]
id: PRO:000000589
name: thrombospondin 1 isoform 1 cleaved and glycosylated 1
def: "A thrombospondin 1 isoform 1 cleaved and glycosylated form whose signal peptide has been removed, and is a mature protein." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000000485 ! thrombospondin 1 isoform 1 cleaved and glycosylated form

[Term]
id: PRO:000000590
name: thrombospondin 1 isoform 1 cleaved and glycosylated 2
def: "A thrombospondin 1 isoform 1 cleaved and glycosylated form that has been proteolytically processed by ADAMTS1 rendering a C-terminal domain product." [PMID:17082774]
comment: Category=modification.
is_a: PRO:000000485 ! thrombospondin 1 isoform 1 cleaved and glycosylated form

[Term]
id: PRO:000000591
name: thrombospondin 2 isoform 1 cleaved 1
def: "A thrombospondin 2 isoform 1 cleaved form whose signal peptide has been removed and is a mature protein." [PRO:CNA]
comment: Category=modification.
synonym: "mature protein" RELATED []
is_a: PRO:000000487 ! thrombospondin 2 isoform 1 cleaved form

[Term]
id: PRO:000000592
name: thrombospondin 2 isoform 1 cleaved 2
def: "A thrombospondin 2 isoform 1 cleaved form that has been proteolytically processed by ADAMTS1 rendering an N-terminal domain product." [PMID:17082774]
comment: Category=modification.
is_a: PRO:000000487 ! thrombospondin 2 isoform 1 cleaved form

[Term]
id: PRO:000000593
name: thrombospondin 2 isoform 1 cleaved 3
def: "A thrombospondin 2 isoform 1 cleaved and glycosylated form that has been proteolytically processed by ADAMTS1 rendering a C-terminal domain product." [PMID:17082774]
comment: Category=modification.
is_a: PRO:000000487 ! thrombospondin 2 isoform 1 cleaved form

[Term]
id: PRO:000000594
name: thrombospondin 3 isoform 1 cleaved 1
def: "A thrombospondin 3 isoform 1 cleaved form whose signal peptide has been removed, and is a mature protein." [PMID:8654563]
comment: Category=modification.
is_a: PRO:000000488 ! thrombospondin 3 isoform 1 cleaved form

[Term]
id: PRO:000000595
name: thrombospondin 4 isoform 1 cleaved 1
def: "A thrombospondin 4 isoform 1 cleaved form whose signal peptide has been removed, and is a mature protein." [PMID:8654563]
comment: Category=modification.
is_a: PRO:000000489 ! thrombospondin 4 isoform 1 cleaved form

[Term]
id: PRO:000000596
name: transcription factor Sp1 isoform 1 acetylated 1
def: "A transcription factor Sp1 isoform 1 acetylated form that has been acetylated by PCAF." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000000490 ! transcription factor Sp1 isoform 1 acetylated form

[Term]
id: PRO:000000597
name: transcription factor Sp1 isoform 1 cleaved 1
def: "A transcription factor Sp1 isoform 1 cleaved form in which the N-terminal inhibitory domain has been released." [PMID:16407261]
comment: Category=modification.
is_a: PRO:000000491 ! transcription factor Sp1 isoform 1 cleaved form

[Term]
id: PRO:000000598
name: transcription factor Sp1 isoform 1 glycosylated 1
def: "A transcription factor Sp1 isoform 1 glycosylated form that has terminal O-linked N-acetylglucosamines." [PMID:11371615]
comment: Category=modification.
is_a: PRO:000000492 ! transcription factor Sp1 isoform 1 glycosylated form

[Term]
id: PRO:000000599
name: transcription factor Sp1 isoform 1 phosphorylated 1
def: "A transcription factor Sp1 isoform 1 phosphorylated that has been phosphorylated at the N-terminal activation domains by a DNA-dependent protein kinase." [PMID:2170018]
comment: Category=modification.
is_a: PRO:000000493 ! transcription factor Sp1 isoform 1 phosphorylated form

[Term]
id: PRO:000000600
name: transcription factor Sp1 isoform 1 phosphorylated 2
def: "A transcription factor Sp1 isoform 1 phosphorylated form that has been phosphorylated at a Thr residue in the C-terminal domain by casein kinase II." [PMID:9153193]
comment: Category=modification.
is_a: PRO:000000493 ! transcription factor Sp1 isoform 1 phosphorylated form

[Term]
id: PRO:000000601
name: transcription factor Sp1 isoform 1 phosphorylated 3
def: "A transcription factor Sp1 isoform 1 phosphorylated form that has been phosphorylated at the Ser residue within the CyclinA/cdk2 phosphorylation site (QPSP sequence). Phosphorylation at this site induces removal of the inhibitory domain by proteolytic processing and activation of transcription activity." [PMID:18239466]
comment: Category=modification.
is_a: PRO:000000493 ! transcription factor Sp1 isoform 1 phosphorylated form

[Term]
id: PRO:000000602
name: transcription factor Sp1 isoform 1 phosphorylated 4
def: "A transcription factor Sp1 isoform 1 phosphorylated form that has been phosphorylated at the first serine/threonine strech by ATM kinase in response to DNA damage." [PMID:18171990]
comment: Category=modification.
is_a: PRO:000000493 ! transcription factor Sp1 isoform 1 phosphorylated form

[Term]
id: PRO:000000603
name: transcription factor Sp1 isoform 1 sumoylated 1
def: "A transcription factor Sp1 isoform 1 sumoylated form that has a SUMO protein covalently linked to a Lys residue at the consensus motif VKIE within the N-terminal inhibitory domain." [PMID:16407261]
comment: Category=modification.
is_a: PRO:000000494 ! transcription factor Sp1 isoform 1 sumoylated form

[Term]
id: PRO:000000604
name: tumor necrosis factor alpha isoform 1 cleaved 1
def: "A tumor necrosis factor alpha isoform 1 cleaved form that has been processed by TNF alpha converting enzyme ADAM17." [PMID:12135369]
comment: Category=modification.
is_a: PRO:000000495 ! tumor necrosis factor alpha isoform 1 cleaved form

[Term]
id: PRO:000000605
name: tumor necrosis factor alpha isoform 1 cleaved 2
def: "A tumor necrosis factor alpha isoform 1 cleaved form that is an incompletely processed soluble form." [PMID:2777790]
comment: Category=modification.
is_a: PRO:000000495 ! tumor necrosis factor alpha isoform 1 cleaved form

[Term]
id: PRO:000000606
name: tumor necrosis factor alpha isoform 1 myristoylated 1
def: "A tumor necrosis factor alpha isoform 1 myristoylated form that has been modified at the N-epsilon-NH2 groups of the most N-terminal Lys within the cytoplasmic domain." [PMID:1402651]
comment: Category=modification.
is_a: PRO:000000496 ! tumor necrosis factor alpha isoform 1 myristoylated form

[Term]
id: PRO:000000607
name: tumor necrosis factor alpha isoform 1 phosphorylated 1
def: "A tumor necrosis factor alpha isoform 1 phosphorylated form that has been phosphorylated at the N-terminal Ser within the ST[EK]S motif in the cytoplasmic domain." [PMID:10205166]
comment: Category=modification.
is_a: PRO:000000497 ! tumor necrosis factor alpha isoform 1 phosphorylated form

[Term]
id: PRO:000000608
name: BMP2 isoform 1 cleaved 1
def: "A BMP2 isoform 1 cleaved form that has been processed to a mature protein by removal of the signal peptide and subsequent release of the propeptide." [PMID:10074410]
comment: Category=modification.
is_a: PRO:000000501 ! BMP2 isoform 1 cleaved form

[Term]
id: PRO:000000609
name: BMP4 isoform 1 cleaved 1
def: "A BMP4 isoform 1 cleaved form that has been processed to a mature protein by removal of the signal peptide and subsequent release of the propeptide." [PMID:12805376]
comment: Category=modification.
is_a: PRO:000000502 ! BMP4 isoform 1 cleaved form

[Term]
id: PRO:000000610
name: BMP5 isoform 1 cleaved 1
def: "A BMP5 isoform 1 cleaved form that has been processed to a mature protein by removal of the signal peptide and subsequent release of the propeptide." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000000503 ! BMP5 isoform 1 cleaved form

[Term]
id: PRO:000000611
name: BMP6 isoform 1 cleaved 1
def: "A BMP6 isoform 1 cleaved form that has been processed to a mature protein by removal of the signal peptide and subsequent release of the propeptide." [PMID:15969083]
comment: Category=modification.
is_a: PRO:000000504 ! BMP6 isoform 1 cleaved form

[Term]
id: PRO:000000612
name: BMP7 isoform 1 cleaved 1
def: "A BMP7 isoform 1 cleaved and glycosylated form that has been processed to a mature protein by removal of the signal peptide and subsequent release of the propeptide from the latent complex." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000000506 ! BMP7 isoform 1 cleaved form

[Term]
id: PRO:000000613
name: BMP7 isoform 1 cleaved and glycosylated 1
def: "A BMP7 isoform 1 cleaved and glycosylated form that has been processed to a mature protein by removal of the signal peptide and subsequent release of the propeptide from the latent complex, and is N-glycosylated at the N{P}[ST]{P} motif. This form is a disulfide linked homodimer." [PMID:15929982, PRO:CNA]
comment: Category=modification.
is_a: PRO:000000505 ! BMP7 isoform 1 cleaved and glycosylated form

[Term]
id: PRO:000000614
name: BMP7 isoform 1 cleaved and glycosylated 2
def: "A BMP7 isoform 1 cleaved and glycosylated form that has been processed to a latent complex by removal of the signal peptide and of the propeptide which in turns, remains bound to the mature protein. This form is N-glycosylated at the most C-terminal N{P}[ST]{P} motif and is a homodimer." [PMID:15929982]
comment: Category=modification.
is_a: PRO:000000505 ! BMP7 isoform 1 cleaved and glycosylated form

[Term]
id: PRO:000000615
name: GTP-binding protein RhoA isoform 1 prenylated 1
def: "A GTP-binding protein RhoA isoform 1 prenylated form where a geranylgeranyl moiety has been added to the Cys residue within the C-terminal Cxxx motif. Example: UniProtKB:P61586-1, has_modification MOD:00113 S-geranylgeranyl-L-cysteine, Cys-190." [PMID:16773203, PRO:CNA]
comment: Category=modification.
is_a: PRO:000000510 ! GTP-binding protein RhoA isoform 1 prenylated form

[Term]
id: PRO:000000616
name: TGF-beta 1 isoform 1 cleaved 1
def: "A TGF-beta 1 isoform 1 cleaved form that has been processed by proteolytic cleavage and released from the latent complex. This form is the active mature protein." [PMID:3162913]
comment: Category=modification.
synonym: "active protein" RELATED []
synonym: "mature protein" RELATED []
is_a: PRO:000000513 ! TGF-beta 1 isoform 1 cleaved form

[Term]
id: PRO:000000617
name: TGF-beta 1 isoform 1 cleaved and glycosylated 1
def: "A TGF-beta 1 isoform 1 cleaved and glycosylated form that has been processed by proteolytic cleavage to remove the signal peptide and the C-terminal mature peptide. This chain is referred as to the latent associated peptide (LAP). This form is glycosylated mainly at either one or the two first consensus glycosylation sites." [PMID:3162913]
comment: Category=modification.
synonym: "LAP" RELATED []
synonym: "latent associated peptide" RELATED []
is_a: PRO:000000512 ! TGF-beta 1 isoform 1 cleaved and glycosylated form

[Term]
id: PRO:000000618
name: TGF-beta 1 isoform 1 cleaved and glycosylated 2
def: "A TGF-beta 1 isoform 1 cleaved and glycosylated form that has cleavage of the signal peptide and also has cleavage at the dibasic cleavage site rendering the latent associated peptide (LAP) and the mature protein non-covalently bound. This form is glycosylated mainly at either one or the two first consensus glycosylation sites within the LAP sequence." [PMID:3162913, PMID:3185545]
comment: Category=modification.
synonym: "TGF beta latent complex" RELATED []
synonym: "TGFb latent complex" RELATED []
is_a: PRO:000000512 ! TGF-beta 1 isoform 1 cleaved and glycosylated form

[Term]
id: PRO:000000619
name: TGF-beta 1 sequence variant 2 cleaved 1
def: "A TGF-beta 1 sequence variant 2 cleaved form that has been processed by proteolytic cleavage of the signal peptide and propeptide." [PMID:12493741]
comment: Category=modification.
is_a: PRO:000000514 ! TGF-beta 1 sequence variant 2 cleaved form

[Term]
id: PRO:000000620
name: TGF-beta 1 sequence variant 2 cleaved 2
def: "A TGF-beta 1 sequence variant 2 cleaved form that has been processed by proteolytic cleavage to remove the signal peptide and the C-terminal mature peptide. This chain is referred as to the latent associated peptide (LAP)." [PMID:12493741]
comment: Category=modification.
is_a: PRO:000000514 ! TGF-beta 1 sequence variant 2 cleaved form

[Term]
id: PRO:000000621
name: TGF-beta 1 sequence variant 3 cleaved 1
def: "A TGF-beta 1 sequence variant 3 cleaved form that has been processed by proteolytic cleavage of the signal peptide and propeptide." [PMID:11278244]
comment: Category=modification.
is_a: PRO:000000515 ! TGF-beta 1 sequence variant 3 cleaved form

[Term]
id: PRO:000000622
name: TGF-beta 1 sequence variant 3 cleaved 2
def: "A TGF-beta 1 sequence variant 3 cleaved form that has been processed by proteolytic cleavage to remove the signal peptide and the C-terminal mature peptide. This chain is referred as to the latent associated peptide (LAP). This form has decrease afinity for the mature peptide (PRO:000000621)." [PMID:11278244]
comment: Category=modification.
is_a: PRO:000000515 ! TGF-beta 1 sequence variant 3 cleaved form

[Term]
id: PRO:000000623
name: TGF-beta 1 sequence variant 5 cleaved 1
def: "A TGF-beta 1 sequence variant 5 cleaved form that has been processed by proteolytic cleavage of the signal peptide and propeptide." [PMID:12493741]
comment: Category=modification.
is_a: PRO:000000517 ! TGF-beta 1 sequence variant 5 cleaved form

[Term]
id: PRO:000000624
name: TGF-beta 1 sequence variant 5 cleaved 2
def: "A TGF-beta 1 sequence variant 5 cleaved form that has been processed by proteolytic cleavage to remove the signal peptide and the C-terminal mature peptide. This chain is referred as to the latent associated peptide (LAP)." [PMID:12493741]
comment: Category=modification.
is_a: PRO:000000517 ! TGF-beta 1 sequence variant 5 cleaved form

[Term]
id: PRO:000000625
name: TGF-beta 1 sequence variant 6 cleaved 1
def: "A TGF-beta 1 sequence variant 6 cleaved form that has been processed by proteolytic cleavage of the signal peptide and propeptide." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000000518 ! TGF-beta 1 sequence variant 6 cleaved form

[Term]
id: PRO:000000626
name: TGF-beta 1 sequence variant 6 cleaved 2
def: "A TGF-beta 1 sequence variant 6 cleaved form that has been processed by proteolytic cleavage to remove the signal peptide and the C-terminal mature peptide. This chain is referred as to the latent associated peptide (LAP)." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000000518 ! TGF-beta 1 sequence variant 6 cleaved form

[Term]
id: PRO:000000627
name: TGF-beta 1 sequence variant 4 cleaved 1
def: "A TGF-beta 1 sequence variant 4 cleaved form that has been processed by proteolytic cleavage of the signal peptide and propeptide." [PMID:11278244]
comment: Category=modification.
is_a: PRO:000000516 ! TGF-beta 1 sequence variant 4 cleaved form

[Term]
id: PRO:000000628
name: TGF-beta 1 sequence variant 4 cleaved 2
def: "A TGF-beta 1 sequence variant 4 cleaved form that has been processed by proteolytic cleavage to remove the signal peptide and the C-terminal mature peptide. This chain is referred as to the latent associated peptide (LAP). This form has decrease afinity for the mature peptide." [PMID:11278244]
comment: Category=modification.
is_a: PRO:000000516 ! TGF-beta 1 sequence variant 4 cleaved form

[Term]
id: PRO:000000629
name: TGF-beta 2 isoform 1 cleaved 1
def: "A TGF-beta 2 isoform 1 cleaved form that has been processed by proteolytic cleavage and released from the latent complex. This form is the active mature protein." [PMID:3476488]
comment: Category=modification.
synonym: "mature protein" RELATED []
is_a: PRO:000000519 ! TGF-beta 2 isoform 1 cleaved form

[Term]
id: PRO:000000630
name: TGF-beta 2 isoform 1 cleaved 2
def: "A TGF-beta 2 isoform 1 cleaved form that has been processed by proteolytic cleavage to remove the signal peptide and the C-terminal mature protein. This chain is referred as to the latent associated peptide (LAP)." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000000519 ! TGF-beta 2 isoform 1 cleaved form

[Term]
id: PRO:000000631
name: TGF-beta 2 isoform 1 cleaved 3
def: "A TGF-beta 2 isoform 1 that has cleavage of the signal peptide and also has cleavage at the dibasic cleavage site rendering the latent associated peptide (LAP) and the mature protein non-covalently bound." [PMID:10224129]
comment: Category=modification.
is_a: PRO:000000519 ! TGF-beta 2 isoform 1 cleaved form

[Term]
id: PRO:000000632
name: TGF-beta 2 isoform 2 cleaved 1
def: "A TGF-beta 2 isoform 2 cleaved form that has been processed by proteolytic cleavage and released from the latent complex. This form is the active mature peptide." [PMID:1777240]
comment: Category=modification.
is_a: PRO:000000520 ! TGF-beta 2 isoform 2 cleaved form

[Term]
id: PRO:000000633
name: TGF-beta 2 isoform 2 cleaved 2
def: "A TGF-beta 2 isoform 2 that has cleavage of the signal peptide and also has cleavage at the dibasic cleavage site rendering the latent associated peptide (LAP) and the mature protein non-covalently bound." [PMID:1777240]
comment: Category=modification.
is_a: PRO:000000520 ! TGF-beta 2 isoform 2 cleaved form

[Term]
id: PRO:000000634
name: TGF-beta 3 isoform 1 cleaved 1
def: "A TGF-beta 3 isoform 1 cleaved form that has been processed by proteolytic cleavage and released from the latent complex. This form is the active mature peptide." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000000521 ! TGF-beta 3 isoform 1 cleaved form

[Term]
id: PRO:000000635
name: TGF-beta 3 isoform 1 cleaved 2
def: "A TGF-beta 3 isoform 1 cleaved and glycosylated form that has been processed by proteolytic cleavage to remove the signal peptide and the C-terminal mature peptide. This chain is referred as to the latent associated peptide (LAP)." [PMID:11821050]
comment: Category=modification.
synonym: "TGFB3 lap" RELATED []
synonym: "TGFB3 latent associated peptide" RELATED []
is_a: PRO:000000521 ! TGF-beta 3 isoform 1 cleaved form

[Term]
id: PRO:000000636
name: TGF-beta 3 isoform 1 cleaved 3
def: "A TGF-beta 3 isoform 1 that has cleavage of the signal peptide and also has cleavage at the dibasic cleavage site rendering the latent associated peptide (LAP) and the mature protein non-covalently bound." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000000521 ! TGF-beta 3 isoform 1 cleaved form

[Term]
id: PRO:000000637
name: activin/inhibin beta A chain isoform 1 cleaved 1
def: "An activin/inhibin beta A chain isoform 1 cleaved form that has been processed to the mature peptide by removal of the signal peptide and subsequent release of the propeptide. It is a subunit of inhibin A and activin A complexes. Inhibin A complex is a dimer of INHA and INHBA, whereas activin A complex is a homodimer of INHBA." [PMID:15948132]
comment: Category=modification.
is_a: PRO:000000530 ! activin/inhibin beta A chain isoform 1 cleaved form

[Term]
id: PRO:000000638
name: activin/inhibin beta B chain isoform 1 cleaved 1
def: "An activin/inhibin beta B chain isoform 1 cleaved form that has been processed to the mature peptide by removal of the signal peptide and subsequent release of the propeptide. It is a subunit of activin B, inhibin B and activin AB complexes. Activin B is a homodimer of INHBB. Inhibin B is a dimer of INHA and INHBB. Activin AB is a dimer of INHBA and INHBB." [PMID:3754442]
comment: Category=modification.
is_a: PRO:000000531 ! activin/inhibin beta B chain isoform 1 cleaved form

[Term]
id: PRO:000000639
name: activin/inhibin beta E chain isoform 1 cleaved 1
def: "An activin/inhibin beta E chain isoform 1 cleaved form that has been processed to the mature peptide by removal of the signal peptide and subsequent release of the propeptide." [PMID:1286533, PRO:CNA]
comment: Category=modification.
is_a: PRO:000000532 ! activin/inhibin beta E chain isoform 1 cleaved form

[Term]
id: PRO:000000640
name: growth/differentiation factor 5 isoform 1 cleaved 1
def: "A growth/differentiation factor 5 isoform 1 cleaved form that has been processed to a mature protein by removal of the signal peptide and subsequent release of the propeptide. The functional unit is a dimer." [PMID:8962721, PRO:CNA]
comment: Category=modification.
is_a: PRO:000000548 ! growth/differentiation factor 5 isoform 1 cleaved form

[Term]
id: PRO:000000641
name: growth/differentiation factor 7 isoform 1 cleaved 1
def: "A growth/differentiation factor 7 isoform 1 cleaved form that has been processed to a mature protein by removal of the signal peptide and subsequent release of the propeptide." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000000549 ! growth/differentiation factor 7 isoform 1 cleaved form

[Term]
id: PRO:000000642
name: inhibin beta C chain isoform 1 cleaved 1
def: "An inhibin beta C chain isoform 1 cleaved form that has been processed to the mature peptide by removal of the signal peptide and subsequent release of the propeptide. It can form heterodimers with INHBB or INHBA." [PMID:11134153]
comment: Category=modification.
is_a: PRO:000000551 ! inhibin beta C chain isoform 1 cleaved form

[Term]
id: PRO:000000643
name: lefty 1 isoform 1 cleaved 1
def: "A lefty 1 isoform 1 cleaved form that has been processed by proteolytic cleavage in the first dibasic RxxR cleavage site of the propeptide region." [PMID:11278322, PMID:18039650]
comment: Category=modification.
is_a: PRO:000000554 ! lefty 1 isoform 1 cleaved form

[Term]
id: PRO:000000644
name: lefty 1 isoform 1 cleaved 2
def: "A lefty 1 isoform 1 cleaved form that has been processed by proteolytic cleavage in the second dibasic RxxR cleavage site of the propeptide region." [PMID:11278322]
comment: Category=modification.
is_a: PRO:000000554 ! lefty 1 isoform 1 cleaved form

[Term]
id: PRO:000000645
name: lefty 2 isoform 1 cleaved 1
def: "A lefty 2 isoform 1 cleaved form that has been processed by proteolytic cleavage in the first dibasic RxxR cleavage site of the propeptide region." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000000555 ! lefty 2 isoform 1 cleaved form

[Term]
id: PRO:000000646
name: lefty 2 isoform 1 cleaved 2
def: "A lefty 2 isoform 1 cleaved form that has been processed by proteolytic cleavage in the second dibasic RxxR cleavage site of the propeptide region." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000000555 ! lefty 2 isoform 1 cleaved form

[Term]
id: PRO:000000647
name: smad1 isoform 1 phosphorylated 1
def: "A smad1 isoform 1 phosphorylated form that has been phosphorylated at the C-terminal SSxS motif as a result of the activation of the bone morphogenetic protein (BMP) signaling pathway." [PMID:9136927]
comment: Category=modification.
synonym: "BMP receptor-activated smad1" EXACT []
synonym: "phospho-R-smad1" EXACT [REACTOME:REACT_12354.1]
is_a: PRO:000000571 ! smad1 isoform 1 phosphorylated form

[Term]
id: PRO:000000648
name: smad1 isoform 1 phosphorylated and ubiquitinated 1
def: "A smad1 isoform 1 phosphorylated and ubiquitinated form that has been phosphorylated at the two last C-terminal SSxS motif and has been ubiquitinated by smad ubiquitination regulatory factor 1 (PRO:000000466)." [PMID:12857866]
comment: Category=modification.
is_a: PRO:000000570 ! smad1 isoform 1 phosphorylated and ubiquitinated form

[Term]
id: PRO:000000649
name: smad2 isoform 1 acetylated and phosphorylated 1
def: "A smad2 isoform 1 acetylated and phosphorylated form that has been phosphorylated by TGF-beta receptor activation and further acetylated at a Lys residue within the MH1 domain by coactivators, such as CBP, PCAF and EP300." [PMID:17074756]
comment: Category=modification.
synonym: "smad2 sequence 1 acetylated-1 and phosphorylated-1" EXACT []
is_a: PRO:000000572 ! smad2 isoform 1 acetylated and phosphorylated form

[Term]
id: PRO:000000650
name: smad2 isoform 1 phosphorylated 1
def: "A smad2 isoform 1 phosphorylated form that has been phosphorylated in the last two Ser residues within the SSxS C-terminal motif by TGF-beta pathway activation." [PMID:8980228, PMID:9346966]
comment: Category=modification.
synonym: "TGF-beta receptor-activated smad2" RELATED []
is_a: PRO:000000574 ! smad2 isoform 1 phosphorylated form

[Term]
id: PRO:000000651
name: smad2 isoform 1 phosphorylated 2
def: "A smad2 isoform 1 phosphorylated form that has been phosphorylated at the N-terminal Px[ST]P motif by ERK1." [PMID:12193595]
comment: Category=modification.
is_a: PRO:000000574 ! smad2 isoform 1 phosphorylated form

[Term]
id: PRO:000000652
name: smad2 isoform 1 phosphorylated 3
def: "A smad2 isoform 1 phosphorylated form that has been phosphorylated at a [S/T] residue within the MH1-MH2 domain linker region in response to decorin-induced Ca(2+) signaling." [PMID:11027280, PRO:000000652]
comment: Category=modification.
is_a: PRO:000000574 ! smad2 isoform 1 phosphorylated form

[Term]
id: PRO:000000653
name: smad2 isoform 1 phosphorylated 4
def: "A smad2 isoform 1 phosphorylated form that has been phosphorylated at the clusters of [S/T]P motifs within the MH1-MH2 domain linker region through the MAP kinase cascade in the oncogenic Ras-activated pathway." [PMID:10197981]
comment: Category=modification.
is_a: PRO:000000574 ! smad2 isoform 1 phosphorylated form

[Term]
id: PRO:000000654
name: smad2 isoform 1 phosphorylated and ubiquitinated 1
def: "A smad2 isoform 1 phosphorylated and ubiquitinated form that has been phosphorylated by TGF-beta receptor activation and further ubiquitinated by NEDD4L. This form is targeted for proteosomal degradation." [PMID:15496141]
comment: Category=modification.
is_a: PRO:000000573 ! smad2 isoform 1 phosphorylated and ubiquitinated form

[Term]
id: PRO:000000655
name: smad2 isoform 2 acetylated and phosphorylated 1
def: "A smad2 isoform 2 phosphorylated form that has been phosphorylated in the last two Ser residues within the SSxS C-terminal motif by TGF-beta pathway activation and acetylated in a Lys residue within the MH1 domain by coactivators, such as CBP, PCAF and EP300." [PMID:17074756]
comment: Category=modification.
is_a: PRO:000000575 ! smad2 isoform 2 acetylated and phosphorylated form

[Term]
id: PRO:000000656
name: smad2 isoform 2 phosphorylated 1
def: "A smad2 isoform 2 phosphorylated form that has been phosphorylated in the last two Ser residues within the SSxS C-terminal motif by TGF-beta pathway activation." [PMID:15630024, PMID:17074756, PMID:9873005]
comment: Category=modification.
synonym: "TGF-beta receptor-activated smad2 " RELATED []
is_a: PRO:000000576 ! smad2 isoform 2 phosphorylated form

[Term]
id: PRO:000000657
name: smad3 isoform 1 acetylated and phosphorylated 1
def: "A smad3 isoform 1 phosphorylated form that has been phosphorylated by TGF-beta receptor activation and further acetylated in a Lys residue within the MH1 domain by coactivators, such as CBP and EP300." [PMID:17074756]
comment: Category=modification.
is_a: PRO:000000577 ! smad3 isoform 1 acetylated and phosphorylated form

[Term]
id: PRO:000000658
name: smad3 isoform 1 phosphorylated 1
def: "A smad3 isoform 1 phosphorylated form that has been phosphorylated at the C-terminal SSxS motif as a result of the activation of the transforming growth factor beta signaling pathway." [PMID:8774881]
comment: Category=modification.
synonym: "smad3 active" EXACT []
synonym: "TGF-beta receptor-activated smad3" RELATED []
is_a: PRO:000000578 ! smad3 isoform 1 phosphorylated form

[Term]
id: PRO:000000659
name: smad3 isoform 1 phosphorylated 2
def: "A smad3 isoform 1 phosphorylated form that has been phosphorylated at the N-terminal Px[ST]P motif and the clusters of [ST]P motifs within the MH1-MH2 domain linker region by G1 cyclin-dependent kinases (CDK4 and CDK2) leading to CDK inhibition of its transcriptional activity and antiproliferative function." [PMID:15241418]
comment: Category=modification.
is_a: PRO:000000578 ! smad3 isoform 1 phosphorylated form

[Term]
id: PRO:000000660
name: smad3 isoform 1 phosphorylated 3
def: "A smad3 isoform 1 phosphorylated form that has been phosphorylated at the clusters of [S/T]P motifs within the MH1-MH2 domain linker region through the MAP kinase cascade in oncogenic Ras-activated pathway. TGF-receptor phosphorylation sites are not required for Ras-induced phosphorylation." [PMID:10197981]
comment: Category=modification.
is_a: PRO:000000578 ! smad3 isoform 1 phosphorylated form

[Term]
id: PRO:000000661
name: smad5 isoform 1 phosphorylated 1
def: "A smad5 isoform 1 phosphorylated form that has been phosphorylated at the C-terminal SSxS motif as a result of the activation of the bone morphogenetic protein (BMP) signaling pathway." [PMID:8637600]
comment: Category=modification.
synonym: "phospho-R-smad5" EXACT [REACTOME:REACT_12102.1]
is_a: PRO:000000580 ! smad5 isoform 1 phosphorylated form

[Term]
id: PRO:000000662
name: smad6 isoform 1 methylated 1
def: "A smad6 sequence 1 dimethylated form that has been methylated at Arginine residue within the MH1 domain by PRMT1." [PMID:17118358]
comment: Category=modification.
is_a: PRO:000000581 ! smad6 isoform 1 methylated form

[Term]
id: PRO:000000663
name: smad7 isoform 1 acetylated 1
def: "A smad7 isoform 1 acetylated form that has been acetylated at Lys residues within the MH1 domain by Histone acetyltransferase p300. Acetylation stabilizes smad7." [PMID:12408818]
comment: Category=modification.
is_a: PRO:000000582 ! smad7 isoform 1 acetylated form

[Term]
id: PRO:000000664
name: smad7 isoform 1 phosphorylated 1
def: "A smad7 isoform 1 phosphorylated form that has been phosphorylated at the Ser residue within the DSQL sequence region in the MH2 domain." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000000583 ! smad7 isoform 1 phosphorylated form

[Term]
id: PRO:000000665
name: smad7 isoform 1 ubiquitinated 1
def: "A smad7 isoform 1 ubiquitinated form that has been ubiquitinated at Lys residues within the MH1 domain by Smurf proteins. This targets smad7 for proteosomal degradation." [PMID:12408818]
comment: Category=modification.
is_a: PRO:000000584 ! smad7 isoform 1 ubiquitinated form

[Term]
id: PRO:000000666
name: smad9 isoform 1 phosphorylated 1
def: "A smad9 isoform 1 phosphorylated form that has been phosphorylated at the C-terminal SSxS motif as a result of the activation of the bone morphogenetic protein (BMP) signaling pathway." [PMID:15542835]
comment: Category=modification.
synonym: "phospho-R-smad9" RELATED [REACTOME:REACT_12302.1]
is_a: PRO:000000585 ! smad9 isoform 1 phosphorylated form

[Term]
id: PRO:000000667
name: smad9 isoform 3 phosphorylated 1
def: "A smad9 isoform 3 phosphorylated form that has been phosphorylated at the C-terminal SSxS motif." [PMID:17081983, PRO:CNA]
comment: Category=modification.
is_a: PRO:000000586 ! smad9 isoform 3 phosphorylated form

[Term]
id: PRO:000000668
name: calcium-activated calmodulin-binding potassium channel alpha subunit
def: "A protein with amino- and carboxyl-terminal intracellular domains separated by a domain containing six transmembrane helices (S1-S6) in which the last two helices (S5 and S6) flank a loop, called the pore loop, which determines ion selectivity. They are subunits of the small conductance calcium-activated channels. SK channels are independent of voltage and gated solely by intracellular calcium. These membrane channels are heteromeric complexes that comprise pore-forming alpha-subunits and the calcium-binding protein calmodulin. Calmodulin binds to the SK channel through the Calmodulin binding domain (PF02888), which is located in an intracellular region of the alpha-subunit immediately carboxy-terminal to the pore. Channel opening is triggered when calcium binds the EF hands in the N-lobe of calmodulin. These channels play a crucial role in hyperpolarizing the membrane potential of excitable and nonexcitable cells." [PMID:10026195, PMID:11323678]
comment: Category=family.
xref: PIRSF:PIRSF038511
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000000669
name: cation channel sperm-associated protein 1
def: "A protein that is a translation product of the CATSPER1 gene. In mammals, four CatSper ion channel subunit genes (CatSpers 1-4) are required for sperm cell hyperactivation and male fertility. The four proteins assemble (presumably as a tetramer) to form a sperm-specific, alkalinization-activated Ca(2+)-selective channel. CatSper channels seem to require auxiliary subunits, such as CatSperB (PRO:000000672). In common with other channels, CatSper1 proteins have an architecture consisting of six transmembrane domains (S1-S6), arranged in a voltage sensor (S1-S4) and pore modules (S5-P-S6), and with both N and C termini on the intracellular side of the membrane. Unique to this class is the His-rich N-terminus that seems to be involved the pH sensitivity of the channel calcium currents." [PRO:CNA]
comment: Category=gene.
synonym: "CatSper1" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000000670
name: cation channel sperm-associated protein 2
def: "A protein that is a translation product of the CATSPER2 gene. In mammals, four CatSper ion channel subunit genes (CatSpers 1-4) are required for sperm cell hyperactivation and male fertility. The four proteins assemble (presumably as a tetramer) to form a sperm-specific, alkalinization-activated Ca(2+)-selective channel. CatSper channels seem to require auxiliary subunits, such as CatSperB (PRO:000000672). In common with other channels, CatSper2 proteins have an architecture consisting of six transmembrane domains (S1-S6), arranged in a voltage sensor (S1-S4) and pore modules (S5-P-S6), and with both N and C termini on the intracellular side of the membrane." [PRO:CNA]
comment: Category=gene.
synonym: "CatSper2" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000000671
name: cation channel sperm-associated protein 3
def: "A protein that is a translation product of the CATSPER3 gene. In mammals, four CatSper ion channel subunit genes (CatSpers 1-4) are required for sperm cell hyperactivation and male fertility. The four proteins assemble (presumably as a tetramer) to form a sperm-specific, alkalinization-activated Ca(2+)-selective channel. CatSper channels seem to require auxiliary subunits, such as CatSperB (PRO:000000672). In common with other channels, CatSper3 proteins have an architecture consisting of six transmembrane domains (S1-S6), arranged in a voltage sensor (S1-S4) and pore modules (S5-P-S6), and with both N and C termini on the intracellular side of the membrane." [PRO:CNA]
comment: Category=gene.
synonym: "Ca(v)-like protein" EXACT []
synonym: "CatSper3" EXACT []
synonym: "One-repeat calcium channel-like protein" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000000672
name: cation channel sperm-associated protein subunit beta
def: "A protein that is a translation product of the CATSPERB gene. Members of this class are auxiliary proteins to the CatSper channel. They have four putative transmembrane-spanning domains. In mammals, four CatSper ion channel subunit genes (CatSpers 1-4) are required for sperm cell hyperactivation and male fertility. The four proteins assemble (presumably as a tetramer) to form a sperm-specific, alkalinization-activated Ca(2+)-selective channel." [PMID:17478420, PRO:CNA]
comment: Category=gene.
synonym: "CatSperB" EXACT []
synonym: "CatSperbeta" EXACT []
xref: PIRSF:PIRSF038543
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000000673
name: cyclic nucleotide-gated channel alpha subunit
def: "A protein with amino- and carboxyl-terminal intracellular domains separated by a domain (common with other ion channels) containing six transmembrane helices (S1-S6) in which the last two helices (S5 and S6) flank a loop, called the pore loop, which determines ion selectivity. The carboxy-terminal region contains the Cyclic nucleotide-binding domain (PF00027) (CNBD) and a region connecting the CNBD to the S6 segment (C-linker), which is important for modulation by transition metals. In addition, CNG alpha has a carboxy-terminal leucine zipper that seems to be involved in inter-subunit interaction. CNG alpha subunits combine with the beta subunits to form the cyclic nucleotide-gated ion channels, which mediate sensory transduction in photoreceptors and olfactory sensory neurons. These channels are likely composed of four subunits around a centrally located ion-permeable pore that opens in response to the direct binding of intracellular cyclic nucleotides. CNG channels are non-selective cation channels. They are not gated by membrane voltage although their structure includes the transmembrane S4 motif known to function as the membrane voltage sensor in all voltage-gated ion channels, but it has been shown to be important for proper folding and processing. Alpha and beta subunits of the CNG channel are very similar, however only alpha subunits are able to homooligomerize and form functional channels." [PMID:12432397, PRO:CNA]
comment: Category=family.
xref: PIRSF:PIRSF002403
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000000674
name: cyclic nucleotide-gated channel beta subunit
def: "A protein that is a modulatory subunit of the cyclic nucleotide-gated channel (CNG channel). It consists of amino- and carboxyl-terminal intracellular domains separated by a domain (common with other ion channels) containing six transmembrane helices (S1-S6) in which the last two helices (S5 and S6) flank a loop, called the pore loop, which determines ion selectivity. The carboxy-terminal region contains the Cyclic nucleotide-binding domain (PF00027) (CNBD) and a region connecting the CNBD to the S6 segment (C-linker), which is important for modulation by transition metals. CNG beta subunits combine with the alpha subunits to form the cyclic nucleotide-gated ion channels, which mediate sensory transduction in photoreceptors and olfactory sensory neurons. These channels are likely composed of four subunits around a centrally located ion-permeable pore that opens in response to the direct binding of intracellular cyclic nucleotides. CNG channels are non-selective cation channels. They are not gated by membrane voltage although their structure includes the transmembrane S4 motif known to function as the membrane voltage sensor in all voltage-gated ion channels, but it has been shown to be important for proper folding and processing. Alpha and beta subunits of the CNG channel are very similar, however the beta subunits are not able to form functional channels by themselves." [PRO:CNA]
comment: Category=family.
xref: PIRSF:PIRSF038515
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000000675
name: platelet-derived growth factor with CUB domain
def: "A protein with a core domain composition consisting of a signal peptide, a CUB domain (PF00431), and a C-terminal Platelet-derived growth factor (PDGF) domain (PF00341)." [PRO:CNA]
comment: Category=family.
xref: PIRSF:PIRSF038533
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000000676
name: potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel protein
def: "A protein with amino- and carboxyl-terminal intracellular domains separated by a domain (common with other ion channels) containing six transmembrane helices (S1-S6) in which the last two helices (S5 and S6) flank a loop, called the pore loop, which determines ion selectivity. The N-terminus has a conserved domain that is also present in other voltage-gated potassium and sodium channels. The carboxyl-terminal region contains the cyclic nucleotide-binding domain (CNBD). In addition, there is a structural element called the C-linker, the region connecting the CNBD to the S6 segment, which couples conformational changes in the ligand-binding domain to channel activation. Subunits combine to form the HCN channels. In common with CNG channels, HCN are cation channels that are modulated by cyclic nucleotide binding. Unlike CNG channels, HCN channels are voltage-gated, and are weakly selective for potassium. In contrast to most other voltage-gated channels, HCN channels open upon hyperpolarization and close at positive potential. HCN channels act as a pacemaker by regulating neuronal and cardiac firing rate, but also function as a regulator of membrane resting potential and resistance." [PMID:16382102]
comment: Category=family.
synonym: "f-channel" EXACT []
synonym: "HCN" RELATED []
xref: PIRSF:PIRSF038514
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000000677
name: shab-related voltage-gated potassium channel alpha subunit
def: "A protein that has a conserved carboxyl terminal domain called the Kv2 channel domain. Kv2 channels are known as delayed rectifier channels. Shab-related voltage-potassium channels are involved in maintaining membrane potential and modulating electrical excitability in neurons. In common with other voltage-gated channels, has a domain composition consisting of six transmembrane domains (S1-S6), arranged in a voltage sensor (S1-S4) and pore modules (S5-P-S6), and with both N and C termini on the intracellular side of the membrane. The charged S4 segment with a basic amino acid at every third position confers their voltage sensitivity. In common with Kv3 and Kv4 channels, the tetramerization domain at the N-terminus contains a zinc binding site." [PRO:CNA]
comment: Category=family.
synonym: "Kv2 channel" RELATED []
xref: PIRSF:PIRSF038520
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000000678
name: sodium leak channel non-selective protein
def: "A protein that is a translation product of the NALCN gene. The prototype subunit contains four copies of the six transmembrane ion transport protein domain, but the number of copies of this domain varies among splice variants. Responsible for the background sodium ion leak current in neurons and controls neuronal excitability. They are subunits of a voltage-independent, nonselective cation channel." [PMID:17448995, PRO:CNA]
comment: Category=gene.
synonym: "NALCN" EXACT []
synonym: "Vgcnl1" EXACT []
synonym: "Voltage gated channel-like protein 1" EXACT []
xref: PIRSF:PIRSF038547
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000000679
name: transient receptor potential cation channel TRPA
def: "A protein that is a member of the subfamily A of the transient receptor potential cation channels (TRPs), with amino- and carboxyl-terminal intracellular domains separated by a domain (common with other ion channels) containing six transmembrane helices (S1-S6) in which the last two helices (S5 and S6) flank a loop, called the pore loop, which determines ion selectivity. The amino terminal domain contains 14-16 copies of Ankyrin repeat (PF00023). Most TRPs are relatively non-selective. They may be modulated by voltage changes but channel gating is generally effected by other means." [PMID:16382100, PMID:16460286, PMID:17579562, PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF038535
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000000680
name: transient receptor potential cation channel TRPC
def: "A protein that is a member of the subfamily C of the transient receptor potential cation channels (TRPs), with amino- and carboxyl-terminal intracellular domains separated by a domain (common with other ion channels) containing six transmembrane helices (S1-S6) in which the last two helices (S5 and S6) flank a loop, called the pore loop, which determines ion selectivity. The amino terminal domain contains up to 4 detectable copies of Ankyrin repeat (PF00023) followed by the Transient receptor ion channel II domain (PF08344). Most TRPs are relatively non-selective. They may be modulated by voltage changes but channel gating is generally effected by other means." [PMID:16382100, PMID:16460286, PMID:17579562, PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF005528
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000000681
name: transient receptor potential cation channel TRPV
def: "A protein that is a member of the subfamily V of the transient receptor potential cation channels (TRPs), with amino- and carboxyl-terminal intracellular domains separated by a domain (common with other ion channels) containing six transmembrane helices (S1-S6) in which the last two helices (S5 and S6) flank a loop, called the pore loop, which determines ion selectivity. The amino terminal domain contains up to 6 copies of detectable ankyrin repeat (PF00023). Most TRPs are relatively non-selective. They may be modulated by voltage changes but channel gating is generally effected by other means." [PMID:16382100, PMID:16460286, PMID:17579562, PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF038527
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000000682
name: voltage-gated potassium channel alpha subunit with PAS domain
def: "A protein with amino- and carboxyl-terminal intracellular domains separated by a domain (common with other ion channels) containing six transmembrane helices (S1-S6) in which the last two helices (S5 and S6) flank a loop, called the pore loop, which determines ion selectivity. Unique to this class is the presence of an N-terminal PAS fold domain (PF00989). In addition, in the cytoplasmic region downstream from S6, there is a segment that shares substantial similarity to the Cyclic nucleotide-binding domain (PF00027) (CNBD) present in cyclic nucleotide-gated cation channel subunits (PRO:000000674 and PRO:000000674). These channels regulate membrane excitability." [PMID:8159766]
comment: Category=family.
xref: PIRSF:PIRSF038287
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000000683
name: voltage-gated potassium channel alpha subunit KCNA4
def: "A protein voltage-gated potassium channel alpha subunit that is a translation product of the KCNA4 gene. The Kv1.4 channel is a fast-inactivating channel involved in neuronal after hypolarization. It can coassemble with other Kv1 subunits. It is closely related to members of the shaker-related voltage-gated potassium channel, but has a unique N-terminal domain, with two tandem inactivation domains (ID1-ID2). ID1 may work as a pore-occluding ball domain, whereas ID2 most likely acts as a docking domain that attaches ID1 to the cytoplasmic face of the channel." [PMID:12590144]
comment: Category=gene.
synonym: "Kv1.4" RELATED []
xref: PIRSF:PIRSF038521
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000000684
name: voltage-gated potassium channel subunit KQT
def: "A protein with a core domain composition consisting of six transmembrane domains (S1-S6), arranged in a voltage sensor (S1-S4) and pore modules (S5-P-S6), and with both N and C termini on the intracellular side of the membrane. The charged S4 segment with a basic amino acid at every third position confers their voltage sensitivity. Unlike other voltage-gated potassium channels, these proteins lack the N-terminal tetramerization domain (T1), which encodes molecular determinants for subfamily-specific assembly of alpha-subunits into functional tetrameric channels. Also, unique to this class is the presence of a carboxyl terminal domain called the KCNQ voltage-gated potassium channel domain (PF03520) or A-domain. Voltage-gated potassium channels are composed of tetramers of alpha subunits, with each alpha subunit containing a voltage sensor and contributing to the central pore. This pore is formed by these subunits that encircle a central ion conduction pathway. KQT channels are responsible for M-type potassium currents in the nervous and auditory systems and slow delayed rectifier K+ currents in the heart." [PRO:CNA]
comment: Category=family.
xref: PIRSF:PIRSF038513
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000000685
name: voltage-gated potassium channel alpha subunit
def: "A protein with a core domain composition consisting of six transmembrane domains (S1-S6), arranged in a voltage sensor (S1-S4) and pore modules (S5-P-S6), and with both N and C termini on the intracellular side of the membrane. The charged S4 segment with a basic amino acid at every third position confers their voltage sensitivity. A hallmark of this class is the presence of an N-terminal K+ channel tetramerisation domain (PF02214) (T1), which encodes molecular determinants for subfamily-specific assembly of alpha-subunits into functional tetrameric channels. Carbonyl oxygen atoms from the potassium channel signature sequence (TTxGYGD) line the selectivity filter, where they preferentially coordinate potassium. Voltage-gated potassium channels are composed of tetramers of alpha subunits with each alpha subunit containing a voltage sensor and contributing to the central pore. This pore is formed by these subunits that encircle a central ion conduction pathway." [PMID:16382097, PMID:17606609, PMID:9886290]
comment: Category=family.
xref: PIRSF:PIRSF002449
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000000686
name: cGMP-gated cation channel alpha-1
def: "A cyclic nucleotide-gated channel alpha subunit that is a translation product of the CNGA1 gene. In the retina, these proteins can be activated by cyclic GMP which leads to an opening of the cation channel and thereby causing a depolarization of rod photoreceptors." [PRO:CNA]
comment: Category=gene.
synonym: "rod alpha subunit" EXACT []
is_a: PRO:000000673 ! cyclic nucleotide-gated channel alpha subunit

[Term]
id: PRO:000000687
name: calcium-selective transient receptor potential cation channel TRPV
def: "A transient receptor potential cation channel TRPV that is distinctive in being insensitive to heat and strongly selective for calcium ion transport." [PMID:16382100, PMID:16460286, PMID:17579562, PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF500996
is_a: PRO:000000681 ! transient receptor potential cation channel TRPV

[Term]
id: PRO:000000688
name: cation channel sperm-associated protein 1 isoform 1
def: "A cation channel sperm-associated protein 1 that is a translation product of a mature transcript of the CATSPER1 gene encoding all core domains. This form is represented by the mouse sequence UniProtKB:Q91ZR5-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000669 ! cation channel sperm-associated protein 1

[Term]
id: PRO:000000689
name: cation channel sperm-associated protein 2 isoform 1
def: "A cation channel sperm-associated protein 2 that is a translation product of the mature transcript of CATSPER2 gene, with the core domain architecture. This form is represented by the human sequence UniProtKB:Q96P56-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000670 ! cation channel sperm-associated protein 2

[Term]
id: PRO:000000690
name: cation channel sperm-associated protein 2 isoform 2
def: "A cation channel sperm-associated protein 2 that is a translation product of the mature transcript of CATSPER2 gene, with all core domains, uses an alternate in-frame splice site in the coding region, compared to variant 2, resulting in a protein that is two amino acids shorter than isoform 1 (PRO:000000689) after the S6 segment. This form is represented by the human sequence UniProtKB:Q96P56-2." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000670 ! cation channel sperm-associated protein 2

[Term]
id: PRO:000000691
name: cation channel sperm-associated protein 2 isoform 3
def: "A cation channel sperm-associated protein 2 that is a translation product of the mature transcript of CATSPER2 gene which uses an alternate splice site in the coding region that causes a frameshift. This form lacks most of the cytoplasmic C-terminal domain. This form is represented by the human sequence UniProtKB:Q96P56-3." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000670 ! cation channel sperm-associated protein 2

[Term]
id: PRO:000000692
name: cation channel sperm-associated protein 2 isoform 4
def: "A cation channel sperm-associated protein 2 that is a translation product of the mature transcript of CATSPER2 gene, with the core domain architecture, and with an additional unconventional leucine zipper motif at the C-terminus. This form is represented by the mouse sequence UniProtKB:A2ARP9-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000670 ! cation channel sperm-associated protein 2

[Term]
id: PRO:000000693
name: cation channel sperm-associated protein 3 isoform 1
def: "A cation channel sperm-associated protein 3 that is a translation product of the mature transcript of CATSPER3 gene, with the core domain architecture. This form is represented by the mouse sequence UniProtKB:Q80W99-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000671 ! cation channel sperm-associated protein 3

[Term]
id: PRO:000000694
name: cation channel sperm-associated protein 3 isoform 2
def: "A cation channel sperm-associated protein 3 that is a translation product of the mature transcript of CATSPER3 gene, missing the exon coding for the C-terminal part of the first loop and most of the predicted transmembrane S2 segment. This form is represented by the mouse sequence UniProtKB:Q80W99-2." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000671 ! cation channel sperm-associated protein 3

[Term]
id: PRO:000000695
name: cation channel sperm-associated protein subunit beta isoform 1
def: "A cation channel sperm-associated protein subunit beta that is a translation product of a mature transcript of the CASPERB gene, and that includes the putative transmembrane domains. This form is represented by the human sequence UniProtKB:Q9H7T0-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000672 ! cation channel sperm-associated protein subunit beta

[Term]
id: PRO:000000696
name: cyclic nucleotide-gated cation channel alpha-3
def: "A cyclic nucleotide-gated channel alpha subunit that is a translation product of the CNGA3 gene. This protein are the alpha subunits of the cone cyclic nucleotide-gated cation channel. This channel generates the light-evoked electrical responses of cone photoreceptors." [PRO:CNA]
comment: Category=gene.
synonym: "CNCG3" RELATED []
synonym: "CNG channel alpha-3" EXACT []
synonym: "CNG-3" EXACT []
synonym: "CNG3" EXACT []
synonym: "CNGA3" RELATED []
synonym: "Cone photoreceptor cGMP-gated channel subunit alpha" EXACT []
synonym: "Cyclic nucleotide-gated channel alpha-3" EXACT []
is_a: PRO:000000673 ! cyclic nucleotide-gated channel alpha subunit

[Term]
id: PRO:000000697
name: cyclic nucleotide-gated cation channel beta-3
def: "A cyclic nucleotide-gated channel beta subunit that is a translation product of the CNGB3 gene. Many members of this class are subunits of the cone cyclic nucleotide-gated cation channel, which generates the light-evoked electrical responses of cone photoreceptors." [PRO:CNA]
comment: Category=gene.
synonym: "CNG channel beta-3" EXACT []
synonym: "Cng6" EXACT []
synonym: "Cone photoreceptor cGMP-gated channel subunit beta" EXACT []
xref: PIRSF:PIRSF501006
is_a: PRO:000000674 ! cyclic nucleotide-gated channel beta subunit

[Term]
id: PRO:000000698
name: cyclic nucleotide-gated olfactory channel
def: "A cyclic nucleotide-gated channel alpha subunit that is a translation product of the CNGA2 gene." [PRO:CNA]
comment: Category=gene.
synonym: "CNG channel alpha-2 " EXACT []
synonym: "cyclic nucleotide-gated cation channel 2 " EXACT []
is_a: PRO:000000673 ! cyclic nucleotide-gated channel alpha subunit

[Term]
id: PRO:000000699
name: transient receptor potential cation channel TRPA1
def: "A transient receptor potential cation channel TRP that is a translation product of the TRPA1 gene." [MGI:HJD]
comment: Category=gene.
synonym: "ANKTM1" RELATED []
synonym: "Ankyrin-like with transmembrane domains protein 1" EXACT []
is_a: PRO:000000679 ! transient receptor potential cation channel TRPA

[Term]
id: PRO:000000700
name: intermediate conductance calcium-activated potassium channel protein 4
def: "A calcium-activated calmodulin-binding potassium channel alpha subunit that is a translation product of the KCNN4 gene. It forms a voltage-independent potassium channel that is activated by intracellular calcium. Activation is followed by membrane hyperpolarization which promotes calcium influx. The channel is blocked by clotrimazole and charybdotoxin but is insensitive to apamin. This feature distinguishes the intermediate from the small conductance channels." [PMID:9326665, PMID:9407042]
comment: Category=gene.
synonym: "IK1" EXACT []
synonym: "IKCa1" EXACT []
synonym: "SK4" EXACT []
is_a: PRO:000000668 ! calcium-activated calmodulin-binding potassium channel alpha subunit

[Term]
id: PRO:000000701
name: modulatory voltage-gated potassium channel subunit KCNG
def: "A voltage-gated potassium channel alpha subunit that is a modulator of the shab-related potassium channels (Kv2). Similarly to KCNF1, KCNV and KCNS subunits, KCNG subunits are not able to form functional channels on their own. Also in common with these modulatory subunits, it lacks the conserved PxP motif located in the distal part of S6. In this class the motif is PxT. The alteration of the PxP motif seems to be an important determinant of the regulatory function of modulatory subunits." [PMID:9305895]
comment: Category=family.
synonym: "silent subunit" RELATED []
xref: PIRSF:PIRSF500980
is_a: PRO:000000685 ! voltage-gated potassium channel alpha subunit

[Term]
id: PRO:000000702
name: modulatory voltage-gated potassium channel subunit KCNS
def: "A voltage-gated potassium channel alpha subunit that is a modulator of the shab-related potassium channels (Kv2). Similarly to KCNF1, KCNV and KCNG subunits, KCNS subunits are not able to form functional channels on their own. Also in common with these modulatory subunits, it lacks the conserved PxP motif located in the distal part of S6. In this class the motif is PIT. The alteration of the PxP motif seems to be an important determinant of the regulatory function of modulatory subunits." [PMID:12642579, PMID:9305895]
comment: Category=family.
synonym: "silent subunit" RELATED []
xref: PIRSF:PIRSF500981
is_a: PRO:000000685 ! voltage-gated potassium channel alpha subunit

[Term]
id: PRO:000000703
name: platelet-derived growth factor C
def: "A platelet-derived growth factor with CUB domain that is a translation product of the PDGFC gene. Potent mitogen and chemoattractant for cells of mesenchymal origin. Binding of this growth factor to its affinity receptor elicits a variety of cellular responses. Appears to be involved in the three stages of wound healing: inflammation, proliferation and remodeling." [PRO:CNA]
comment: Category=gene.
synonym: "Fallotein" RELATED []
synonym: "PDGF-C" RELATED []
synonym: "SCDGF" RELATED []
synonym: "VEGF-E" RELATED []
is_a: PRO:000000675 ! platelet-derived growth factor with CUB domain

[Term]
id: PRO:000000704
name: platelet-derived growth factor D
def: "A platelet-derived growth factor with CUB domain that is a translation product of the PDGFD gene. Potent mitogen for cells of mesenchymal origin." [PRO:CNA]
comment: Category=gene.
synonym: "IEGF" RELATED []
synonym: "Iris-expressed growth factor" EXACT []
synonym: "PDGF-D" EXACT []
synonym: "PDGFD" RELATED []
synonym: "PDGFD latent form" EXACT []
synonym: "PDGFD receptor-binding form" EXACT []
synonym: "Platelet-derived growth factor D, latent form" EXACT []
synonym: "Platelet-derived growth factor D, receptor-binding form" EXACT []
synonym: "SCDGF-B" EXACT []
synonym: "SCDGFB" RELATED []
synonym: "Scdgfb" RELATED []
synonym: "Spinal cord-derived growth factor B" EXACT []
is_a: PRO:000000675 ! platelet-derived growth factor with CUB domain

[Term]
id: PRO:000000705
name: potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1
def: "A potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel protein that is a translation product of the HCN1 gene." [PRO:CNA]
comment: Category=gene.
synonym: "BCNG-1" EXACT []
synonym: "HCN1" EXACT []
is_a: PRO:000000676 ! potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel protein

[Term]
id: PRO:000000706
name: potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2
def: "A potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel protein that is a translation product of the HCN2 gene." [PRO:CNA]
comment: Category=gene.
synonym: "BCNG-2" EXACT []
synonym: "Hac1" EXACT []
xref: PIRSF:PIRSF500961
is_a: PRO:000000676 ! potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel protein

[Term]
id: PRO:000000707
name: potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 3
def: "A potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel protein that is a translation product of the HCN3 gene." [PRO:CNA]
comment: Category=gene.
synonym: "HAC-3" EXACT []
synonym: "HCN3" RELATED []
synonym: "Hyperpolarization-activated cation channel 3" EXACT []
xref: PIRSF:PIRSF500962
is_a: PRO:000000676 ! potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel protein

[Term]
id: PRO:000000708
name: potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4
def: "A potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel protein that is a translation product of the HCN4 gene." [PRO:CNA]
comment: Category=gene.
synonym: "BCNG-3" EXACT []
synonym: "Bcng3" RELATED []
synonym: "Brain cyclic nucleotide-gated channel 3" EXACT []
synonym: "HCN4" RELATED []
xref: PIRSF:PIRSF500963
is_a: PRO:000000676 ! potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel protein

[Term]
id: PRO:000000709
name: shaker-related voltage-gated potassium channel alpha subunit
def: "A voltage-gated potassium channel alpha subunit that is a member of the subfamily A of voltage-gated potassium channels. The N-terminus is rich in basic residues and this region is critical for the N-type inactivation. Shaker-related voltage-gated potassium channels (Kv1 channels) play an important role in modulating electrical excitability of axons." [PMID:11506885]
comment: Category=family.
synonym: "Kv1" RELATED []
is_a: PRO:000000685 ! voltage-gated potassium channel alpha subunit

[Term]
id: PRO:000000710
name: shal-related voltage-gated potassium channel
def: "A voltage-gated potassium channel alpha subunit that is a constituent of the Kv4 channels, responsible for transient, voltage-dependent potassium currents (A currents) in the brain and heart. The unique motif KSCASE is absolutely conserved in all shal-related channel subunits. Mutations in this region drastically affect deactivation and inactivation. This motif is located in the cytoplasmic S4-S5 loop. In common with Kv2 and Kv3 channels, the tetramerization domain at the N-terminus contains a zinc binding site. Kv.4 channels are modulated by Kv4 Channel Interacting Proteins (KChIPs1-4), which bind to the cytoplasmic N-terminal domain." [PMID:15555915]
comment: Category=family.
synonym: "A-type potassium channel" RELATED []
synonym: "Kv4" RELATED []
synonym: "pore-forming Kv4 alpha subunits" RELATED []
xref: PIRSF:PIRSF500983
is_a: PRO:000000685 ! voltage-gated potassium channel alpha subunit

[Term]
id: PRO:000000711
name: shaw-related voltage-gated potassium channel alpha subunit
def: "A voltage-gated potassium channel alpha subunit that is a constituent of Kv3 channels. These proteins are characterized by the high sequence conservation in the S5 segment which seems to determine the gating properties of the Kv3 channels: rightward shifted voltage dependence and fast deactivation rates. They also contain an ATM motif at the lysine-rich C-terminal region that is unique to this group. Kv3 channels are necessary for high-frequency, repetitive firing of action potentials. High activation threshold is a hallmark of Kv3 channels. They regulate rapid spiking, transmitter release and dendritic integration of many central neurons. In common with Kv2 and Kv4 channels, the tetramerization domain at the N-terminus contains a zinc-binding site." [PMID:11506885]
comment: Category=family.
synonym: "Kv3 channel" RELATED []
xref: PIRSF:PIRSF500973
is_a: PRO:000000685 ! voltage-gated potassium channel alpha subunit

[Term]
id: PRO:000000712
name: small conductance calcium-activated potassium channel protein 1
def: "A calcium-activated calmodulin-binding potassium channel alpha subunit that is a translation product of the KCNN1 gene." [PRO:CNA]
comment: Category=gene.
synonym: "SK1" RELATED []
is_a: PRO:000000668 ! calcium-activated calmodulin-binding potassium channel alpha subunit

[Term]
id: PRO:000000713
name: small conductance calcium-activated potassium channel protein 2
def: "A calcium-activated calmodulin-binding potassium channel alpha subunit that is a translation product of the KCNN2 gene." [PRO:CNA]
comment: Category=gene.
synonym: "KCNN2" RELATED []
synonym: "SK2" EXACT []
is_a: PRO:000000668 ! calcium-activated calmodulin-binding potassium channel alpha subunit

[Term]
id: PRO:000000714
name: small conductance calcium-activated potassium channel protein 3
def: "A calcium-activated calmodulin-binding potassium channel alpha subunit that is a translation product of the KCNN3 gene. The KCNN3 gene contains two arrays of CAG trinucleotide repeats, which are highly polymorphic. The SK3 channels are thought to regulate neuronal excitability by contributing to the slow component of synaptic afterhyperpolarization." [PRO:CNA]
comment: Category=gene.
synonym: "SKCa3" EXACT []
is_a: PRO:000000668 ! calcium-activated calmodulin-binding potassium channel alpha subunit

[Term]
id: PRO:000000715
name: sodium leak channel non-selective protein isoform 1
def: "A sodium leak channel non-selective protein that is a translation product of a mature transcript of the NALCN gene, and that contains the four copies of the 6 transmembrane ion transport protein domain. Represented by the human sequence UniProtKB:Q8IZF0-1. Responsible for the background sodium ion leak current in neurons and controls neuronal excitability." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000678 ! sodium leak channel non-selective protein

[Term]
id: PRO:000000716
name: sodium leak channel non-selective protein isoform 2
def: "A Sodium leak channel non-selective protein that is a translation product of a mature transcript of the NALCN gene, and that lacks three of the six transmembrane ion transport domain at the C-terminus. This form is represented by the human sequence UniProtKB:Q8IZF0-2." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000678 ! sodium leak channel non-selective protein

[Term]
id: PRO:000000717
name: sodium leak channel non-selective protein isoform 3
def: "A sodium leak channel non-selective protein that is a translation product of a mature transcript of the NALCN gene, and that contains only a partial copy of the most N-terminal transmembrane ion transport domain. This form is represented by the human sequence UniProtKB:Q8IZF0-3." [PRO:CNA]
comment: Category=sequence.
synonym: "sodium leak channel non-selective protein isoform 4" EXACT []
is_a: PRO:000000678 ! sodium leak channel non-selective protein

[Term]
id: PRO:000000718
name: transient receptor potential cation channel TRPC3/6/7
def: "A transient receptor potential cation channel TRPC that is a member of a subgroup of subfamily C containing the very similar TRPC3, TRPC6, and TRPC7. They form homomeric or heteromeric nonselective cation channels that generate double-rectifying currents and are activated by diacylglycerol." [PMID:16382100, PMID:16460286, PMID:17579562]
comment: Category=family.
synonym: "DAG-sensitive TRPC" RELATED []
xref: PIRSF:PIRSF500999
is_a: PRO:000000680 ! transient receptor potential cation channel TRPC

[Term]
id: PRO:000000719
name: voltage-gated potassium channel Eag alpha subunit
def: "A voltage-gated potassium channel alpha subunit with PAS domain whose activation is characterized by a nonsuperimposable Cole-Moore shift, in which the time course of activation becomes slower and more sigmoidal as the prepulse or holding potential is made more negative and, as a consequence, the currents do not superimpose when aligned by shifting along the time axis." [PMID:10191308, PMID:6275922]
comment: Category=family.
xref: PIRSF:PIRSF500995
is_a: PRO:000000682 ! voltage-gated potassium channel alpha subunit with PAS domain

[Term]
id: PRO:000000720
name: voltage-gated potassium channel Elk alpha subunit
comment: Category=family.
xref: PIRSF:PIRSF500884
is_a: PRO:000000682 ! voltage-gated potassium channel alpha subunit with PAS domain

[Term]
id: PRO:000000721
name: voltage-gated potassium channel Erg alpha subunit
def: "A voltage-gated potassium channel alpha subunit with PAS domain which is characterized by its nanomolar sensitivity to class III antiarrhythmic drugs." [PMID:7604285]
comment: Category=family.
xref: PIRSF:PIRSF500886
is_a: PRO:000000682 ! voltage-gated potassium channel alpha subunit with PAS domain

[Term]
id: PRO:000000722
name: voltage-gated potassium channel KCNB1
def: "A shab-related voltage-gated potassium channel alpha subunit that is a translation product of the KCNB1 gene. It associates with other subunits to generate a delayed rectifier potassium channel." [PRO:CNA]
comment: Category=gene.
synonym: "KV2.1" EXACT []
synonym: "Potassium voltage-gated channel subfamily B member 1" EXACT []
is_a: PRO:000000677 ! shab-related voltage-gated potassium channel alpha subunit

[Term]
id: PRO:000000723
name: voltage-gated potassium channel KCNB2
def: "A shab-related voltage-gated potassium channel alpha subunit that is a translation product of the KCNB2 gene." [PRO:CNA]
comment: Category=gene.
synonym: "KV2.2" EXACT []
synonym: "Potassium voltage-gated channel subfamily B member 2" EXACT []
is_a: PRO:000000677 ! shab-related voltage-gated potassium channel alpha subunit

[Term]
id: PRO:000000724
name: voltage-gated potassium channel KCNF1
def: "A voltage-gated potassium channel alpha subunit that is a translation product of the KCNF1 gene. KCNF1 is a modulator of the shab-related potassium channels (Kv2). Unlike other potassium channel subunits, KCNF1 subunits are not able to form functional channels on their own." [PMID:9696692]
comment: Category=gene.
synonym: "KV5.1" EXACT []
synonym: "Potassium voltage-gated channel subfamily F member 1" EXACT []
xref: PIRSF:PIRSF500982
is_a: PRO:000000685 ! voltage-gated potassium channel alpha subunit

[Term]
id: PRO:000000725
name: voltage-gated potassium channel KCNV1
def: "A voltage-gated potassium channel alpha subunit that is a translation product of the KCNV1 gene. It has an atypical S6 segment containing the structural elements that modify inactivation of Kv2 channels. Similarly to KCNF1, KCNV1 and KCNS, KCNV2 subunits are not able to form functional channels on their own. Also in common with these modulatory subunits, it lacks the conserved PxP motif located in the distal part of S6. In this class the motif is PIA. The alteration of the PxP motif seems to be an important determinant of the regulatory function of modulatory subunits. It modulates the activity of KCNB1 and KCNB2 channels by changing kinetics and levels of expression and by shifting the half-inactivation potential to more polarized values." [PMID:16382104]
comment: Category=gene.
synonym: "Kv8.1" EXACT []
synonym: "Potassium voltage-gated channel subfamily V member 1" EXACT []
xref: PANTHER:PTHR11537\:SF38
is_a: PRO:000000685 ! voltage-gated potassium channel alpha subunit

[Term]
id: PRO:000000726
name: voltage-gated potassium channel KCNV2
def: "A voltage-gated potassium channel alpha subunit that is a translation product of the KCNV2 gene. Similarly to KCNF1, KCNV1 and KCNS, KCNV2 subunits are not able to form functional channels on their own. Also in common with these modulatory subunits, it lacks the conserved PxP motif located in the distal part of S6. In this class the motif is PIS. The alteration of the PxP motif seems to be an important determinant of the regulatory function of modulatory subunits." [PRO:CNA]
comment: Category=gene.
synonym: "KV8.2" EXACT []
synonym: "Potassium voltage-gated channel subfamily V member 2" RELATED []
synonym: "Voltage-gated potassium channel subunit Kv8.2" EXACT []
xref: PANTHER:PTHR11537\:SF40
is_a: PRO:000000685 ! voltage-gated potassium channel alpha subunit

[Term]
id: PRO:000000727
name: voltage-gated potassium channel alpha subunit KCNA4 isoform 1
def: "A voltage-gated potassium channel alpha subunit KCNA4 that is a translation product of a mature transcript of the KCNA4 gene, and that includes the potassium channel alpha subunit core domains. This form is represented by the mouse sequence UniProtKB:Q8CBF8-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000683 ! voltage-gated potassium channel alpha subunit KCNA4

[Term]
id: PRO:000000728
name: voltage-gated potassium channel subunit KCNQ1
def: "A voltage-gated potassium channel subunit KQT that is a translation product of the KCNQ1 gene." [PRO:CNA]
comment: Category=gene.
synonym: "Kcna9" EXACT []
synonym: "KV7.1" EXACT []
synonym: "KvLQT1" EXACT []
xref: PIRSF:PIRSF500964
is_a: PRO:000000684 ! voltage-gated potassium channel subunit KQT

[Term]
id: PRO:000000729
name: voltage-gated potassium channel subunit KCNQ2
def: "A voltage-gated potassium channel subunit KQT that is a translation product of the KCNQ2 gene. Most of the isoforms are generated by splicing that is restricted to a region that encodes the intracellular C-terminal domain of the channel (exons 7-16 in rat). From these, there are two main classes, one containing exon 16 in-frame, and others with an alternative splice junction in exon 14 that results in a frameshift and early termination. In addition, exons 12 and 13 have alternative splice junctions, and exons 8,11, and 15a are subject to splicing. Many members of this class can form heteromeric channels with members of the class KCNQ3 (PRO:000000730). Some forms of KCNQ2 contain two binding calmodulin binding sites and calmodulin is tethered constitutively to KCNQ channels." [PMID:11230508, PMID:12223552]
comment: Category=gene.
synonym: "KCNQ2" RELATED []
synonym: "KQT-like 2" EXACT []
synonym: "Kqt2" RELATED []
synonym: "Neuroblastoma-specific potassium channel subunit alpha KvLQT2" EXACT []
synonym: "Potassium channel subunit alpha KvLQT2" EXACT []
synonym: "Voltage-gated potassium channel subunit Kv7.2" EXACT []
xref: PIRSF:PIRSF500965
is_a: PRO:000000684 ! voltage-gated potassium channel subunit KQT

[Term]
id: PRO:000000730
name: voltage-gated potassium channel subunit KCNQ3
def: "A voltage-gated potassium channel subunit KQT that is a translation product of the KCNQ3 gene. Many members of this class can form heteromeric channels with members of the class KCNQ2 (PRO:000000729) or KCNQ5 with essentially identical properties to the channel underlying the native M-current." [PMID:10479678]
comment: Category=gene.
synonym: "Potassium voltage-gated channel subfamily KQT member 3" EXACT []
xref: PIRSF:PIRSF500966
is_a: PRO:000000684 ! voltage-gated potassium channel subunit KQT

[Term]
id: PRO:000000731
name: voltage-gated potassium channel subunit KCNQ4
def: "A voltage-gated potassium channel subunit KQT that is a translation product of the KCNQ4 gene." [PRO:CNA]
comment: Category=gene.
synonym: "Kv7.4" RELATED []
synonym: "Potassium channel subunit alpha KvLQT4" RELATED []
synonym: "Potassium voltage-gated channel subfamily KQT member 4" EXACT []
xref: PANTHER:PTHR11537\:SF4
xref: PIRSF:PIRSF500967
is_a: PRO:000000684 ! voltage-gated potassium channel subunit KQT

[Term]
id: PRO:000000732
name: voltage-gated potassium channel subunit KCNQ5
def: "A voltage-gated potassium channel subunit KQT that is a translation product of the KCNQ5 gene. It contributes to M-type potassium currents. It is also inhibited by M1 muscarinic receptor activation." [PRO:CNA]
comment: Category=gene.
synonym: "Potassium voltage-gated channel subfamily KQT member 5" EXACT []
xref: PIRSF:PIRSF500968
is_a: PRO:000000684 ! voltage-gated potassium channel subunit KQT

[Term]
id: PRO:000000737
name: cGMP-gated cation channel alpha-1 isoform 1
def: "A cGMP-gated cation channel alpha-1 that is a translation product of a mature transcript of the CNGA1 gene encoding all core domains. This form is represented by the human sequence UniProtKB:P29973-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000686 ! cGMP-gated cation channel alpha-1

[Term]
id: PRO:000000738
name: cGMP-gated cation channel alpha-1 sequence variant 1
def: "A cGMP-gated cation channel alpha-1 that is a translation product of a polymorphic sequence variant of CNGA1 gene that has a Phe residue at the position equivalent to Ser-316 in the human sequence UniProtKB:P29973-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000686 ! cGMP-gated cation channel alpha-1

[Term]
id: PRO:000000739
name: cyclic nucleotide-gated cation channel alpha-3 isoform 1
def: "A cyclic nucleotide-gated cation channel alpha-3 that is a translation product of a mature transcript of the CNGA3 gene, and that includes all core domains, and the N-terminal region coded by exons 3 and 5. This form is represented by the human sequence UniProtKB:Q16281-1. Exon nomenclature from PMID:8922401 and 10813773." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000696 ! cyclic nucleotide-gated cation channel alpha-3

[Term]
id: PRO:000000740
name: cyclic nucleotide-gated cation channel alpha-3 isoform 2
def: "A cyclic nucleotide-gated cation channel alpha-3 that is a translation product of a mature transcript of the CNGA3 gene, and that includes all core domains, but lacks the N-terminal region coded by exons 3, 5 and 6. This form is represented by sequence UniProtKB:Q9JJZ8-1 . Exon nomenclature from PMID:8922401 and 10813773." [PMID:10813773]
comment: Category=sequence.
is_a: PRO:000000696 ! cyclic nucleotide-gated cation channel alpha-3

[Term]
id: PRO:000000741
name: cyclic nucleotide-gated cation channel alpha-3 sequence variant 1
def: "A cyclic nucleotide-gated cation channel alpha-3 that is a translation product of a polymorphic sequence variant of the CNGA3 gene that has a Gln residue at the position equivalent to Arg-283 in the human sequence UniProtKB:Q16281-1. This residue is located within the segment S4." [PMID:9662398]
comment: Category=sequence.
is_a: PRO:000000696 ! cyclic nucleotide-gated cation channel alpha-3

[Term]
id: PRO:000000742
name: cyclic nucleotide-gated cation channel alpha-3 sequence variant 2
def: "A cyclic nucleotide-gated cation channel alpha-3 that is a translation product of a polymorphic sequence variant of the CNGA3 gene that has a Arg residue at the position equivalent to Thr-291 in the human sequence UniProtKB:Q16281-1. This residue is located within the segment S4." [PMID:9662398]
comment: Category=sequence.
is_a: PRO:000000696 ! cyclic nucleotide-gated cation channel alpha-3

[Term]
id: PRO:000000743
name: cyclic nucleotide-gated cation channel alpha-3 sequence variant 3
def: "A cyclic nucleotide-gated cation channel alpha-3 that is a translation product of a polymorphic sequence variant of the CNGA3 gene that has a Arg residue at the position equivalent to Gly-557 in the human sequence UniProtKB:Q16281-1. This residue is located within the cytoplasmic cyclic nucleotide binding domain (CNBD)." [PMID:9662398]
comment: Category=sequence.
is_a: PRO:000000696 ! cyclic nucleotide-gated cation channel alpha-3

[Term]
id: PRO:000000744
name: cyclic nucleotide-gated cation channel alpha-3 sequence variant 4
def: "A cyclic nucleotide-gated cation channel alpha-3 that is a translation product of a polymorphic sequence variant of the CNGA3 gene that has a Met residue at the position equivalent to Val-529 in the human sequence UniProtKB:Q16281-1. This residue is located within the cytoplasmic cyclic nucleotide binding domain (CNBD)." [PMID:9662398]
comment: Category=sequence.
is_a: PRO:000000696 ! cyclic nucleotide-gated cation channel alpha-3

[Term]
id: PRO:000000745
name: cyclic nucleotide-gated cation channel alpha-3 sequence variant 5
def: "A cyclic nucleotide-gated cation channel alpha-3 that is a translation product of a polymorphic sequence variant of the CNGA3 gene that has a Trp residue at the position equivalent to Arg-283 in the human sequence UniProtKB:Q16281-1. This residue is located within the segment S4." [PMID:9662398]
comment: Category=sequence.
is_a: PRO:000000696 ! cyclic nucleotide-gated cation channel alpha-3

[Term]
id: PRO:000000746
name: cyclic nucleotide-gated cation channel alpha-3 sequence variant 6
def: "A cyclic nucleotide-gated cation channel alpha-3 that is a translation product of a polymorphic sequence variant of the CNGA3 gene that has a Leu residue at the position equivalent to Phe-547 in the human sequence UniProtKB:Q16281-1. This residue is located within the cytoplasmic cyclic nucleotide binding domain (CNBD)." [PMID:9662398]
comment: Category=sequence.
is_a: PRO:000000696 ! cyclic nucleotide-gated cation channel alpha-3

[Term]
id: PRO:000000747
name: cyclic nucleotide-gated cation channel alpha-3 sequence variant 7
def: "A cyclic nucleotide-gated cation channel alpha-3 that is a translation product of a polymorphic sequence variant of the CNGA3 gene that has a Trp residue at the position equivalent to Arg-410 in the human sequence UniProtKB:Q16281-1. This residue is located at the cytoplasmic C-terminus." [PMID:9662398]
comment: Category=sequence.
is_a: PRO:000000696 ! cyclic nucleotide-gated cation channel alpha-3

[Term]
id: PRO:000000748
name: cyclic nucleotide-gated cation channel alpha-3 sequence variant 8
def: "A cyclic nucleotide-gated cation channel alpha-3 that is a translation product of a polymorphic sequence variant of the CNGA3 gene that has a Leu residue at the position equivalent to Pro-163 in the human sequence UniProtKB:Q16281-1." [PMID:9662398]
comment: Category=sequence.
is_a: PRO:000000696 ! cyclic nucleotide-gated cation channel alpha-3

[Term]
id: PRO:000000749
name: cyclic nucleotide-gated cation channel beta-3 isoform 1
def: "A cyclic nucleotide-gated cation channel beta-3 that is a translation product of a mature transcript of the CNGB3 gene, and that contains the core domains but lacks the C-terminal region after the cyclic nucleotide binding domain (CNBD). This form is represented by the mouse sequence UniProtKB:Q9JJZ9-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000697 ! cyclic nucleotide-gated cation channel beta-3

[Term]
id: PRO:000000750
name: cyclic nucleotide-gated cation channel beta-3 isoform 2
def: "A cyclic nucleotide-gated cation channel beta-3 that is a translation product of a mature transcript of the CNGB3 gene, A cyclic nucleotide-gated cation channel beta-3 that is a translation product of a mature transcript of the CNGB3 gene, and that contains the core domains and the extended C-terminal region after the cyclic nucleotide binding domain (CNBD), but with five missing residues within this domain as compared to isoform 3. This form is represented by the human sequence UniProtKB:Q9NQW8-2." [PMID:10888875]
comment: Category=sequence.
is_a: PRO:000000697 ! cyclic nucleotide-gated cation channel beta-3

[Term]
id: PRO:000000751
name: cyclic nucleotide-gated cation channel beta-3 isoform 3
def: "A cyclic nucleotide-gated cation channel beta-3 that is a translation product of a mature transcript of the CNGB3 gene, and that contains the core domains and the extended C-terminal region after the cyclic nucleotide binding domain (CNBD). This form is represented by the human sequence UniProtKB:Q9NQW8-1." [PMID:10958649]
comment: Category=sequence.
is_a: PRO:000000697 ! cyclic nucleotide-gated cation channel beta-3

[Term]
id: PRO:000000752
name: cyclic nucleotide-gated cation channel beta-3 sequence variant 1
def: "A cyclic nucleotide-gated cation channel beta-3 that is a translation product of a polymorphic sequence variant of the CNGB3 gene that has a Phe residue at the position equivalent to Ser-435 in the human sequence UniProtKB:Q9NQW8-1." [PMID:10958649]
comment: Category=sequence.
is_a: PRO:000000697 ! cyclic nucleotide-gated cation channel beta-3

[Term]
id: PRO:000000753
name: intermediate conductance calcium-activated potassium channel protein 4 isoform 1
def: "An intermediate conductance calcium-activated potassium channel protein 4 that is a translation product of a mature transcript of the KCNN4 gene. It contains all core domains. This form is represented by the human sequence UniProtKB:O15554-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000700 ! intermediate conductance calcium-activated potassium channel protein 4

[Term]
id: PRO:000000754
name: platelet-derived growth factor C isoform 1
def: "A platelet-derived growth factor C that is a translation product of a mature transcript of the PDGFC gene, and that includes the core domains. This form is represented by the human sequence UniProtKB:Q9NRA1-1. This form is the precursor." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000703 ! platelet-derived growth factor C

[Term]
id: PRO:000000755
name: potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 isoform 1
def: "A potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 that is a translation product of a mature transcript of the HCN1 gene encoding all core domains. This form is represented by the mouse sequence UniProtKB:O88704-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000705 ! potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1

[Term]
id: PRO:000000756
name: potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2 isoform 1
def: "A potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 that is a translation product of a mature transcript of the HCN2 gene encoding all core domains. This form is represented by the mouse sequence UniProtKB:O88703-1." [PRO:CNA]
comment: Category=sequence.
synonym: "potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2 isoform 1" EXACT []
is_a: PRO:000000706 ! potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2

[Term]
id: PRO:000000757
name: potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 3 isoform 1
def: "A potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 that is a translation product of a mature transcript of the HCN3 gene encoding all core domains. This form is represented by the mouse sequence UniProtKB:O88705-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000707 ! potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 3

[Term]
id: PRO:000000758
name: potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 isoform 1
def: "A potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 that is a translation product of a mature transcript of the HCN4 gene encoding all core domains. This form is represented by the human sequence UniProtKB:Q9Y3Q4-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000708 ! potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4

[Term]
id: PRO:000000759
name: potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 sequence variant 1
def: "A potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 that is a translation product of a polymorphic sequence variant of HCN4 gene that has an Asn residue at the position equivalent to Asp-553 in the human sequence UniProtKB:Q9Y3Q4-1." [PMID:15123648]
comment: Category=sequence.
is_a: PRO:000000708 ! potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4

[Term]
id: PRO:000000760
name: potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 sequence variant 2
def: "A potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 that is a translation product of a polymorphic sequence variant of HCN4 gene that has an Arg residue at the position equivalent to Ser-672 in the human sequence UniProtKB:Q9Y3Q4-1. This residue is located in the CNBD." [PMID:16407510]
comment: Category=sequence.
is_a: PRO:000000708 ! potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4

[Term]
id: PRO:000000761
name: small conductance calcium-activated potassium channel protein 1 isoform 1
def: "A small conductance calcium-activated potassium channel protein 1 that is a translation product of a mature transcript of the KCNN1 gene, and that includes all core domains. This form is represented by the mouse sequence UniProtKB:Q9EQR3-1, which is produced by alternative splicing events in which various combinations of the four 5' non-coding exons A, B1, B2 or C are joined directly to exon 3.2." [PRO:CNA, UniProtKB:Q9EQR3-1]
comment: Category=sequence.
is_a: PRO:000000712 ! small conductance calcium-activated potassium channel protein 1

[Term]
id: PRO:000000762
name: small conductance calcium-activated potassium channel protein 1 isoform 2
def: "A small conductance calcium-activated potassium channel protein 1 that is a translation product of a mature transcript of the KCNN1 gene, and that includes all core domains. This form is represented by the human sequence UniProtKB:Q92952-2." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000712 ! small conductance calcium-activated potassium channel protein 1

[Term]
id: PRO:000000763
name: small conductance calcium-activated potassium channel protein 1 isoform I
def: "A small conductance calcium-activated potassium channel protein 1 that is a translation product of a mature transcript of the KCNN1 gene, and that includes all core domains. This form is represented by the mouse sequence UniProtKB:Q9EQR3-2, which is produced by usage of the starting Met in exon 3.1, and includes the regions encoded by exon 7, 8, 8a and 9." [PMID:11267657]
comment: Category=sequence.
synonym: "isoform I" RELATED []
is_a: PRO:000000712 ! small conductance calcium-activated potassium channel protein 1

[Term]
id: PRO:000000764
name: small conductance calcium-activated potassium channel protein 1 isoform II
def: "A small conductance calcium-activated potassium channel protein 1 that is a translation product of a mature transcript of the KCNN1 gene, and that includes all core domains. This form is represented by the mouse sequence UniProtKB:Q9EQR3-9, which lacks the region encoded by exon 9, but includes exons 7, 8 and 8a." [PMID:11267657]
comment: Category=sequence.
is_a: PRO:000000712 ! small conductance calcium-activated potassium channel protein 1

[Term]
id: PRO:000000765
name: small conductance calcium-activated potassium channel protein 1 isoform III
def: "A small conductance calcium-activated potassium channel protein 1 that is a translation product of a mature transcript of the KCNN1 gene. It includes all core domains, but it has a distinct C-terminus. This form is represented by the mouse sequence UniProtKB:Q9EQR3-8, which lacks the region encoded by exons 8a, but includes exons 7 and 8 and 9." [PMID:11267657]
comment: Category=sequence.
is_a: PRO:000000712 ! small conductance calcium-activated potassium channel protein 1

[Term]
id: PRO:000000766
name: small conductance calcium-activated potassium channel protein 1 isoform IV
def: "A small conductance calcium-activated potassium channel protein 1 that is a translation product of a mature transcript of the KCNN1 gene. It includes all core domains, but it has a distinct C-terminus. This form is represented by the mouse sequence UniProtKB:Q9EQR3-7, which lacks the region encoded by exons 8a and 9, but includes exons 7 and 8." [PMID:11267657]
comment: Category=sequence.
is_a: PRO:000000712 ! small conductance calcium-activated potassium channel protein 1

[Term]
id: PRO:000000767
name: small conductance calcium-activated potassium channel protein 1 isoform V
def: "A small conductance calcium-activated potassium channel protein 1 that is a translation product of a mature transcript of the KCNN1 gene. The distal portion of the S6 transmembrane is modified in relation to isoform I due to the lack of an exon in the coding transcript. This form is represented by the mouse sequence UniProtKB:Q9EQR3-3, which lacks the region encoded by exon 7, but includes exons 8, 8a and 9." [PMID:11267657]
comment: Category=sequence.
is_a: PRO:000000712 ! small conductance calcium-activated potassium channel protein 1

[Term]
id: PRO:000000768
name: small conductance calcium-activated potassium channel protein 1 isoform VI
def: "A small conductance calcium-activated potassium channel protein 1 that is a translation product of a mature transcript of the KCNN1 gene, and that includes all core domains. This form is represented by the mouse sequence UniProtKB:Q9EQR3-4, which lacks the region encoded by exons 7 and 9, but includes exons 8 and 8a." [PMID:11267657, PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000712 ! small conductance calcium-activated potassium channel protein 1

[Term]
id: PRO:000000769
name: small conductance calcium-activated potassium channel protein 1 isoform VII
def: "A small conductance calcium-activated potassium channel protein 1 that is a translation product of a mature transcript of the KCNN1 gene, and that includes all core domains. This form is represented by the mouse sequence UniProtKB:Q9EQR3-5, which lacks the region encoded by exons 7 and 8a, but includes exons 8 and 9." [PMID:11267657]
comment: Category=sequence.
is_a: PRO:000000712 ! small conductance calcium-activated potassium channel protein 1

[Term]
id: PRO:000000770
name: small conductance calcium-activated potassium channel protein 1 isoform VIII
def: "A small conductance calcium-activated potassium channel protein 1 that is a translation product of a mature transcript of the KCNN1 gene, and that includes all core domains. This form is represented by the mouse sequence UniProtKB:Q9EQR3-6, which lacks the region encoded by exons 7, 8a and 9, but includes exon 8." [PMID:11267657]
comment: Category=sequence.
is_a: PRO:000000712 ! small conductance calcium-activated potassium channel protein 1

[Term]
id: PRO:000000771
name: small conductance calcium-activated potassium channel protein 2 isoform 1
def: "A small conductance calcium-activated potassium channel protein 2 that is a translation product of a mature transcript of the KCNN2 gene, and that includes the core domains. This form is represented by the human sequence UniProtKB:Q9H2S1-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000713 ! small conductance calcium-activated potassium channel protein 2

[Term]
id: PRO:000000772
name: small conductance calcium-activated potassium channel protein 2 isoform 2
def: "A small conductance calcium-activated potassium channel protein 2 that is a translation product of a mature transcript of the KCNN2 gene lacking the exons coding for the N-terminal cytoplasmic domain and most of the transmembrane segments of the calcium-activated SK potassium channel domain. This form is represented by the human sequence UniProtKB:Q6PJI0-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000713 ! small conductance calcium-activated potassium channel protein 2

[Term]
id: PRO:000000773
name: small conductance calcium-activated potassium channel protein 3 isoform 1
def: "A small conductance calcium-activated potassium channel protein 3 that is a translation product of a mature transcript of the KCNN3 gene, and that includes all core domains. Represented by the human sequence UniProtKB:Q9UGI6-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000714 ! small conductance calcium-activated potassium channel protein 3

[Term]
id: PRO:000000774
name: small conductance calcium-activated potassium channel protein 3 variant 1
def: "A small conductance calcium-activated potassium channel protein 3 that is a translation product of the KCNN3 gene with a four base deletion causing a frameshift that leads to early termination. The truncated protein lacks the transmembrane and the calmodulin binding domains. However, it conserves the two glutamine rich domains." [PMID:11395478]
comment: Category=sequence.
is_a: PRO:000000714 ! small conductance calcium-activated potassium channel protein 3

[Term]
id: PRO:000000775
name: transient receptor potential cation channel TRPC3
def: "A transient receptor potential cation channel TRPC3/6/7 that is a translation product of the TRPC3 gene." [PRO:CNA]
comment: Category=gene.
synonym: "Short transient receptor potential channel 3" EXACT []
is_a: PRO:000000718 ! transient receptor potential cation channel TRPC3/6/7

[Term]
id: PRO:000000776
name: transient receptor potential cation channel TRPV5
def: "A calcium-selective transient receptor potential cation channel TRPV that is a translation product of the TRPV5 gene." [PRO:HJD]
comment: Category=gene.
synonym: "Calcium transport protein 2" EXACT []
synonym: "CaT2" EXACT []
synonym: "ECaC" EXACT []
synonym: "ECaC1" EXACT []
synonym: "Epithelial calcium channel 1" EXACT []
synonym: "Osm-9-like TRP channel 3" EXACT []
synonym: "OTRPC3" EXACT []
synonym: "TrpV5" EXACT []
is_a: PRO:000000687 ! calcium-selective transient receptor potential cation channel TRPV

[Term]
id: PRO:000000777
name: transient receptor potential cation channel TRPV6
def: "A calcium-selective transient receptor potential cation channel TRPV that is a translation product of the TRPV6 gene." [PRO:HJD]
comment: Category=gene.
synonym: "Calcium transport protein 1" EXACT []
synonym: "CaT-L" EXACT []
synonym: "CaT-like" EXACT []
synonym: "CaT1" EXACT []
synonym: "ECaC2" EXACT []
synonym: "Epithelial calcium channel 2" EXACT []
synonym: "TrpV6" EXACT []
is_a: PRO:000000687 ! calcium-selective transient receptor potential cation channel TRPV

[Term]
id: PRO:000000778
name: voltage-gated potassium channel alpha subunit KCNA4 isoform 1 phosphorylated form
def: "A voltage-gated potassium channel alpha subunit KCNC4 isoform 1 that has been post-translationally modified to include phosphorylated residues." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000727 ! voltage-gated potassium channel alpha subunit KCNA4 isoform 1
intersection_of: has_modification MOD:00696 ! phosphorylated residue

[Term]
id: PRO:000000779
name: voltage-gated potassium channel KCNB1 isoform 1
def: "A voltage-gated potassium channel KCNB1 that is a translation product of a mature transcript of the KCNB1 gene represented by the human sequence UniProtKB:Q14721-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000722 ! voltage-gated potassium channel KCNB1

[Term]
id: PRO:000000780
name: voltage-gated potassium channel KCNB2 isoform 1
def: "A voltage-gated potassium channel KCNB2 that is a translation product of a mature transcript of the KCNB2 gene represented by the human sequence UniProtKB:Q92953-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000723 ! voltage-gated potassium channel KCNB2

[Term]
id: PRO:000000781
name: voltage-gated potassium channel KCNC1
def: "A shaw-related voltage-gated potassium channel alpha subunit that is translation product of the KCNC1 gene. They contain an ATM motif at the C-terminus, following the S6 segment that allows interaction with axonal targeting machinery when exposed." [PRO:CNA]
comment: Category=gene.
synonym: " NGK2" RELATED []
synonym: "KV3.1" RELATED []
synonym: "Potassium voltage-gated channel subfamily C member 1" EXACT []
synonym: "voltage-gated potassium channel subunit Kv3.1" RELATED []
is_a: PRO:000000711 ! shaw-related voltage-gated potassium channel alpha subunit

[Term]
id: PRO:000000782
name: voltage-gated potassium channel KCNC2
def: "A shaw-related voltage-gated potassium channel alpha subunit that is translation product of the KCNC2." [PRO:CNA]
comment: Category=gene.
synonym: "KCNC2" RELATED []
synonym: "Potassium voltage-gated channel subfamily C member 2" EXACT []
synonym: "Voltage-gated potassium channel Kv3.2" EXACT []
is_a: PRO:000000711 ! shaw-related voltage-gated potassium channel alpha subunit

[Term]
id: PRO:000000783
name: voltage-gated potassium channel KCNC4
def: "A shaw-related voltage-gated potassium channel alpha subunit that is translation product of the KCNC4." [PRO:CNA]
comment: Category=gene.
synonym: "KSHIIIC" EXACT []
synonym: "Kv3.4 " RELATED []
synonym: "Potassium voltage-gated channel subfamily C member 4" RELATED []
is_a: PRO:000000711 ! shaw-related voltage-gated potassium channel alpha subunit

[Term]
id: PRO:000000784
name: voltage-gated potassium channel KCND1
def: "A shal-related voltage-gated potassium channel that is a translation product of the KCND1 gene." [PRO:CNA]
comment: Category=gene.
synonym: "KV4.1" EXACT []
synonym: "Potassium voltage-gated channel subfamily D member 1" EXACT []
xref: PANTHER:PTHR11537\:SF15
is_a: PRO:000000710 ! shal-related voltage-gated potassium channel

[Term]
id: PRO:000000785
name: voltage-gated potassium channel KCND2
def: "A shal-related voltage-gated potassium channel that is a translation product of the KCND2 gene. Kv4.2 potassium channels play a critical role in postsynaptic excitability. They are modulated by phosphorylation as well as by association with Kv4 Channel Interacting Proteins (KChIPs). The N-terminus contains an ER retention motif RKR that seems to be masked when associated to KChiPs. This masking increases surface expression." [PMID:12829703, PRO:CNA]
comment: Category=gene.
synonym: "KV4.2" EXACT []
synonym: "Potassium voltage-gated channel subfamily D member 2" RELATED []
is_a: PRO:000000710 ! shal-related voltage-gated potassium channel

[Term]
id: PRO:000000786
name: voltage-gated potassium channel KCND3
def: "A shal-related voltage-gated potassium channel that is a translation product of the KCND3 gene. These subunits form homotetramers or heterotetramers with KCND1 and/or KCND2. Associates with the regulatory subunits KCNIP1, KCNIP2, KCNIP3 and KCNIP4." [PRO:CNA]
comment: Category=gene.
synonym: "KV4.3" EXACT []
synonym: "Potassium voltage-gated channel subfamily D member 3" RELATED []
is_a: PRO:000000710 ! shal-related voltage-gated potassium channel

[Term]
id: PRO:000000787
name: voltage-gated potassium channel KCNG1
def: "A modulatory voltage-gated potassium channel subunit KCNG that is a translation product of the KCNG1 gene." [PRO:CNA]
comment: Category=gene.
synonym: "KV6.1" RELATED []
synonym: "Potassium voltage-gated channel subfamily G member 1" EXACT []
is_a: PRO:000000701 ! modulatory voltage-gated potassium channel subunit KCNG

[Term]
id: PRO:000000788
name: voltage-gated potassium channel KCNG3
def: "A modulatory voltage-gated potassium channel subunit KCNG that is a translation product of the KCNG3 gene. It has to be associated with Kv2 subunits (PRO:000000677) or possibly another partner to get inserted in the plasma membrane. Remains intracellular in the absence of KCNB1." [PRO:CNA]
comment: Category=gene.
synonym: "KV10.1" RELATED []
synonym: "Voltage-gated potassium channel subunit Kv6.3 " EXACT []
is_a: PRO:000000701 ! modulatory voltage-gated potassium channel subunit KCNG

[Term]
id: PRO:000000789
name: voltage-gated potassium channel KCNG4
def: "A modulatory voltage-gated potassium channel subunit KCNG that is a translation product of the KCNG4 gene." [PRO:CNA]
comment: Category=gene.
synonym: "Potassium voltage-gated channel subfamily G member 4" EXACT []
synonym: "Voltage-gated potassium channel subunit Kv6.4" EXACT []
is_a: PRO:000000701 ! modulatory voltage-gated potassium channel subunit KCNG

[Term]
id: PRO:000000790
name: voltage-gated potassium channel KCNH1
def: "A voltage-gated potassium channel Eag alpha subunit that is a translation product of the KHCN1 gene." [PRO:CNA]
comment: Category=gene.
synonym: "Eag1" RELATED []
synonym: "Potassium voltage-gated channel subfamily H member 1" EXACT []
is_a: PRO:000000719 ! voltage-gated potassium channel Eag alpha subunit

[Term]
id: PRO:000000791
name: voltage-gated potassium channel KCNH2
def: "A voltage-gated potassium channel Erg alpha subunit that is a translation product of the KCNH2 gene." [PRO:CNA]
comment: Category=gene.
synonym: "ether-a-go-go-related gene protein 1" EXACT []
synonym: "potassium channel subunit Kv11.1" EXACT []
synonym: "potassium voltage-gated channel subfamily H member 2 " EXACT []
is_a: PRO:000000721 ! voltage-gated potassium channel Erg alpha subunit

[Term]
id: PRO:000000792
name: voltage-gated potassium channel KCNH3
def: "A voltage-gated potassium channel Elk alpha subunit that is a translation product of the KHCN3 gene." [PRO:CNA]
comment: Category=gene.
synonym: "Elk2" EXACT []
synonym: "kv12.2" EXACT []
synonym: "Potassium voltage-gated channel subfamily H member 3 " EXACT []
is_a: PRO:000000720 ! voltage-gated potassium channel Elk alpha subunit

[Term]
id: PRO:000000793
name: voltage-gated potassium channel KCNH4
def: "A voltage-gated potassium channel Elk alpha subunit that is a translation product of the KHCN4 gene." [PRO:CNA]
comment: Category=gene.
synonym: "potassium voltage-gated channel subfamily H member 4" EXACT []
is_a: PRO:000000720 ! voltage-gated potassium channel Elk alpha subunit

[Term]
id: PRO:000000794
name: voltage-gated potassium channel KCNH5
def: "A voltage-gated potassium channel Eag alpha subunit that is a translation product of the KHCN5 gene." [PRO:CNA]
comment: Category=gene.
synonym: "Eag2" EXACT []
synonym: "Potassium voltage-gated channel subfamily H member 5" EXACT []
is_a: PRO:000000719 ! voltage-gated potassium channel Eag alpha subunit

[Term]
id: PRO:000000795
name: voltage-gated potassium channel KCNH6
def: "A voltage-gated potassium channel Erg alpha subunit that is a translation product of the KHCN6 gene." [PRO:CNA]
comment: Category=gene.
synonym: "Erg2" EXACT []
synonym: "Ether-a-go-go-related gene potassium channel 2" EXACT []
synonym: "Kv11.2" RELATED []
is_a: PRO:000000721 ! voltage-gated potassium channel Erg alpha subunit

[Term]
id: PRO:000000796
name: voltage-gated potassium channel KCNH7
def: "A voltage-gated potassium channel Erg alpha subunit that is a translation product of the KHCN7 gene." [PRO:CNA]
comment: Category=gene.
synonym: "Eag-related protein 3" EXACT []
synonym: "HERG-3 " EXACT []
synonym: "Voltage-gated potassium channel subunit Kv11.3" EXACT []
is_a: PRO:000000721 ! voltage-gated potassium channel Erg alpha subunit

[Term]
id: PRO:000000797
name: voltage-gated potassium channel KCNH8
def: "A voltage-gated potassium channel Elk alpha subunit that is a translation product of the KHCN8 gene." [PRO:CNA]
comment: Category=gene.
synonym: "Potassium voltage-gated channel subfamily H member 8" EXACT []
is_a: PRO:000000720 ! voltage-gated potassium channel Elk alpha subunit

[Term]
id: PRO:000000798
name: voltage-gated potassium channel KCNS1
def: "A modulatory voltage-gated potassium channel subunit KCNS that is a translation product of the KCNS1 gene." [PRO:CNA]
comment: Category=gene.
synonym: "Delayed-rectifier K(+) channel alpha subunit 1" EXACT []
synonym: "KV9.1" RELATED []
synonym: "Potassium voltage-gated channel subfamily S member 1" EXACT []
is_a: PRO:000000702 ! modulatory voltage-gated potassium channel subunit KCNS

[Term]
id: PRO:000000799
name: voltage-gated potassium channel KCNS2
def: "A modulatory voltage-gated potassium channel subunit KCNS that is a translation product of the KCNS2 gene." [PRO:CNA]
comment: Category=gene.
synonym: "Delayed-rectifier K(+) channel alpha subunit 2" EXACT []
synonym: "KV9.2" EXACT []
synonym: "Potassium voltage-gated channel subfamily S member 2" EXACT []
synonym: "Voltage-gated potassium channel subunit Kv9.2" EXACT []
is_a: PRO:000000702 ! modulatory voltage-gated potassium channel subunit KCNS

[Term]
id: PRO:000000800
name: voltage-gated potassium channel KCNS3
def: "A modulatory voltage-gated potassium channel subunit KCNS that is a translation product of the KCNS3 gene." [PRO:CNA]
comment: Category=gene.
synonym: "Delayed-rectifier K(+) channel alpha subunit 3" RELATED []
synonym: "KV9.3" RELATED []
synonym: "Potassium voltage-gated channel subfamily S member 3" EXACT []
synonym: "Voltage-gated potassium channel subunit Kv9.3" RELATED []
is_a: PRO:000000702 ! modulatory voltage-gated potassium channel subunit KCNS

[Term]
id: PRO:000000801
name: voltage-gated potassium channel KCNV1 isoform 1
def: "A voltage-gated potassium channel subunit KCNV1 that is a translation product of a mature transcript of the KCNV1 gene, and that includes the potassium channel alpha subunit core domains, and the atypical S6 segment." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000725 ! voltage-gated potassium channel KCNV1

[Term]
id: PRO:000000802
name: voltage-gated potassium channel KCNV2 isoform 1
def: "A voltage-gated potassium channel KCNV2 that is a translation product of a mature transcript of the KCNV2 gene, and that contains the core domains. This form is represented by the human sequence UniProtKB:Q8TDN2-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000726 ! voltage-gated potassium channel KCNV2

[Term]
id: PRO:000000803
name: voltage-gated potassium channel KCNV2 sequence variant 1
def: "A voltage-gated potassium channel KCNV2 that is a translation product of a polymorphic sequence variant of the KCNV2 gene that has a Asp residue at the position equivalent to Gly-459 in the human sequence UniProtKB:Q8TDN2-1. This residue is located in the loop connecting segments S5 and S6." [PMID:16909397]
comment: Category=sequence.
is_a: PRO:000000726 ! voltage-gated potassium channel KCNV2

[Term]
id: PRO:000000804
name: voltage-gated potassium channel KCNV2 sequence variant 2
def: "A voltage-gated potassium channel KCNV2 that is a translation product of a polymorphic sequence variant of the KCNV2 gene that has a Val residue at the position equivalent to Ala-259 in the human sequence UniProtKB:Q8TDN2-1. This residue is located in the loop connecting segments S1 and S2." [PMID:16909397]
comment: Category=sequence.
is_a: PRO:000000726 ! voltage-gated potassium channel KCNV2

[Term]
id: PRO:000000805
name: voltage-gated potassium channel KCNV2 sequence variant 3
def: "A voltage-gated potassium channel KCNV2 that is a translation product of a polymorphic sequence variant of the KCNV2 gene that has a Gln residue at the position equivalent to Leu-126 in the human sequence UniProtKB:Q8TDN2-1. This residue is located in the cytoplasmic N-terminus." [PMID:16909397]
comment: Category=sequence.
is_a: PRO:000000726 ! voltage-gated potassium channel KCNV2

[Term]
id: PRO:000000806
name: voltage-gated potassium channel KCNV2 sequence variant 4
def: "A voltage-gated potassium channel KCNV2 that is a translation product of a sequence variant of the KCNV2 gene that has a deletion of the region corresponding to residues 339 to 341 in the human sequence UniProtKB:Q8TDN2-1. These residues are part of segment S3." [PMID:16909397]
comment: Category=sequence.
is_a: PRO:000000726 ! voltage-gated potassium channel KCNV2

[Term]
id: PRO:000000807
name: voltage-gated potassium channel KCNV2 sequence variant 5
def: "A voltage-gated potassium channel KCNV2 that is a translation product of a polymorphic sequence variant of the KCNV2 gene that has a Trp residue at the position equivalent to Ser-256 in sequence UniProtKB:Q8TDN2-1. This residue is located in the loop connecting segments S1 and S2." [PMID:16909397]
comment: Category=sequence.
is_a: PRO:000000726 ! voltage-gated potassium channel KCNV2

[Term]
id: PRO:000000808
name: voltage-gated potassium channel KCNV2 sequence variant 6
def: "A voltage-gated potassium channel KCNV2 that is a translation product of a polymorphic sequence variant of the KCNV2 gene that has a Cys residue at the position equivalent to Trp-188 in sequence UniProtKB:Q8TDN2-1. This residue is located in the loop connecting segments S1 and S2." [PMID:16909397]
comment: Category=sequence.
is_a: PRO:000000726 ! voltage-gated potassium channel KCNV2

[Term]
id: PRO:000000809
name: voltage-gated potassium channel subunit KCNA10
def: "A voltage-gated potassium channel alpha subunit that is a translation product of the KCNA10 gene. It is a subunit of the Kv1.8 channel is a delayed rectifier channel that may be involved in regulating the tone of renal vascular smooth muscle and may also participate in the cardiac action potential. It is regulated by cGMP and postulated to mediate the effects of substances that increase intracellular cGMP. It can coassemble with other Kv1 subunits." [PMID:10836990]
comment: Category=gene.
synonym: "Kv1.8" RELATED []
synonym: "Potassium voltage-gated channel subfamily A member 10" RELATED []
is_a: PRO:000000709 ! shaker-related voltage-gated potassium channel alpha subunit

[Term]
id: PRO:000000810
name: voltage-gated potassium channel subunit KCNA2
def: "A voltage-gated potassium channel alpha subunit that is a translation product of the KCNA2 gene. The Kv1.2 channel is involved in maintaining membrane potential, modulating electrical excitability in neurons and muscle. It can coassemble with other Kv1 subunits." [PMID:16382104]
comment: Category=gene.
synonym: "Kv1.2" RELATED []
synonym: "Potassium voltage-gated channel subfamily A member 2" RELATED []
is_a: PRO:000000709 ! shaker-related voltage-gated potassium channel alpha subunit

[Term]
id: PRO:000000811
name: voltage-gated potassium channel subunit KCNA3
def: "A voltage-gated potassium channel alpha subunit that is a translation product of the KCNA3 gene. The Kv1.3 channel is involved in maintaining membrane potential and calcium signaling in lymphocytes and oligodendrocytes. It can coassemble with other Kv1 subunits." [PRO:CNA]
comment: Category=gene.
synonym: "Kv1.3" RELATED []
synonym: "Potassium voltage-gated channel subfamily A member 3" RELATED []
is_a: PRO:000000709 ! shaker-related voltage-gated potassium channel alpha subunit

[Term]
id: PRO:000000812
name: voltage-gated potassium channel subunit KCNA5
def: "A voltage-gated potassium channel alpha subunit that is a translation product of the KCNA5 gene. The voltage-gated potassium channel Kv1.5 mediates the ultrarapid-activating potassium current (IKur) in heart, and also plays a critical role in the regulation of arterial tone." [PMID:10575199, PMID:16772329, PMID:18344374]
comment: Category=gene.
synonym: "HPCN1" RELATED []
synonym: "Kv1.5" RELATED []
synonym: "Potassium voltage-gated channel subfamily A member 5" EXACT []
xref: PANTHER:PTHR11537\:SF25
is_a: PRO:000000709 ! shaker-related voltage-gated potassium channel alpha subunit

[Term]
id: PRO:000000813
name: voltage-gated potassium channel subunit KCNA6
def: "A voltage-gated potassium channel alpha subunit that is a translation product of the KCNA6 gene. The Kv1.6 channel is Regulator of membrane potential in neurons. The N terminus contains an N terminus inactivation prevention domain. It can coassemble with other Kv1 subunits." [PRO:CNA]
comment: Category=gene.
synonym: "Potassium voltage-gated channel subfamily A member 6" RELATED []
is_a: PRO:000000709 ! shaker-related voltage-gated potassium channel alpha subunit

[Term]
id: PRO:000000814
name: voltage-gated potassium channel subunit KCNA7
def: "A voltage-gated potassium channel alpha subunit that is a translation product of the KCNA7 gene. The Kv1.7 channel has properties similar to the ultrarapidly activating IKur current in the heart. It can coassemble with other Kv1 subunits." [PRO:CNA]
comment: Category=gene.
synonym: "Kv1.7" RELATED []
synonym: "Potassium voltage-gated channel subfamily A member 7" RELATED []
is_a: PRO:000000709 ! shaker-related voltage-gated potassium channel alpha subunit

[Term]
id: PRO:000000815
name: voltage-gated potassium channel subunit KCNQ1 isoform 1
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a mature transcript of the KCNQ1 gene, that includes the core domains. This form is represented by the human sequence UniProtKB:P51787-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000816
name: voltage-gated potassium channel subunit KCNQ1 isoform 2
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a mature transcript of the KCNQ1 gene, that lacks the N-terminal cytoplasmic domain and the initial one-third of the first transmembrane domain. This form is represented by the human sequence UniProtKB:P51787-2. This form is not able to generate channels by itself, but can form a channel when associated with KCNE4 or the isoform 1 (PRO:000000815)." [PMID:9305853]
comment: Category=sequence.
synonym: "atKvLQT1" EXACT []
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000817
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 1
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Met residue at the position equivalent to Thr-587 in the human sequence UniProtKB:P51787-1." [PMID:10024302]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000818
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 10
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Pro residue at the position equivalent to Ser-373 in the human sequence UniProtKB:P51787-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000819
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 11
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Cys residue at the position equivalent to Arg-243 in the human sequence UniProtKB:P51787-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000820
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 12
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Asn residue at the position equivalent to Asp-317 in the human sequence UniProtKB:P51787-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000821
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 13
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has an Ile residue at the position equivalent to Val-310 in the human sequence UniProtKB:P51787-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000822
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 14
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has an Phe residue at the position equivalent to Ser-566 in the human sequence UniProtKB:P51787-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000823
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 15
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Cys residue at the position equivalent to Tyr-315 in the human sequence UniProtKB:P51787-1." [PMID:9927399]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000824
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 16
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Leu residue at the position equivalent to Ser-225 in the human sequence UniProtKB:P51787-1." [PMID:9927399]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000825
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 17
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Pro residue at the position equivalent to Ala-178 in the human sequence UniProtKB:P51787-1. This residue is located in the loop connecting segments S2 and S3." [PMID:9323054]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000826
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 18
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Thr residue at the position equivalent to Ala-178 in the human sequence UniProtKB:P51787-1. This residue is located in the loop connecting segments S2 and S3." [PMID:9024139]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000827
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 19
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has an Arg residue at the position equivalent to Gly-189 in the human sequence UniProtKB:P51787-1. This residue is located in the cytoplasmic loop connecting S2-S3." [PMID:10220144]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000828
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 2
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Arg residue at the position equivalent to Pro-448 in the human sequence UniProtKB:P51787-1. This residue is located in the cytoplasmic C-terminus." [UniProtKB_VAR:VAR_009931]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000829
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 20
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has an Arg residue at the position equivalent to Thr-309 in the human sequence UniProtKB:P51787-1. This mutation is located in the pore region between segments S5 and S6." [UniProtKB_VAR:VAR_001529.]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000830
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 21
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a His residue at the position equivalent to Arg-591 in the human sequence UniProtKB:P51787-1. This residue is located in the cytoplasmic C-terminus." [PMID:10024302]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000831
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 22
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Trp residue at the position equivalent to Arg-366 in the human sequence UniProtKB:P51787-1. This residue is located in the cytoplasmic C-terminus." [PMID:9693036]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000832
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 23
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Met residue at the position equivalent to Ile-313 in the human sequence UniProtKB:P51787-1. This mutation is located in the pore region between segments S5 and S6." [PMID:9024139]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000833
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 24
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Cys residue at the position equivalent to Tyr-111 in the human sequence UniProtKB:P51787-1. This residue is located in the cytoplasmic N-terminus." [UniProtKB_VAR:VAR_009918]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000834
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 25
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Trp residue at the position equivalent to Arg-533 in the human sequence UniProtKB:P51787-1. This residue is located in the cytoplasmic C-terminus." [PMID:10728423]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000835
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 26
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has an Arg residue at the position equivalent to Gly-168 in the human sequence UniProtKB:P51787-1. This residue is located at the end of segment S2." [PMID:9693036]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000836
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 27
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has an Asp residue at the position equivalent to Glu-261 in the human sequence UniProtKB:P51787-1. This residue is located at the end of the intracellular loop connecting segments S4 and S5." [UniProtKB_VAR:VAR_008944]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000837
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 28
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Thr residue at the position equivalent to Ala-371 in the human sequence UniProtKB:P51787-1. This residue is located in the cytoplasmic C-terminus." [UniProtKB_VAR:VAR_001544]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000838
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 29
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a sequence variant of the KCNQ1 gene that includes the deletion of the region coding for residues 71 to 73 in the human sequence UniProtKB:P51787-1." [UniProtKB_VAR:VAR_009917]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000839
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 3
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Val residue at the position equivalent to Ala-341 in the human sequence UniProtKB:P51787-1. This residue is located within the S6 segment." [PMID:8872472]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000840
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 30
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a His residue at the position equivalent to Leu-250 in the human sequence UniProtKB:P51787-1." [UniProtKB_VAR:VAR_008943]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000841
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 31
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Trp residue at the position equivalent to\nSer-349 in the human sequence UniProtKB:P51787-1." [UniProtKB_VAR:VAR_009928]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000842
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 32
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Ile residue at the position equivalent to Thr-391 in the human sequence UniProtKB:P51787-1. This residue is located in the cytoplasmic C-terminus." [PMID:10704188]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000843
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 33
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Asn residue at the position equivalent to Lys-318 in the human sequence UniProtKB:P51787-1. This mutation is located in the pore region between segments S5 and S6." [PMID:9693036]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000844
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 34
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Val residue at the position equivalent to Ala-344 in the human sequence UniProtKB:P51787-1." [PMID:10704188]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000845
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 35
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Thr residue at the position equivalent to Ala-525 in the human sequence UniProtKB:P51787-1. This residue is located in the cytoplasmic C-terminus." [PMID:10482963]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000846
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 36
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Glu residue at the position equivalent to Ala-341 in the human sequence UniProtKB:P51787-1." [PMID:10704188]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000847
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 37
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Cys residue at the position equivalent to Arg-583 in the human sequence UniProtKB:P51787-1. This residue is located in the cytoplasmic C-terminus." [PMID:10704188]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000848
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 38
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Asn residue at the position equivalent to Asp-242 in the human sequence UniProtKB:P51787-1. This residue is located within the segment S2." [PMID:10704188]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000849
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 39
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Phe residue at the position equivalent to Leu-342 in the human sequence UniProtKB:P51787-1. This residue is located within the segment S6." [PMID:10704188]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000850
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 4
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Arg residue at the position equivalent to Gly-306 in the human sequence UniProtKB:P51787-1. This mutation is located in the pore region between segments S5 and S6." [PMID:10704188]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000851
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 40
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Gly residue at the position equivalent to Ser-140 in the human sequence UniProtKB:P51787-1. This residue is located in the segment S1." [PMID:12522251]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000852
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 41
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Ser residue at the position equivalent to Gly-269 in the human sequence UniProtKB:P51787-1. This residue is located within segment S5." [PMID:10704188]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000853
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 42
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Cys residue at the position equivalent to Arg-555 in the human sequence UniProtKB:P51787-1. This residue is located in the cytoplasmic C-terminus." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000854
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 43
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Trp residue at the position equivalent to Arg-539 in the human sequence UniProtKB:P51787-1. This residue is located in the cytoplasmic C-terminus. This amino acid change affects the interaction with other channel subunits." [PMID:10728423]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000855
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 44
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Ser residue at the position equivalent to Tyr-315 in the human sequence UniProtKB:P51787-1. This mutation is located in the pore region between segments S5 and S6." [PMID:10220144]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000856
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 45
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a His residue at the position equivalent to Arg-174 in the human sequence UniProtKB:P51787-1. This residue is located in the loop between segments S2 and S3." [PMID:10367071]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000857
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 46
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Pro residue at the position equivalent to Ala-194 in the human sequence UniProtKB:P51787-1. This residue is located in the loop between segments S2 and S3." [PMID:10704188]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000858
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 47
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Ser residue at the position equivalent to Tyr-184 in the human sequence UniProtKB:P51787-1. This residue is located in the loop between segments S2 and S3." [PMID:10220144]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000859
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 48
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Glu residue at the position equivalent to Gly-345 in the human sequence UniProtKB:P51787-1. This residue is located within segment S6." [PMID:10704188]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000860
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 49
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Gln residue at the position equivalent to Arg-190 in the human sequence UniProtKB:P51787-1." [PMID:10728423]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000861
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 5
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Ile residue at the position equivalent to Thr-311 in the human sequence UniProtKB:P51787-1. This mutation is located in the pore region between segments S5 and S6." [PMID:9482580]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000862
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 50
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Ser residue at the position equivalent to Gly-314 in the human sequence UniProtKB:P51787-1. This mutation is located in the pore region between segments S5 and S6." [PMID:9693036]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000863
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 51
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Arg residue at the position equivalent to Trp-248 in the human sequence UniProtKB:P51787-1. This residue is located within segment S4. This amino acid change affects the interaction with other channel subunits." [PMID:10409658]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000864
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 52
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Pro residue at the position equivalent to Arg-366 in the human sequence UniProtKB:P51787-1. This residue is located in the cytoplasmic C-terminus." [PMID:9024139]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000865
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 53
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Gln residue at the position equivalent to Arg-366 in the human sequence UniProtKB:P51787-1. This residue is located in the cytoplasmic C-terminus." [PMID:10704188]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000866
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 54
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Lys residue at the position equivalent to Glu-160 in the human sequence UniProtKB:P51787-1. This residue is located within the segment S2." [PMID:10704188]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000867
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 55
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Met residue at the position equivalent to Val-254 in the human sequence UniProtKB:P51787-1." [PMID:10704188]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000868
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 56
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Arg residue at the position equivalent to Gly-345 in the human sequence UniProtKB:P51787-1. This residue is located within segment S6." [PMID:10220144]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000869
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 57
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Lys residue at the position equivalent to Glu-261 in the human sequence UniProtKB:P51787-1. This residue is located at the end of the intracellular loop connecting segments S4 and S5." [PMID:10409658]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000870
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 58
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Leu residue at the position equivalent to Val-307 in the human sequence UniProtKB:P51787-1. This mutation is located in the pore region between segments S5 and S6." [PMID:15159330]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000871
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 59
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a sequence variant of the KCNQ1 gene that lacks a Phe residue at the position equivalent to Phe-339 in the human sequence UniProtKB:P51787-1. This residue is located within segment S6." [PMID:9702906]
comment: Category=sequence.
synonym: "deltaF339 " RELATED []
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000872
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 6
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a His residue at the position equivalent to Arg-243 in the human sequence UniProtKB:P51787-1. This residue is located in segment S4." [PMID:10728423]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000873
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 60
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Ser residue at the position equivalent to Gly-179 in the human sequence UniProtKB:P51787-1. This residue is located in the loop connecting segments S2 and S3." [PMID:10728423]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000874
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 61
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Thr residue at the position equivalent to Ala-300 in the human sequence UniProtKB:P51787-1. This mutation is located in the pore region between segments S5 and S6." [PMID:9641694]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000875
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 62
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Cys residue at the position equivalent to Arg-174 in the human sequence UniProtKB:P51787-1. This residue is located in the loop connecting segments S2 and S3." [PMID:10704188]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000876
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 63
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Ser residue at the position equivalent to Trp-305 in the human sequence UniProtKB:P51787-1. This mutation is located in the pore region between segments S5 and S6." [PMID:9781056]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000877
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 64
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Pro residue at the position equivalent to Leu-266 in the human sequence UniProtKB:P51787-1. This residue is located within the segment S5." [PMID:10704188]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000878
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 65
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Gln residue at the position equivalent to Arg-594 in the human sequence UniProtKB:P51787-1. This residue is located in the cytoplasmic C-terminus." [PMID:10704188]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000879
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 66
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Phe residue at the position equivalent to Leu-273 in the human sequence UniProtKB:P51787-1. This residue is located within the segment S5." [PMID:9323054]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000880
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 67
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Cys residue at the position equivalent to Tyr-281 in the human sequence UniProtKB:P51787-1. This residue is located within segment S5." [PMID:9927399]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000881
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 68
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Ala residue at the position equivalent to Pro-320 in the human sequence UniProtKB:P51787-1. This mutation is located in the pore region between segments S5 and S6." [PMID:10704188]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000882
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 69
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Cys residue at the position equivalent to Phe-157 in the human sequence UniProtKB:P51787-1. This residue is located within segment S2." [PMID:10220146]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000883
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 7
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Pro residue at the position equivalent to Leu-353 in the human sequence UniProtKB:P51787-1. This residue is located in the cytoplasmic C-terminus." [PMID:9693036]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000884
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 70
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Arg residue at the position equivalent to Gly-325 in the human sequence UniProtKB:P51787-1. This mutation is located in the pore region between segments S5 and S6." [PMID:9024139]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000885
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 71
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Arg residue at the position equivalent to Trp-392 in the human sequence UniProtKB:P51787-1. This residue is located in the cytoplasmic C-terminus." [PMID:10220144]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000886
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 72
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Asp residue at the position equivalent to Gly-269 in the human sequence UniProtKB:P51787-1. This residue is located within segment S5." [PMID:10704188]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000887
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 73
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Asp residue at the position equivalent to Gly-589 in the human sequence UniProtKB:P51787-1." [PMID:10704188]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000888
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 74
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Arg residue at the position equivalent to Gly-216 in the human sequence UniProtKB:P51787-1. This residue is located within segment S2." [PMID:9272155]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000889
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 8
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Met residue at the position equivalent to Val-417 in the human sequence UniProtKB:P51787-1. This residue is located in the cytoplasmic C-terminus." [PMID:10704188]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000890
name: voltage-gated potassium channel subunit KCNQ1 sequence variant 9
def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a polymorphic sequence variant of the KCNQ1 gene that has a Ile residue at the position equivalent to Thr-312 in the human sequence UniProtKB:P51787-1. This mutation is located in the pore region between segments S5 and S6." [PMID:10409658]
comment: Category=sequence.
is_a: PRO:000000728 ! voltage-gated potassium channel subunit KCNQ1

[Term]
id: PRO:000000891
name: voltage-gated potassium channel subunit KCNQ2 isoform 1
def: "A voltage-gated potassium channel subunit KCNQ2 that is a translation product of a mature transcript of the KCNQ2 gene. It contains all the transmembrane segments and it is characterized by presence of the region encoded by exons 8-11, exons12 and 13 both with 5 prime alternative spliced site, and the absence of the region coded by exon 15a. It includes the in-frame exon 16. This form is represented by the mouse sequence UniProtKB:Q9Z351-12. Exon nomenclature is based on PMID:11230508." [PMID:11230508]
comment: Category=sequence.
synonym: "K2KL" EXACT []
is_a: PRO:000000729 ! voltage-gated potassium channel subunit KCNQ2

[Term]
id: PRO:000000892
name: voltage-gated potassium channel subunit KCNQ2 isoform 10
def: "A voltage-gated potassium channel subunit KCNQ2 that is a translation product of a mature transcript of the KCNQ2 gene, and contains all the transmembrane segments (S1-S6), but has a shorter and alternative C-terminus compare to isoform 1 due to the use of an alternative splice site that creates a frameshift. This renders a protein lacking the region coded by exons 7- 16. This form is represented by the mouse sequence UniProtKB:Q9Z351-10 with unique C-terminus sequence VSLSPC." [PMID:9666519]
comment: Category=sequence.
synonym: "MKQT2.10" RELATED []
is_a: PRO:000000729 ! voltage-gated potassium channel subunit KCNQ2

[Term]
id: PRO:000000893
name: voltage-gated potassium channel subunit KCNQ2 isoform 11
def: "A voltage-gated potassium channel subunit KCNQ2 that is a translation product of a mature transcript of the KCNQ2 gene, and contains the transmembrane segments (S1-S5), but has a shorter and alternative C-terminus compare to isoform 1 due to the use of an alternative splice site that creates a frameshift. This renders a protein with a different sequence at the end of segment S6, and lacking the C-terminus region coded by exons 7-16. This form is represented by the mouse sequence UniProtKB:Q9Z351-11." [PMID:9666519]
comment: Category=sequence.
synonym: "MKQT2.11" RELATED []
is_a: PRO:000000729 ! voltage-gated potassium channel subunit KCNQ2

[Term]
id: PRO:000000894
name: voltage-gated potassium channel subunit KCNQ2 isoform 12
def: "A voltage-gated potassium channel subunit KCNQ2 that is a translation product of a mature transcript of the KCNQ2 gene, and contains all the transmembrane segments (S1-S6). It is characterized by the absence of exon 8,and 11, the presence of the region coded by the five prime alternative spliced exons 12-13, but has a shorter and alternative C-terminus compare to isoform 1 after exon 14. This renders a protein lacking the region coded by exons 15-16. This form is represented by the mouse sequence UniProtKB:Q9Z351-2, with C-terminal sequence QEPLPVQSGHEQGPPGQNQAWHKGHQGLGD." [PRO:CNA]
comment: Category=sequence.
synonym: "MKQT2.2" RELATED []
is_a: PRO:000000729 ! voltage-gated potassium channel subunit KCNQ2

[Term]
id: PRO:000000895
name: voltage-gated potassium channel subunit KCNQ2 isoform 13
def: "A voltage-gated potassium channel subunit KCNQ2 that is a translation product of a mature transcript of the KCNQ2 gene. It contains all the transmembrane segments and it is characterized by lacking of the region encoded by exons 8, 11, an alternative exon 15, and has an alternative C-terminus compared to isoform 1. This form is represented by the mouse sequence UniProtKB:Q9Z351-3. Exon nomenclature is based on PMID:11230508." [PRO:CNA]
comment: Category=sequence.
synonym: "MKQT2.3" RELATED []
is_a: PRO:000000729 ! voltage-gated potassium channel subunit KCNQ2

[Term]
id: PRO:000000896
name: voltage-gated potassium channel subunit KCNQ2 isoform 14
def: "A voltage-gated potassium channel subunit KCNQ2 that is a translation product of a mature transcript of the KCNQ2 gene. It contains all the transmembrane segments and it is characterized by lacking of the region encoded by exons 8, 11, 15a, and has an alternative C-terminus compared to isoform 1. This form is represented by the mouse sequence UniProtKB:Q9Z351-4. Exon nomenclature is based on PMID:11230508." [PRO:CNA]
comment: Category=sequence.
synonym: "MKQT2.4" RELATED []
is_a: PRO:000000729 ! voltage-gated potassium channel subunit KCNQ2

[Term]
id: PRO:000000897
name: voltage-gated potassium channel subunit KCNQ2 isoform 15
def: "A voltage-gated potassium channel subunit KCNQ2 that is a translation product of a mature transcript of the KCNQ2 gene, and contains all the transmembrane segments (S1-S6). It is characterized by the absence of exon 8,and 11, the presence of the region coded by the five prime alternative spliced exons 12-13, but has a shorter and alternative C-terminus compare to isoform 1 after exon 14. This renders a protein lacking the region coded by exons 15-16. This form is represented by the mouse sequence UniProtKB:Q9Z351-5, with C-terminal sequence RSCDWRGVLA." [PRO:CNA]
comment: Category=sequence.
synonym: "MKQT2.5" RELATED []
is_a: PRO:000000729 ! voltage-gated potassium channel subunit KCNQ2

[Term]
id: PRO:000000898
name: voltage-gated potassium channel subunit KCNQ2 isoform 16
def: "A voltage-gated potassium channel subunit KCNQ2 that is a translation product of a mature transcript of the KCNQ2 gene, and contains all the transmembrane segments (S1-S6). It is characterized by the absence of exon 8,and 11, the presence of the region coded by the five prime alternative spliced exons 12-13, but has a shorter and alternative C-terminus compare to isoform 1 after exon 14. This renders a protein lacking the region coded by exons 15-16. This form is represented by the mouse sequence UniProtKB:Q9Z351-6, with C-terminal sequence QEPLPVQSGHEQGPPGQNQAWHKGHQGLGDRCAEQGQYQLWRSLPTLLASCCFLLCFHTVCF." [PRO:CNA]
comment: Category=sequence.
synonym: "MKQT2.6" RELATED []
is_a: PRO:000000729 ! voltage-gated potassium channel subunit KCNQ2

[Term]
id: PRO:000000899
name: voltage-gated potassium channel subunit KCNQ2 isoform 2
def: "A voltage-gated potassium channel subunit KCNQ2 that is a translation product of a mature transcript of the KCNQ2 gene. It contains all the transmembrane segments and it is characterized by presence of the region encoded by exons 8-10, exons12 and 13 both with 5 prime alternative spliced site, and the absence of the region coded by exons 11 and 15a. It includes the in-frame exon 16. This form is represented by the human sequence UniProtKB:O43526-2. Exon nomenclature is based on PMID:11230508." [PRO:CNA]
comment: Category=sequence.
synonym: "KCNQ2L" RELATED []
is_a: PRO:000000729 ! voltage-gated potassium channel subunit KCNQ2

[Term]
id: PRO:000000900
name: voltage-gated potassium channel subunit KCNQ2 isoform 3
def: "A voltage-gated potassium channel subunit KCNQ2 that is a translation product of a mature transcript of the KCNQ2 gene. It contains all the transmembrane segments and it is characterized by presence of the region encoded by exons 9-10, exons12 and 13 both with 5 prime alternative spliced site, and the absence of the region coded by exons 8, 11 and 15a. It includes the in-frame exon 16. This form is represented by the human sequence UniProtKB:O43526-3. Exon nomenclature is based on PMID:11230508." [PMID:9430594]
comment: Category=sequence.
synonym: "isoform C" RELATED []
is_a: PRO:000000729 ! voltage-gated potassium channel subunit KCNQ2

[Term]
id: PRO:000000901
name: voltage-gated potassium channel subunit KCNQ2 isoform 4
def: "A voltage-gated potassium channel subunit KCNQ2 that is a translation product of a mature transcript of the KCNQ2 gene. It contains all the transmembrane segments and it is characterized by presence of the region encoded by exons 8, 12 and 13 (both with the 3 prime splice site) and the absence of the region coded by exons 11 and 15a. It includes the in-frame exon 16. This form is represented by the human sequence UniProtKB:O43526-4. Exon nomenclature is based on PMID:11230508." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000729 ! voltage-gated potassium channel subunit KCNQ2

[Term]
id: PRO:000000902
name: voltage-gated potassium channel subunit KCNQ2 isoform 5
def: "A voltage-gated potassium channel subunit KCNQ2 that is a translation product of a mature transcript of the KCNQ2 gene. It contains all the transmembrane segments and it is characterized by lacking a short exon encoding 10 amino acids roughly 50 residues COOH-terminal from S6. It contains the region encoded by exons 8, 11, 12-13 both with 5 prime alternative spliced site, and the absence of the region coded by exon 15a. It includes the in-frame exon 16. This form is represented by the human sequence UniProtKB:O43526-5. Exon nomenclature is based on PMID:11230508." [PMID:11230508]
comment: Category=sequence.
synonym: "K2deltaKdeltaL" EXACT []
is_a: PRO:000000729 ! voltage-gated potassium channel subunit KCNQ2

[Term]
id: PRO:000000903
name: voltage-gated potassium channel subunit KCNQ2 isoform 6
def: "A voltage-gated potassium channel subunit KCNQ2 that is a translation product of a mature transcript of the KCNQ2 gene, and contains all the transmembrane segments (S1-S6), but has a shorter and alternative C-terminus compare to isoform 1 due to the use of an alternative splice site that creates a frameshift. UniProtKB:O43526-6. Inclusion of isoform 6 in heteromultimers results in attenuation of potassium current. Prominent expression of isoform 6 in the developing brain may alter firing repertoires of immature neurons excitability to provide cues for proliferation rather than differentiation." [PMID:9039501]
comment: Category=sequence.
synonym: "HNSPC" RELATED []
is_a: PRO:000000729 ! voltage-gated potassium channel subunit KCNQ2

[Term]
id: PRO:000000904
name: voltage-gated potassium channel subunit KCNQ2 isoform 7
def: "A voltage-gated potassium channel subunit KCNQ2 that is a translation product of a mature transcript of the KCNQ2 gene. It contains all the transmembrane segments and it is characterized by presence of the region encoded by exon 8, and a different and shorter C-terminal sequence after exon 10 due to the usage of an alternative splice site causing a frameshift. This C-terminal region is common to isoform 8 (PRO:000000905). This form is represented by the mouse sequence UniProtKB:Q9Z351-7." [PRO:CNA]
comment: Category=sequence.
synonym: "MKQT2.7" RELATED []
is_a: PRO:000000729 ! voltage-gated potassium channel subunit KCNQ2

[Term]
id: PRO:000000905
name: voltage-gated potassium channel subunit KCNQ2 isoform 8
def: "A voltage-gated potassium channel subunit KCNQ2 that is a translation product of a mature transcript of the KCNQ2 gene. It contains all the transmembrane segments and it is characterized by the absence of the region encoded by exon 8, and a different and shorter C-terminal sequence after exon 10 due to the usage of an alternative splice site causing a frameshift. This C-terminal region is common to isoform 7 (PRO:000000904). This form is represented by the mouse sequence UniProtKB:Q9Z351-8." [PRO:CNA]
comment: Category=sequence.
synonym: "MKQT2.8" RELATED []
is_a: PRO:000000729 ! voltage-gated potassium channel subunit KCNQ2

[Term]
id: PRO:000000906
name: voltage-gated potassium channel subunit KCNQ2 isoform 9
def: "A voltage-gated potassium channel subunit KCNQ2 that is a translation product of a mature transcript of the KCNQ2 gene, and contains all the transmembrane segments (S1-S6), but has a shorter and alternative C-terminus compare to isoform 1 due to the use of an alternative splice site that creates a frameshift. This renders a protein lacking the region coded by exons 7- 16. This form is represented by the mouse sequence UniProtKB:Q9Z351-9 with unique C-terminus sequence GQVRCAGH." [PMID:9666519]
comment: Category=sequence.
synonym: "MKQT2.9" RELATED []
is_a: PRO:000000729 ! voltage-gated potassium channel subunit KCNQ2

[Term]
id: PRO:000000907
name: voltage-gated potassium channel subunit KCNQ2 sequence variant 1
def: "A voltage-gated potassium channel subunit KCNQ2 that is a translation product of a polymorphic sequence variant of the KCNQ2 gene that has a Trp residue at the position equivalent to Ser-247 in sequence UniProtKB:O43526-1. This mutation is located within the transmembrane S5. This form reduces the current amplitude of KCNQ2 homomeric channels in a dominant-negative manner whereas the amplitude of KCNQ2/KCNQ3 heteromers is only reduced by about 40%." [PMID:12742592]
comment: Category=sequence.
is_a: PRO:000000729 ! voltage-gated potassium channel subunit KCNQ2

[Term]
id: PRO:000000908
name: voltage-gated potassium channel subunit KCNQ2 sequence variant 10
def: "A voltage-gated potassium channel subunit KCNQ2 that is a translation product of a polymorphic sequence variant of the KCNQ2 gene that has a Gln residue at the position equivalent to His-228 in sequence UniProtKB:O43526-1. This mutation is located in the intracellular loop between S4-S5." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000729 ! voltage-gated potassium channel subunit KCNQ2

[Term]
id: PRO:000000909
name: voltage-gated potassium channel subunit KCNQ2 sequence variant 2
def: "A Potassium voltage-gated channel subfamily KQT member 2 that is a translation product of a polymorphic sequence variant of the KCNQ2 gene that has a Trp residue at the position equivalent to Arg-207 in the human sequence UniProtKB:O43526-1. This mutation neutralizes a charged amino acid in the S4 voltage-sensor segment of KCNQ2. This substitution leads to a shift of voltage-dependent activation of KCNQ2 and a dramatic slowing of activation upon depolarization." [PMID:11572947]
comment: Category=sequence.
is_a: PRO:000000729 ! voltage-gated potassium channel subunit KCNQ2

[Term]
id: PRO:000000910
name: voltage-gated potassium channel subunit KCNQ2 sequence variant 3
def: "A voltage-gated potassium channel subunit KCNQ2 that is a translation product of a polymorphic sequence variant of the KCNQ2 gene that has a Phe residue at the position equivalent to Leu-243 in sequence UniProtKB:O43526-1." [PMID:14534157]
comment: Category=sequence.
is_a: PRO:000000729 ! voltage-gated potassium channel subunit KCNQ2

[Term]
id: PRO:000000911
name: voltage-gated potassium channel subunit KCNQ2 sequence variant 4
def: "A voltage-gated potassium channel subunit KCNQ2 that is a translation product of a polymorphic sequence variant of the KCNQ2 gene that change of one of the innermost Arg residues of the key functional voltage sensor (S4) region. Example: Trp residue at the position equivalent to Arg-214 in the human sequence UniProtKB:O43526-1." [PMID:11175290]
comment: Category=sequence.
is_a: PRO:000000729 ! voltage-gated potassium channel subunit KCNQ2

[Term]
id: PRO:000000912
name: voltage-gated potassium channel subunit KCNQ2 sequence variant 5
def: "A voltage-gated potassium channel subunit KCNQ2 that is a translation product of a polymorphic sequence variant of the KCNQ2 gene that has a Cys residue at the position equivalent to Tyr-284 in the human sequence UniProtKB:O43526-1. This mutation is located in the pore region and produces a reduction of wild type heteromeric currents." [PMID:9425895]
comment: Category=sequence.
is_a: PRO:000000729 ! voltage-gated potassium channel subunit KCNQ2

[Term]
id: PRO:000000913
name: voltage-gated potassium channel subunit KCNQ2 sequence variant 6
def: "A voltage-gated potassium channel subunit KCNQ2 that is a translation product of a polymorphic sequence variant of the KCNQ2 gene that has a Thr residue at the position equivalent to Ala-306 in sequence UniProtKB:O43526-1. This mutation is located in transmembrane domain S6 and causes a reduction of wild type heteromeric currents." [PMID:10788442]
comment: Category=sequence.
is_a: PRO:000000729 ! voltage-gated potassium channel subunit KCNQ2

[Term]
id: PRO:000000914
name: voltage-gated potassium channel subunit KCNQ2 sequence variant 7
def: "A voltage-gated potassium channel subunit KCNQ2 that is a translation product of a polymorphic sequence variant of the KCNQ2 gene that has a Gln residue at the position equivalent to Arg-333 in sequence UniProtKB:O43526-1. This mutation is located in the C-terminal segment." [PMID:14534157]
comment: Category=sequence.
is_a: PRO:000000729 ! voltage-gated potassium channel subunit KCNQ2

[Term]
id: PRO:000000915
name: voltage-gated potassium channel subunit KCNQ2 sequence variant 8
def: "A voltage-gated potassium channel subunit KCNQ2 that is a translation product of a polymorphic sequence variant of the KCNQ2 gene that has a Val residue at the position equivalent to Met-208 in sequence UniProtKB:O43526-1. This mutation is located in the S4 transmembrane domain and causes minor effect on maximal current but clearly exhibits a faster rate of deactivation." [PMID:14534157]
comment: Category=sequence.
is_a: PRO:000000729 ! voltage-gated potassium channel subunit KCNQ2

[Term]
id: PRO:000000916
name: voltage-gated potassium channel subunit KCNQ2 sequence variant 9
def: "A voltage-gated potassium channel subunit KCNQ2 that is a translation product of a polymorphic sequence variant of the KCNQ2 gene that has a Asn residue at the position equivalent to Lys-526 in sequence UniProtKB:O43526-3. This mutation lies within the minimum KCNQ2 sequence necessary for CaM binding." [PMID:15249611]
comment: Category=sequence.
is_a: PRO:000000729 ! voltage-gated potassium channel subunit KCNQ2

[Term]
id: PRO:000000917
name: voltage-gated potassium channel subunit KCNQ3 isoform 1
def: "A voltage-gated potassium channel subunit KCNQ3 that is a translation product of a mature transcript of the KCNQ3 gene, and that contains the core domains. This form is represented by the human sequence UniProtKB:O43525-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000730 ! voltage-gated potassium channel subunit KCNQ3

[Term]
id: PRO:000000918
name: voltage-gated potassium channel subunit KCNQ4 isoform 1
def: "A voltage-gated potassium channel subunit KCNQ4 that is a translation product of a mature transcript of the KCNQ4 gene, and that includes all core domains. This form is represented by the human sequence UniProtKB:P56696-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000731 ! voltage-gated potassium channel subunit KCNQ4

[Term]
id: PRO:000000919
name: voltage-gated potassium channel subunit KCNQ4 isoform 2
def: "A voltage-gated potassium channel subunit KCNQ4 that is a translation product of a mature transcript of the KCNQ4 gene, containing all transmembrane domains (S1-S6), but lacking at the C-terminus the region equivalent to that encoded by exon 9 in the human gene. This form is represented by UniProtKB:P56696-2." [PMID:10025409]
comment: Category=sequence.
is_a: PRO:000000731 ! voltage-gated potassium channel subunit KCNQ4

[Term]
id: PRO:000000920
name: voltage-gated potassium channel subunit KCNQ4 sequence variant 1
def: "A voltage-gated potassium channel subunit KCNQ4 that is a translation product of a polymorphic sequence variant of the KCNQ4 gene that has a Cys residue replacing the first Gly in the conserved selectivity filter sequence GYGD in the pore region of the human sequence UniProtKB:P56696-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000731 ! voltage-gated potassium channel subunit KCNQ4

[Term]
id: PRO:000000921
name: voltage-gated potassium channel subunit KCNQ4 sequence variant 2
def: "A voltage-gated potassium channel subunit KCNQ4 that is a translation product of a polymorphic sequence variant of the KCNQ4 gene that has a His residue at the position equivalent to Leu-274 in the human sequence UniProtKB:P56696-1. This residue is located in the pore region located between segments S5 and S6." [PMID:10925378]
comment: Category=sequence.
is_a: PRO:000000731 ! voltage-gated potassium channel subunit KCNQ4

[Term]
id: PRO:000000922
name: voltage-gated potassium channel subunit KCNQ4 sequence variant 3
def: "A voltage-gated potassium channel subunit KCNQ4 that is a translation product of a polymorphic sequence variant of the KCNQ4 gene that has a Cys residue replacing the first Gly in the conserved selectivity filter sequence GYGD in the pore region of the human sequence UniProtKB:P56696-1." [PMID:10025409]
comment: Category=sequence.
is_a: PRO:000000731 ! voltage-gated potassium channel subunit KCNQ4

[Term]
id: PRO:000000923
name: voltage-gated potassium channel subunit KCNQ4 sequence variant 4
def: "A voltage-gated potassium channel subunit KCNQ4 that is a translation product of a polymorphic sequence variant of the KCNQ4 gene that has a Ser residue at the position equivalent to Leu-281 in sequence UniProtKB:P56696-1. This residue is located in the pore region located between segments S5 and S6." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000731 ! voltage-gated potassium channel subunit KCNQ4

[Term]
id: PRO:000000924
name: voltage-gated potassium channel subunit KCNQ4 sequence variant 5
def: "A voltage-gated potassium channel subunit KCNQ4 that is a translation product of a polymorphic sequence variant of the KCNQ4 gene that has a Ser residue at the position equivalent to Trp-276 in sequence UniProtKB:P56696-1. This residue is located in the pore region located between segments S5 and S6." [PMID:10369879]
comment: Category=sequence.
is_a: PRO:000000731 ! voltage-gated potassium channel subunit KCNQ4

[Term]
id: PRO:000000925
name: voltage-gated potassium channel subunit KCNQ4 sequence variant 6
def: "A voltage-gated potassium channel subunit KCNQ4 that is a translation product of a polymorphic sequence variant of the KCNQ4 gene that has a Ser residue at the position equivalent to Gly-321 in sequence UniProtKB:P56696-1." [PMID:10369879]
comment: Category=sequence.
is_a: PRO:000000731 ! voltage-gated potassium channel subunit KCNQ4

[Term]
id: PRO:000000926
name: voltage-gated potassium channel subunit KCNQ5 isoform 1
def: "A voltage-gated potassium channel subunit KCNQ5 that is a translation product of a mature transcript of the KCNQ5 gene represented by the human sequence UniProtKB:Q9NR82-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000732 ! voltage-gated potassium channel subunit KCNQ5

[Term]
id: PRO:000000927
name: voltage-gated potassium channel subunit KCNQ5 isoform 2
def: "A voltage-gated potassium channel subunit KCNQ5 that is a translation product of a mature transcript of the KCNQ5 gene represented by the human sequence UniProtKB:Q9NR82-2." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000732 ! voltage-gated potassium channel subunit KCNQ5

[Term]
id: PRO:000000928
name: voltage-gated potassium channel subunit KCNQ5 isoform 3
def: "A voltage-gated potassium channel subunit KCNQ5 that is a translation product of a mature transcript of the KCNQ5 gene represented by the human sequence UniProtKB:Q9NR82-3. This isoform displays altered gating kinetics." [PMID:10816588, PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000732 ! voltage-gated potassium channel subunit KCNQ5

[Term]
id: PRO:000000929
name: voltage-gated potassium channel subunit KCNQ5 isoform 4
def: "A voltage-gated potassium channel subunit KCNQ5 that is a translation product of the mature transcript of KCNQ5 gene, and lacks the C-terminal KCNQ voltage-gated potassium channel domain. This form is represented by the human sequence UniProtKB:Q9NR82-4." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000732 ! voltage-gated potassium channel subunit KCNQ5

[Term]
id: PRO:000000932
name: cGMP-gated cation channel alpha-1 isoform 1 phosphorylated form
def: "A cGMP-gated cation channel alpha-1 isoform 1 that has been post-translationally modified to include phosphorylated residues." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000737 ! cGMP-gated cation channel alpha-1 isoform 1
intersection_of: has_modification MOD:00696 ! phosphorylated residue

[Term]
id: PRO:000000933
name: platelet-derived growth factor C isoform 1 cleaved form
def: "A platelet-derived growth factor C isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000754 ! platelet-derived growth factor C isoform 1
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000000934
name: platelet-derived growth factor C isoform 1 sumoylated form
def: "A platelet-derived growth factor C isoform 1 that has been post-translationally modified to include sumoylated residues." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000754 ! platelet-derived growth factor C isoform 1
intersection_of: has_modification MOD:01149 ! sumoylated lysine

[Term]
id: PRO:000000935
name: potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 isoform 1 glycosylated form
def: "A potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 isoform 1 that has been post-translationally modified to include glycosylated residues." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000755 ! potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 isoform 1
intersection_of: has_modification MOD:00693 ! glycosylated residue

[Term]
id: PRO:000000936
name: potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2 isoform 1 glycosylated form
def: "A potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2 isoform 1 that has been post-translationally modified to include glycosylated residues." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000756 ! potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2 isoform 1
intersection_of: has_modification MOD:00693 ! glycosylated residue

[Term]
id: PRO:000000937
name: transient receptor potential cation channel TRPC3 isoform 1
def: "A transient receptor potential cation channel TRPC3 that is a translation product of a mature transcript of the TRPC3 gene, and that includes the core domains. This form is represented by the human sequence UniProtKB:Q13507-1." [PRO:HJD]
comment: Category=sequence.
is_a: PRO:000000775 ! transient receptor potential cation channel TRPC3

[Term]
id: PRO:000000938
name: voltage-gated potassium channel alpha subunit KCNA4 isoform 1 phosphorylated 1
def: "A voltage-gated potassium channel alpha subunit KCNA4 isoform 1 phosphorylated for with has been phosphorylated at the Ser residue located at the N-terminal Glu rich sequence ELSEEEEDEEEEEEEEEEGR. Example:UniProtKB:Q8CBF8-1, has_modification MOD:00046 O-phospho-L-serine, Ser-122." [PMID:18056256]
comment: Category=modification.
is_a: PRO:000000778 ! voltage-gated potassium channel alpha subunit KCNA4 isoform 1 phosphorylated form

[Term]
id: PRO:000000939
name: voltage-gated potassium channel KCNC1 isoform 1
def: "A voltage-gated potassium channel KCNC1 that is a translation product of a mature transcript of the KCNC1 gene, and that includes the core domains and a short C-terminal tail. This form is represented by the human sequence UniProtKB:P48547-1." [PRO:CNA]
comment: Category=sequence.
synonym: "Kv3.1a" RELATED []
is_a: PRO:000000781 ! voltage-gated potassium channel KCNC1

[Term]
id: PRO:000000940
name: voltage-gated potassium channel KCNC1 isoform 2
def: "A voltage-gated potassium channel KCNC1 that is a translation product of a mature transcript of the KCNC1 gene, and that includes the core domains and the longest C-terminal tail compare to isoform 1. This form is represented by the rat sequence UniProtKB:P25122-1." [PRO:CNA]
comment: Category=sequence.
synonym: "Kv3.1b" EXACT []
is_a: PRO:000000781 ! voltage-gated potassium channel KCNC1

[Term]
id: PRO:000000941
name: voltage-gated potassium channel KCNC2 isoform 1
def: "A voltage-gated potassium channel KCNC2 that is a translation product of a mature transcript of the KCNC2 gene, and that includes the core domains. This form is represented by the rat sequence UniProtKB:P22462-1." [PMID:1879548]
comment: Category=sequence.
synonym: "KV3.2B" EXACT []
is_a: PRO:000000782 ! voltage-gated potassium channel KCNC2

[Term]
id: PRO:000000942
name: voltage-gated potassium channel KCNC2 isoform 2
def: "A voltage-gated potassium channel KCNC2 that is a translation product of a mature transcript of the KCNC2 gene, and that includes the core domains, but includes an alternative 3' exon coding region at the C-terminus compared to isoform 1. This form is represented by the human sequence UniProtKB:Q96PR1-2." [PRO:CNA]
comment: Category=sequence.
synonym: "Kv3.2d" RELATED []
is_a: PRO:000000782 ! voltage-gated potassium channel KCNC2

[Term]
id: PRO:000000943
name: voltage-gated potassium channel KCNC2 isoform 3
def: "A voltage-gated potassium channel KCNC2 that is a translation product of a mature transcript of the KCNC2 gene, and that includes the core domains, but includes an alternative 3' exon coding region at the C-terminus compared to isoform 1. This form is represented by the human sequence UniProtKB:Q96PR1-3." [PRO:CNA]
comment: Category=sequence.
synonym: "KV3..2a" EXACT []
synonym: "RKShIIIA" RELATED []
is_a: PRO:000000782 ! voltage-gated potassium channel KCNC2

[Term]
id: PRO:000000944
name: voltage-gated potassium channel KCNC2 isoform 4
def: "A voltage-gated potassium channel KCNC2 that is a translation product of a mature transcript of the KCNC2 gene, and that includes the core domains, but includes an alternative 3' exon coding region at the C-terminus compared to isoform 1. This form lacks a region of around 80 residues at the C-terminus. This form is represented by the human sequence UniProtKB:Q96PR1-4." [PRO:CNA]
comment: Category=sequence.
synonym: "Kv3.2c" EXACT []
is_a: PRO:000000782 ! voltage-gated potassium channel KCNC2

[Term]
id: PRO:000000945
name: voltage-gated potassium channel KCNC4 isoform 1
def: "A voltage-gated potassium channel KCNC4 that is a translation product of a mature transcript of the KCNC4 gene, and that contains the core domains. This form is represented by the human sequence UniProtKB:Q03721-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000783 ! voltage-gated potassium channel KCNC4

[Term]
id: PRO:000000946
name: voltage-gated potassium channel KCNC4 isoform 2
def: "A voltage-gated potassium channel KCNC4 that is a translation product of a mature transcript of the KCNC4 gene, and that includes the core domains but has a shorter C-terminal cytoplasmic tail as compared to isoform 1. This form is represented by the human sequence UniProtKB:Q03721-2." [PMID:1381835]
comment: Category=sequence.
is_a: PRO:000000783 ! voltage-gated potassium channel KCNC4

[Term]
id: PRO:000000947
name: voltage-gated potassium channel KCND2 isoform 1
def: "A voltage-gated potassium channel subunit KCND2 that is a translation product of a mature transcript of the KCND2 gene, and that includes the potassium channel alpha subunit core domains." [PRO:CNA]
comment: Category=sequence.
synonym: "Kv4.2" EXACT []
is_a: PRO:000000785 ! voltage-gated potassium channel KCND2

[Term]
id: PRO:000000948
name: voltage-gated potassium channel KCND3 isoform 1
def: "A voltage-gated potassium channel subunit KCND3 that is a translation product of a mature transcript of the KCND3 gene, with carboxyl-terminal splicing that inserts 19 amino acids with a consensus protein kinase C (PKC) phosphorylation site after the last membrane-spanning segment. This form is downregulated by PKC activation. This form is represented by the human sequence UniProtKB:Q9UK17-1." [PMID:9843794]
comment: Category=sequence.
synonym: "KCND3L" RELATED []
synonym: "Kv4.3-L" RELATED []
synonym: "long isoform" RELATED []
is_a: PRO:000000786 ! voltage-gated potassium channel KCND3

[Term]
id: PRO:000000949
name: voltage-gated potassium channel KCND3 isoform 2
def: "A voltage-gated potassium channel subunit KCND3 that is a translation product of a mature transcript of the KCND3 gene, and that includes the core domains for the voltage-gated potassium channel alpha subunits. This forms lacks the consensus protein kinase C (PKC) phosphorylation site after the last membrane-spanning segment, which is present in Isoform 2. This form is represented by the human sequence UniProtKB:Q9UK17-2." [PMID:9843794]
comment: Category=sequence.
synonym: "KCND3S" RELATED []
is_a: PRO:000000786 ! voltage-gated potassium channel KCND3

[Term]
id: PRO:000000950
name: voltage-gated potassium channel KCNG1 isoform 1
def: "A voltage-gated potassium channel KCNG1 that is a translation product of a mature transcript of the KCNG1 gene, and that includes the core domains. This form is represented by the human sequence UniProtKB:Q9UIX4-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000787 ! voltage-gated potassium channel KCNG1

[Term]
id: PRO:000000951
name: voltage-gated potassium channel KCNG1 isoform 2
def: "A voltage-gated potassium channel KCNG1 that is a translation product of the mature transcript of KCNG1 gene, and lacks the Ion transport protein domain. This form is represented by the human sequence UniProtKB:Q9UIX4-2." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000787 ! voltage-gated potassium channel KCNG1

[Term]
id: PRO:000000952
name: voltage-gated potassium channel KCNG3 isoform 1
def: "A Potassium voltage-gated channel subfamily G member 3 that is a translation product of a mature transcript of the KCNG3 gene, and arise by the usage of an alternative site of splicing in exon 1 producing an 11-amino acid insertion in the linker between the first and second transmembrane domains. This form is represented by the human sequence UniProtKB:Q8TAE7-1." [PMID:15046870]
comment: Category=sequence.
synonym: "KV10.1b" RELATED []
is_a: PRO:000000788 ! voltage-gated potassium channel KCNG3

[Term]
id: PRO:000000953
name: voltage-gated potassium channel KCNG3 isoform 2
def: "A voltage-gated potassium channel KCNG3 that is a translation product of a mature transcript of the KCNG3 gene, including all core domains. This form is represented by the human sequence UniProtKB:Q8TAE7-2." [PRO:CNA]
comment: Category=sequence.
synonym: "Kv10.1a" RELATED []
is_a: PRO:000000788 ! voltage-gated potassium channel KCNG3

[Term]
id: PRO:000000954
name: voltage-gated potassium channel KCNG4 isoform 1
def: "A Potassium voltage-gated channel subfamily G member 4 that is a translation product of a mature transcript of the KCNG4 gene, and that includes all core domains. This form is represented by the human sequence UniProtKB:Q8TDN1-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000789 ! voltage-gated potassium channel KCNG4

[Term]
id: PRO:000000955
name: voltage-gated potassium channel KCNH1 isoform 1
def: "A voltage-gated potassium channel KCNH1 that is a translation product of a mature transcript of the KCNH1 gene, and that lacks most of the loop region between segment S3 and S4. This form is represented by the human sequence UniProtKB:O95259-2." [PRO:CNA]
comment: Category=sequence.
synonym: "Eag1" RELATED []
is_a: PRO:000000790 ! voltage-gated potassium channel KCNH1

[Term]
id: PRO:000000956
name: voltage-gated potassium channel KCNH1 isoform 2
def: "A voltage-gated potassium channel KCNH1 that is a translation product of a mature transcript of the KCNH1 gene, with an additional sequence of approximately 27 aminoacids in the region between segments S3 and S4. This form is represented by the human sequence UniProtKB:O95259-1." [PRO:CNA]
comment: Category=sequence.
synonym: "EAGb" RELATED []
is_a: PRO:000000790 ! voltage-gated potassium channel KCNH1

[Term]
id: PRO:000000957
name: voltage-gated potassium channel KCNH2 isoform 1
def: "A voltage-gated potassium channel KCNH2 that is a translation product of a mature transcript of the KCNH2 gene, and that contains all core domains. This form is represented by the human sequence UniProtKB:Q12809-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000791 ! voltage-gated potassium channel KCNH2

[Term]
id: PRO:000000958
name: voltage-gated potassium channel KCNH2 isoform 2
def: "A voltage-gated potassium channel KCNH2 that is a translation product of a mature transcript of the KCNH2 gene, and that lacks most of the cytoplasmic N-terminal domain, including the PAS domain, due to the usage of an alternative exon 1 (1b) that excludes the region coded by exons 2 to 5. This form is represented by the mouse sequence UniProtKB:O35219-3. This form has rapid deactivation kinetics. Exon nomenclature from PMID:9351462." [PMID:9351446, PMID:9351462]
comment: Category=sequence.
synonym: "ERG1b" EXACT []
is_a: PRO:000000791 ! voltage-gated potassium channel KCNH2

[Term]
id: PRO:000000959
name: voltage-gated potassium channel KCNH2 isoform 3
def: "A voltage-gated potassium channel KCNH2 that is a translation product of a mature transcript of the KCNH2 gene, and that lacks a C-terminal domain required for expression of rapidly activating delayed rectifier current. This form appears to be partially made up of sequences encoded by regions previously thought to be intronic located between exons 9 and 10. This form is represented by the human sequence UniProtKB:Q12809-3. Exon nomenclature from PMID:9351462." [PMID:9765245]
comment: Category=sequence.
synonym: "ERG USO" RELATED []
is_a: PRO:000000791 ! voltage-gated potassium channel KCNH2

[Term]
id: PRO:000000960
name: voltage-gated potassium channel KCNH2 isoform 4
def: "A voltage-gated potassium channel KCNH2 that is a translation product of a mature transcript of the KCNH2 gene, and that lacks an N-terminal region of approximately 59 residues due to the usage of an alternative exon 1 (exon 1a'). This form lacks most of the PAS domain. This form is represented by the mouse sequence UniProtKB:O35219-2. This form has rapid deactivation kinetics. Exon nomenclature from PMID:9351462." [PMID:9351462]
comment: Category=sequence.
synonym: "erg1a'" EXACT []
is_a: PRO:000000791 ! voltage-gated potassium channel KCNH2

[Term]
id: PRO:000000961
name: voltage-gated potassium channel KCNH3 isoform 1
def: "A voltage-gated potassium channel KCNH3 that is a translation product of a mature transcript of the KCNH3 gene, and that includes all core domains. This form is represented by the human sequence UniProtKB:Q9ULD8-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000792 ! voltage-gated potassium channel KCNH3

[Term]
id: PRO:000000962
name: voltage-gated potassium channel KCNH4 isoform 1
def: "A voltage-gated potassium channel KCNH4 that is a translation product of a mature transcript of the KCNH4 gene, and that includes all core domains. This form is represented by the human sequence UniProtKB:Q9UQ05-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000793 ! voltage-gated potassium channel KCNH4

[Term]
id: PRO:000000963
name: voltage-gated potassium channel KCNH5 isoform 1
def: "A voltage-gated potassium channel KCNH5 that is a translation product of a mature transcript of the KCNH5 gene, and that includes all core domains. This form is represented by the human sequence UniProtKB:Q8NCM2-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000794 ! voltage-gated potassium channel KCNH5

[Term]
id: PRO:000000964
name: voltage-gated potassium channel KCNH5 isoform 2
def: "A voltage-gated potassium channel KCNH5 that is a translation product of a mature transcript of the KCNH5 gene which lacks an exon in the coding region, which results in a frameshift and an early stop codon, as compared to isoform 1. This results in a shorter form that is truncated within the cyclic nucleotide binding domain. The truncated region also includes the calmodulin-binding region, and is represented by the human sequence UniProtKB:Q8NCM2-2." [PRO:CNA, Refseq:NP_758963]
comment: Category=sequence.
synonym: "HEAG2b" EXACT []
is_a: PRO:000000794 ! voltage-gated potassium channel KCNH5

[Term]
id: PRO:000000965
name: voltage-gated potassium channel KCNH5 isoform 3
def: "A voltage-gated potassium channel KCNH5 that is a translation product of a mature transcript of the KCNH5 gene that has alternate 5' and 3' ends, as compared to variant 1. It uses a downstream in-frame start codon and an alternate stop codon, resulting in an isoform that has a shorter N-terminus and a distinct C-terminus, as compared to isoform 1. This form is represented by the human sequence UniProtKB:Q8NCM2-3." [PRO:CNA, Refseq:NP_758964]
comment: Category=sequence.
is_a: PRO:000000794 ! voltage-gated potassium channel KCNH5

[Term]
id: PRO:000000966
name: voltage-gated potassium channel KCNH6 isoform 1
def: "A voltage-gated potassium channel KCNH6 that is a translation product of a mature transcript of the KCNH6 gene, and that contains the core domains. This form is represented by the human sequence UniProtKB:Q9H252-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000795 ! voltage-gated potassium channel KCNH6

[Term]
id: PRO:000000967
name: voltage-gated potassium channel KCNH6 isoform 2
def: "A voltage-gated potassium channel KCNH6 that is a translation product of a mature transcript of the KCNH6 gene that lacks two in-frame segments in the coding region, rendering a protein shorter than isoform 1.  It lacks the loop region connecting segments S5 and S6, and a region consisting of around 38 residues following the cytoplasmic cyclic nucleotide binding domain. This form is represented by the human sequence UniProtKB:Q9H252-2." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000795 ! voltage-gated potassium channel KCNH6

[Term]
id: PRO:000000968
name: voltage-gated potassium channel KCNH6 isoform 3
def: "A voltage-gated potassium channel KCNH6 that is a translation product of a mature transcript of the KCNH6 gene, that lacks the region coding for the C-terminus of the protein including part of the segment S6 and the cyclic nucleotide-binding domain, rendering a truncated protein compared to isoform 1. This form is represented by the human sequence UniProtKB:Q9H252-3." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000795 ! voltage-gated potassium channel KCNH6

[Term]
id: PRO:000000969
name: voltage-gated potassium channel KCNS1 isoform 1
def: "A voltage-gated potassium channel KCNS1 that is a translation product of a mature transcript of the KCNS1 gene, and that includes the core domains. This form is represented by the human sequence UniProtKB:Q96KK3-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000798 ! voltage-gated potassium channel KCNS1

[Term]
id: PRO:000000970
name: voltage-gated potassium channel KCNS2 isoform 1
def: "A voltage-gated potassium channel KCNS2 that is a translation product of a mature transcript of the KCNS2 gene, and that includes the core domains. This form is represented by the mouse sequence UniProtKB:O35174-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000799 ! voltage-gated potassium channel KCNS2

[Term]
id: PRO:000000971
name: voltage-gated potassium channel subunit KCNA10 isoform 1
def: "A voltage-gated potassium channel subunit KCNA10 that is a translation product of a mature transcript of the KCNA10 gene, and that includes the potassium channel alpha subunit core domains. This form is represented by the human sequence UniProtKB:Q16322-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000809 ! voltage-gated potassium channel subunit KCNA10

[Term]
id: PRO:000000972
name: voltage-gated potassium channel subunit KCNA2 isoform 1
def: "A voltage-gated potassium channel subunit KCNA2 that is a translation product of a mature transcript of the KCNA2 gene, and that includes the potassium channel alpha subunit core domains. This form is represented by the human UniProtKB:P16389-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000810 ! voltage-gated potassium channel subunit KCNA2

[Term]
id: PRO:000000973
name: voltage-gated potassium channel subunit KCNA3 isoform 1
def: "A voltage-gated potassium channel subunit KCNA3 that is a translation product of a mature transcript of the KCNA3 gene, and that includes the potassium channel alpha subunit core domains. This form is represented by the human sequence UniProtKB:P22001-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000811 ! voltage-gated potassium channel subunit KCNA3

[Term]
id: PRO:000000974
name: voltage-gated potassium channel subunit KCNA5 isoform 1
def: "A voltage-gated potassium channel subunit KCNA5 that is a translation product of a mature transcript of the KCNA5 gene, and that includes the potassium channel alpha subunit core domains." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000812 ! voltage-gated potassium channel subunit KCNA5

[Term]
id: PRO:000000975
name: voltage-gated potassium channel subunit KCNA5 isoform 2
def: "A voltage-gated potassium channel subunit KCNA5 that is a translation product of a mature transcript of the KCNA5 gene, and that lacks the N terminus tetramerization domain." [PMID:11524461, PMID:8226976]
comment: Category=sequence.
synonym: "Kv1-5delta5'" RELATED []
synonym: "voltage-gated potassium channel subfamily A member 5 isoform 2" RELATED []
is_a: PRO:000000812 ! voltage-gated potassium channel subunit KCNA5

[Term]
id: PRO:000000976
name: voltage-gated potassium channel subunit KCNA5 isoform 3
def: "A voltage-gated potassium channel subunit KCNA5 that is a translation product of a mature transcript of the KCNA5 gene, and that lacks the C terminus intracellular part." [PMID:8226976]
comment: Category=sequence.
synonym: "Kv1-5delta3'" RELATED []
synonym: "voltage-gated potassium channel subfamily A member 5 isoform 3" RELATED []
is_a: PRO:000000812 ! voltage-gated potassium channel subunit KCNA5

[Term]
id: PRO:000000977
name: voltage-gated potassium channel subunit KCNA5 sequence variant 1
def: "A voltage-gated potassium channel subunit Kv1.5 that is a translation product of a polymorphic sequence variant of KCNA5 gene, and that generates a C terminal truncated variant lacking the S4-S6 voltage sensor, pore region and C terminus, but preserves the N terminus and S1-S3 transmembrane domains that secure tetrameric subunit assembly. Example: UniProtKB:P22460-1 (1-374)." [PMID:16772329]
comment: Category=sequence.
is_a: PRO:000000812 ! voltage-gated potassium channel subunit KCNA5

[Term]
id: PRO:000000978
name: voltage-gated potassium channel subunit KCNA6 isoform 1
def: "A voltage-gated potassium channel subunit KCNA6 that is a translation product of a mature transcript of the KCNA6 gene, and that includes the potassium channel alpha subunit core domains." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000813 ! voltage-gated potassium channel subunit KCNA6

[Term]
id: PRO:000000979
name: voltage-gated potassium channel subunit KCNA7 isoform 1
def: "A voltage-gated potassium channel subunit KCNA7 that is a translation product of a mature transcript of the KCNA7 gene, and that includes the potassium channel alpha subunit core domains plus an additional N terminal sequence with a Hx20CxCC motif resembling a metal coordination motif. This N terminus appears to be a key component in the redox sensitivity of Kv1.7 channel inactivation. This form contributes to channels that inactivate fast and are sensitive to redox modulation. This form is represented by the mouse sequence UniProtKB:Q17ST2-1." [PRO:CNA]
comment: Category=sequence.
synonym: "Kv1.7L" RELATED []
synonym: "Potassium voltage-gated channel subfamily A member 7 isoform 1" RELATED []
is_a: PRO:000000814 ! voltage-gated potassium channel subunit KCNA7

[Term]
id: PRO:000000980
name: voltage-gated potassium channel subunit KCNA7 isoform 2
def: "A voltage-gated potassium channel subunit KCNA7 that is a translation product of a mature transcript of the KCNA7 gene, and that includes the potassium channel alpha subunit core domains. This form is represented by the mouse sequence UniProtKB:Q17ST2-2. This form contributes to channels that are slow-inactivating and redox-insensitive." [PRO:CNA]
comment: Category=sequence.
synonym: "Kv1.7S" RELATED []
is_a: PRO:000000814 ! voltage-gated potassium channel subunit KCNA7

[Term]
id: PRO:000000981
name: cGMP-gated cation channel alpha-1 isoform 1 phosphorylated 1
def: "A cGMP-gated cation channel alpha-1 isoform 1 phosphorylated form that has been phosphorylated at a Tyr residue within VYSPGD motif located at the N-terminus of the cyclic-nucleotide binding domain (CNDB). This phosphorylation prevents Ca2+/CaM inhibition of the CNG channel, but at the same time has a similar effect, that is decreases the apparent affinity for cGMP." [PMID:10366613, PMID:14602825]
comment: Category=modification.
is_a: PRO:000000932 ! cGMP-gated cation channel alpha-1 isoform 1 phosphorylated form

[Term]
id: PRO:000000982
name: platelet-derived growth factor C isoform 1 cleaved 1
def: "A platelet-derived growth factor C isoform 1 cleaved form whose signal peptide and CUB domain have been removed." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000000933 ! platelet-derived growth factor C isoform 1 cleaved form

[Term]
id: PRO:000000983
name: platelet-derived growth factor C isoform 1 sumoylated 1
def: "A platelet-derived growth factor C isoform 1 sumoylated form sumoylated by SUMO1." [PMID:16443219]
comment: Category=modification.
is_a: PRO:000000934 ! platelet-derived growth factor C isoform 1 sumoylated form

[Term]
id: PRO:000000984
name: potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 isoform 1 glycosylated 1
def: "A potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 isoform 1 glycosylated form with glycosylation at the N-linked glycosylation consensus sequence (Nx[ST]) in the extracellular domain between S5 and S6 transmembrane segments." [PMID:17988239]
comment: Category=modification.
is_a: PRO:000000935 ! potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 isoform 1 glycosylated form

[Term]
id: PRO:000000985
name: potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2 isoform 1 glycosylated 1
def: "A potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2 isoform 1 glycosylated form with glycosylation at the N-linked glycosylation consensus sequence (Nx[ST]) in the extracellular domain between S5 and S6 transmembrane segments. Example: UniProtKB:O88703-1, has_modification MOD:00006 N-glycosylated residue, Asn-380." [PMID:12928435]
comment: Category=modification.
is_a: PRO:000000936 ! potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2 isoform 1 glycosylated form

[Term]
id: PRO:000000986
name: voltage-gated potassium channel KCNC1 isoform 2 phosphorylated form
def: "A voltage-gated potassium channel KCNC1 isoform 2 that has been post-translationally modified to include phosphorylated residues." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000940 ! voltage-gated potassium channel KCNC1 isoform 2
intersection_of: has_modification MOD:00696 ! phosphorylated residue

[Term]
id: PRO:000000987
name: voltage-gated potassium channel KCNC4 isoform 2 phosphorylated form
def: "A voltage-gated potassium channel KCNC4 isoform 2 that has been post-translationally modified to include phosphorylated residues." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000946 ! voltage-gated potassium channel KCNC4 isoform 2
intersection_of: has_modification MOD:00696 ! phosphorylated residue

[Term]
id: PRO:000000988
name: voltage-gated potassium channel KCND2 isoform 1 phosphorylated form
def: "A voltage-gated potassium channel KCND2 isoform 1 that has been post-translationally modified to include phosphorylated residues." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000947 ! voltage-gated potassium channel KCND2 isoform 1
intersection_of: has_modification MOD:00696 ! phosphorylated residue

[Term]
id: PRO:000000989
name: voltage-gated potassium channel KCNH2 isoform 1 glycosylated form
def: "A voltage-gated potassium channel KCNH2 isoform 1 that has been post-translationally modified to include a glycosylated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000957 ! voltage-gated potassium channel KCNH2 isoform 1
intersection_of: has_modification MOD:00693 ! glycosylated residue

[Term]
id: PRO:000000990
name: voltage-gated potassium channel KCNH2 isoform 1 phosphorylated form
def: "A voltage-gated potassium channel KCNH2 isoform 1 that has been post-translationally modified to include phosphorylated residues." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000000957 ! voltage-gated potassium channel KCNH2 isoform 1

[Term]
id: PRO:000000991
name: voltage-gated potassium channel subunit KCNA2 isoform 1 phosphorylated form
def: "A voltage-gated potassium channel subunit KCNA2 isoform 1 that has been post-translationally modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000000972 ! voltage-gated potassium channel subunit KCNA2 isoform 1
intersection_of: has_modification MOD:00696 ! phosphorylated residue

[Term]
id: PRO:000000992
name: voltage-gated potassium channel KCNC1 isoform 2 phosphorylated 1
def: "A voltage-gated potassium channel KCNC1 isoform 2 phosphorylated form that has been phosphorylated by PKC at a Ser residue within the DSKL motif located in the C-terminal tail. In resting neurons, basal phosphorylation at this site decreases Kv3.1 channel current, reducing neuronal ability to follow high frequency stimulation. Example: UniProtKB:P25122-1, has_modification MOD:00046 O-phospho-L-serine, Ser-502." [PMID:16595659]
comment: Category=modification.
is_a: PRO:000000986 ! voltage-gated potassium channel KCNC1 isoform 2 phosphorylated form

[Term]
id: PRO:000000993
name: voltage-gated potassium channel KCNC4 isoform 2 phosphorylated 1
def: "A voltage-gated potassium channel KCNC1 isoform 2 phosphorylated form that has been phosphorylated by PKC at multiple Ser residues located in the N-terminal domain. Example: Q03721-2, has_modification MOD:00046 O-phospho-L-serine, Ser-8/Ser-9/Ser-15/Ser-21." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000000987 ! voltage-gated potassium channel KCNC4 isoform 2 phosphorylated form

[Term]
id: PRO:000000994
name: voltage-gated potassium channel KCND2 isoform 1 phosphorylated 1
def: "A voltage-gated potassium channel KCND2 isoform 1 phosphorylated form phosphorylated in the amino and carboxyl terminal cytoplasmic domains by cAMP-dependent protein kinase (PKA). At the N-terminus, the phosporylation occurs at a Thr residue within the PKA consensus phosphorylation sequence adjacent to the first transmembrane domain (segment S1). At the C-terminus, it occurs at the conserved Ser within the motif [RQ]GS[IV]QEL. Example:UniProtKB:Q9Z0V1-1, has_modification MOD:00047 O-phospho-L-threonine, Thr-38, has_modification MOD:00046 O-phospho-L-serine, Ser-552." [PMID:10681507]
comment: Category=modification.
is_a: PRO:000000988 ! voltage-gated potassium channel KCND2 isoform 1 phosphorylated form

[Term]
id: PRO:000000995
name: voltage-gated potassium channel KCND2 isoform 1 phosphorylated 2
def: "A voltage-gated potassium channel KCND2 isoform 1 phosphorylated form phosphorylated in the amino terminal cytoplasmic domain by cAMP-dependent protein kinase (PKA). The phosporylation occurs at a Thr residue within the PKA consensus phosphorylation sequence adjacent to the first transmembrane domain (segment S1). Example:UniProtKB:Q9Z0V1-1, has_modification MOD:00047 O-phospho-L-threonine, Thr-38." [PMID:11040264]
comment: Category=modification.
is_a: PRO:000000988 ! voltage-gated potassium channel KCND2 isoform 1 phosphorylated form

[Term]
id: PRO:000000996
name: voltage-gated potassium channel KCND2 isoform 1 phosphorylated 3
def: "A voltage-gated potassium channel KCND2 isoform 1 phosphorylated form phosphorylated in carboxyl terminal cytoplasmic domain by cAMP-dependent protein kinase (PKA). Phosphorylation occurs at the conserved Ser within the motif [RQ]GS[IV]QEL. Example:UniProtKB:Q9Z0V1-1, has_modification MOD:00046 O-phospho-L-serine, Ser-552." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000000988 ! voltage-gated potassium channel KCND2 isoform 1 phosphorylated form

[Term]
id: PRO:000000997
name: voltage-gated potassium channel KCND2 isoform 1 phosphorylated 4
def: "A voltage-gated potassium channel KCND2 isoform 1 phosphorylated form phosphorylated in carboxyl terminal cytoplasmic domain by ERK at the three most C-terminal consensus motifs (minimal motif=a Ser or Thr followed directly by a proline). Example:UniProtKB:Q9Z0V1-1, has_modification MOD:00047 O-phosphorylated L-threonine,Thr-602/Thr-607,\nhas_modification MOD:00046 O-phospho-L-serine, Ser-616." [PMID:11080179]
comment: Category=modification.
is_a: PRO:000000988 ! voltage-gated potassium channel KCND2 isoform 1 phosphorylated form

[Term]
id: PRO:000000998
name: voltage-gated potassium channel KCNH2 isoform 1 glycosylated 1
def: "A voltage-gated potassium channel KCNH2 isoform 1 glycosylated form that has been glycosylated at the Asn residue within the Nx[T/S] motif located approximately 26 amino acids downstream of the S5 transmembrane domain." [PMID:12063277]
comment: Category=modification.
is_a: PRO:000000989 ! voltage-gated potassium channel KCNH2 isoform 1 glycosylated form

[Term]
id: PRO:000000999
name: voltage-gated potassium channel KCNH2 isoform 1 phosphorylated 1
def: "A voltage-gated potassium channel KCNH2 isoform 1 phosphorylated form that has been phosphorylated in Ser and Thr residues located in the intracellular loops by PKA." [PMID:10837251]
comment: Category=modification.
is_a: PRO:000000990 ! voltage-gated potassium channel KCNH2 isoform 1 phosphorylated form

[Term]
id: PRO:000001000
name: voltage-gated potassium channel subunit KCNA2 isoform 1 phosphorylated 1
def: "A voltage-gated potassium channel subunit KCNA2 isoform 1 phosphorylated form that has been phosphorylated on the Tyr residue within the REDEGYIK sequence located adjacent to the tetramerization domain. Phosphorylation at this site promotes endocytosis and suppresses the channel activity. Example:UniProtKB:P16389-1, has_modification MOD:00048 O4'-phosphorylated L-tyrosine, Tyr-132." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000000991 ! voltage-gated potassium channel subunit KCNA2 isoform 1 phosphorylated form

[Term]
id: PRO:000001001
name: voltage-gated potassium channel subunit KCNA2 isoform 1 phosphorylated 2
def: "A voltage-gated potassium channel subunit KCNA2 isoform 1 phosphorylated form that has been phosphorylated on the pair of Ser residues within the SSPD motif at the C terminus. Phosphorylation at this site promotes cell surface localization. Example: UniProtKB:P16389-1, has_modification MOD:00046 O-phospho-L-serine, Ser-440/Ser-441." [PMID:18056633]
comment: Category=modification.
is_a: PRO:000000991 ! voltage-gated potassium channel subunit KCNA2 isoform 1 phosphorylated form

[Term]
id: PRO:000001002
name: CD19 antigen
def: "A protein that is a translation product of the CD19 gene. It is composed of an N-terminal extracellular domain containing two Ig-like C2-type (immunoglobulin-like) domains, followed by a single-pass transmembrane segment and a cytoplasmic C-terminal tail. CD19 expression is restricted to members of the B cell lineage. It functions as a co-receptor for B-cell antigen receptor (BCR), regulating signal transduction." [PMID:15778510]
comment: Category=gene.
synonym: "B- lymphocyte surface antigen B4" EXACT []
synonym: "B-lymphocyte antigen CD19 " EXACT []
synonym: "B-lymphocyte antigen CD19 precursor" EXACT []
synonym: "CD19" RELATED []
synonym: "Differentiation antigen CD19" EXACT []
synonym: "Leu-12" EXACT []
xref: PIRSF:PIRSF016630
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001003
name: CD34
def: "A protein that is a translation product of the CD34 gene. It is a leukocyte membrane protein expressed specifically by lymphohematopoietic progenitor cells. It contains a single-pass transmembrane domain and that show distinct expression on early hematopoietic precursors and vascular-associated tissue. Acts as a scaffold that presents selectin carbohydrate ligands in a clustered, tissue specific manner to allow for higher avidity interactions between leukocytes and endothelial cells during the inflammatory process. In common with related sialomucins (endoglycan and podocalyxin), the extracellular region is dominated by an N-terminal mucin-like domain, which is densely substituted with sialylated O-linked carbohydrates. The mucin-like region is followed by a cysteine-containing and presumably globular domain. This domain may fold into an immunoglobulin-like structure as the positions of 2 of the cysteines are conserved in the C2 set of the immunoglobulin superfamily. The cytoplasmic domain is around 73-76 residues long and highly conserved." [PMID:16720896, PMID:8983065]
comment: Category=gene.
synonym: "CD34" EXACT []
xref: PIRSF:PIRSF028749
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001004
name: CD4
def: "A protein that is a translation product of the CD4 gene. CD4 is an accessory protein for MHC class-II antigen/T-cell receptor interaction. It is the primary receptor for HIV-1. CD4 has four immunoglobulin-like domains in its extracellular region that share the same structure, but can differ in sequence." [PMID:15326605]
comment: Category=gene.
synonym: "CD4" EXACT []
synonym: "T-cell surface antigen T4/Leu-3" EXACT []
synonym: "T-cell surface glycoprotein CD4" EXACT []
xref: PIRSF:PIRSF001977
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001005
name: integrin alpha with A domain
def: "A protein that is an alpha subunit of integrin. A hallmark of this class is the presence of a von Willebrand factor type A domain (PF00092) (I-domain) of approximately 200 amino acid residues at the N-terminus, which confers divalent cation binding properties. Unlike other integrin alpha proteins, they do not undergo proteolytic cleavage. In common with other types of integrin alpha proteins, they are composed of a long N-terminal extracellular domain, a transmembrane domain and a short cytoplasmic C-terminal domain. Integrins are heterodimers of an alpha and a beta subunit. They are a structurally elaborate family of adhesion molecules that transmit signals bidirectionally across the plasma membrane by undergoing large-scale structural rearrangements. By regulating cell-cell and cell-matrix contacts, integrins participate in a wide-range of biological interactions including development, tissue repair, angiogenesis, inflammation and hemostasis." [PMID:10402956, PMID:11988479, PMID:9676575]
comment: Category=family.
synonym: "integrin alpha with I domain" EXACT []
xref: PIRSF:PIRSF002497
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001006
name: leukocyte common antigen CD45
def: "A protein that is a translation product of the PTPRC gene. It is composed of an extracellular domain, a single transmembrane segment and two tandem intracytoplasmic protein-tyrosine phosphatase domains. Contains 1 to 3 copies of the Fibronectin type III domain (PF00041) followed by two copies of the Protein-tyrosine phosphatase (PF00102) domain. CD45 regulates signal transduction and lymphocyte activation by specific association with receptor molecules on T and B cells. Multiple isoforms of CD45 (180-235 kDa) can be generated as\na result of alternative splicing of three variable exons 4(A), 5(B) and 6(C), encoding sequences at the N-terminal extracellular domain of the molecule." [PMID:1351092, PRO:CNA]
comment: Category=gene.
synonym: "CD45 antigen" RELATED []
synonym: "EC 3.1.3.48" EXACT []
synonym: "LCA" RELATED []
synonym: "Leukocyte common antigen precursor" EXACT []
synonym: "T200 glycoprotein" RELATED []
xref: PIRSF:PIRSF002004
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001007
name: integrin alpha-1
def: "An integrin alpha with A domain that is a translation product of the ITGA1 gene." [PRO:CNA]
comment: Category=gene.
synonym: "integrin alpha-1 precursor" EXACT []
is_a: PRO:000001005 ! integrin alpha with A domain

[Term]
id: PRO:000001008
name: integrin alpha-2
def: "An integrin alpha with A domain that is a translation product of the ITGA2 gene." [PRO:CNA]
comment: Category=gene.
synonym: "Integrin alpha-2 precursor" EXACT []
is_a: PRO:000001005 ! integrin alpha with A domain

[Term]
id: PRO:000001009
name: integrin alpha-D
def: "An integrin alpha with A domain that is a translation product of the ITGAD gene." [PRO:CNA]
comment: Category=gene.
synonym: "Integrin alpha-D precursor" EXACT []
is_a: PRO:000001005 ! integrin alpha with A domain

[Term]
id: PRO:000001010
name: integrin alpha-E
def: "An integrin alpha with A domain that is a translation product of the ITGAE gene." [PRO:CNA]
comment: Category=gene.
synonym: "Integrin alpha-E precursor" EXACT []
is_a: PRO:000001005 ! integrin alpha with A domain

[Term]
id: PRO:000001011
name: integrin alpha-L
def: "An integrin alpha with A domain that is a translation product of the ITGAL gene." [PRO:CNA]
comment: Category=gene.
synonym: "Integrin alpha-L precursor" EXACT []
is_a: PRO:000001005 ! integrin alpha with A domain

[Term]
id: PRO:000001012
name: integrin alpha-M
def: "An integrin alpha with A domain that is a translation product of the ITGAM gene. They constitute subunits of the integrin alpha-M/beta-2 receptor. This receptor is implicated in various adhesive interactions of monocytes, macrophages and granulocytes as well as in mediating the uptake of complement-coated particles. It is also a receptor for fibrinogen, factor X and ICAM1." [UniProtKB:P11215]
comment: Category=gene.
synonym: "CD11b" EXACT []
synonym: "Cell surface glycoprotein MAC-1 subunit alpha " EXACT []
synonym: "Leukocyte adhesion receptor MO1" RELATED []
synonym: "leukocyte integrin CR3 alpha subunit" EXACT []
is_a: PRO:000001005 ! integrin alpha with A domain

[Term]
id: PRO:000001013
name: integrin alpha-X
def: "An integrin alpha with A domain that is a translation product of the ITGAX gene. Integrin alpha-X complexed with beta-2 is a receptor for fibrinogen. It recognizes the sequence GPR in fibrinogen. It mediates cell-cell interaction during inflammatory responses. It is especially important in monocyte adhesion and chemotaxis." [UniProtKB:P20702]
comment: Category=gene.
synonym: "CD11c" EXACT []
synonym: "CD11c antigen" EXACT []
synonym: "Leukocyte adhesion receptor p150,95" EXACT []
is_a: PRO:000001005 ! integrin alpha with A domain

[Term]
id: PRO:000001014
name: leukocyte common antigen CD45 isoform CD45R
def: "A leukocyte common antigen CD45 that is a translation product of a mature transcript of the PTPRC gene, that contains the region encoded by the variable exons 4(A), 5(B), and 6(C). This form represents the higher molecular weight (220 kDa form)." [PMID:1351092]
comment: Category=sequence.
synonym: "CD45R" EXACT []
synonym: "CD45RABC" RELATED []
is_a: PRO:000001006 ! leukocyte common antigen CD45

[Term]
id: PRO:000001015
name: leukocyte common antigen CD45 isoform CD45RA
def: "A leukocyte common antigen CD45 that is a translation product of a mature transcript of the PTPRC gene, that includes the region encoded by the variable exon 4(A), and lacks the region encoded by exons 5(B),and 6(C)." [PRO:CNA]
comment: Category=sequence.
synonym: "CD45RA" EXACT []
is_a: PRO:000001006 ! leukocyte common antigen CD45

[Term]
id: PRO:000001016
name: leukocyte common antigen CD45 isoform CD45RB
def: "A leukocyte common antigen CD45 that is a translation product of a mature transcript of the PTPRC gene, that includes the region encoded by the variable exon 5(B), and lacks the region encoded by exons 4(A),and 6(C)." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000001006 ! leukocyte common antigen CD45

[Term]
id: PRO:000001017
name: leukocyte common antigen CD45 isoform CD45RO
def: "A leukocyte common antigen CD45 that is a translation product of a mature transcript of the PTPRC gene, that lacks the region encoded by the variable exons 4(A), 5(B), and 6(C)." [PRO:CNA]
comment: Category=sequence.
synonym: "180 kDa form" EXACT []
is_a: PRO:000001006 ! leukocyte common antigen CD45

[Term]
id: PRO:000001018
name: CD3 subunit with immunoglobulin domain
def: "A protein with a core domain composition consisting of an extracellular N-terminal domain that adopts an immunoglobulin fold, a transmembrane domain, and an intracellular C-terminal domain with a single copy of the Immunoreceptor tyrosine-based activation motif (PF02189) (ITAM). It constitutes the invariant subunit of the T cell antigen receptor (TCR). TCR is a surface receptor on T cells responsible for recognizing MHC-restricted antigens and initiating the cellular immune response." [PMID:16473826, PMID:1724736]
comment: Category=family.
synonym: "CD3 subunit with Ig-like domain" EXACT []
xref: PIRSF:PIRSF001993
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001019
name: CD3 delta
def: "A CD3 subunit that is a translation product of the CD3D gene." [PRO:CNA]
comment: Category=gene.
synonym: "CD3d" EXACT []
synonym: "T-cell receptor T3 delta chain" EXACT []
synonym: "T3D" RELATED []
xref: PANTHER:PTHR10570\:SF1
is_a: PRO:000001018 ! CD3 subunit with immunoglobulin domain

[Term]
id: PRO:000001020
name: CD3 epsilon
def: "A CD3 subunit that is a translation product of the CD3E gene." [PRO:CNA]
comment: Category=gene.
synonym: "CD1e" EXACT []
synonym: "CD3E" RELATED []
synonym: "T-cell surface antigen T3/Leu-4 epsilon chain" EXACT []
synonym: "T3E" RELATED []
is_a: PRO:000001018 ! CD3 subunit with immunoglobulin domain

[Term]
id: PRO:000001021
name: CD3 gamma
def: "A CD3 subunit that is a translation product of the CD3G gene." [PRO:CNA]
comment: Category=gene.
synonym: "CD3g" EXACT []
synonym: "T-cell receptor T3 gamma chain" EXACT []
synonym: "T3G" RELATED []
is_a: PRO:000001018 ! CD3 subunit with immunoglobulin domain

[Term]
id: PRO:000001022
name: neural cell adhesion molecule
def: "A protein with a domain composition consisting of a large extracellular domain, including five Ig-like C2-type domains followed by two copies of the Fibronectin type-III domain (PF00041), a single-pass transmembrane domain and a short cytoplasmic C-terminal domain." [PRO:CNA]
comment: Category=family.
xref: PIRSF:PIRSF002507
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001023
name: neural cell adhesion molecule NCAM
def: "A neural cell adhesion molecule which is involved in neuronal development, synaptic plasticity, and regeneration." [PMID:17975827]
comment: Category=family.
xref: PIRSF:PIRSF501037
is_a: PRO:000001022 ! neural cell adhesion molecule

[Term]
id: PRO:000001024
name: neural cell adhesion molecule 1
def: "A neural cell adhesion molecule NCAM that is a translation product of the NCAM1 gene." [PRO:CNA]
comment: Category=gene.
synonym: "CD56" EXACT []
synonym: "NCAM1" EXACT []
is_a: PRO:000001023 ! neural cell adhesion molecule NCAM

[Term]
id: PRO:000001025
name: C-type lectin with multiple lectin domains
def: "A protein that is a type I transmembrane receptor with an N-terminal cysteine-rich domain, a single Fibronectin type II (FNII) domain (PF00040) and eight to ten copies of the Lectin C-type domain (PF00059) (CTLDs). The presence of multiple copies of the CTLD domain is a hallmark of this class." [PMID:12223280]
comment: Category=family.
xref: PIRSF:PIRSF002427
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001026
name: lymphocyte antigen 75
def: "A C-type lectin with multiple lectin domains that is a translation product of the LY75 gene. It consists of 12 extracellular domains (an N-terminal cysteine-rich domain, a fibronectin type II domain and 10 C-type carbohydrate recognition domains), a transmembrane region and a small cytoplasmic C terminus containing a single Tyr residue, but no obvious kinase domain. Acts as an endocytic receptor to direct captured antigens from the extracellular space to a specialized antigen-processing compartment." [PMID:9862343]
comment: Category=gene.
synonym: "CD205" EXACT []
synonym: "CD205 antigen" EXACT []
synonym: "gp200-MR6" EXACT []
is_a: PRO:000001025 ! C-type lectin with multiple lectin domains

[Term]
id: PRO:000001027
name: CD247
def: "A protein consisting of an extracellular short N-terminal domain, a transmembrane domain, and an intracellular C-terminal domain with two to three copies of the Immunoreceptor tyrosine-based activation motif (PF02189) (ITAM). It is a translation product of the CD247 gene." [PRO:CNA]
comment: Category=gene.
synonym: "CD3" EXACT []
xref: PIRSF:PIRSF028738
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001028
name: CD247 isoform CD3 eta
def: "A CD247 that is a translation product of a mature transcript of the CD247 gene, that contains two copies of the ITAM domain. It has a longer and disctinct C-terminus compared to isoform CD3 zeta. This form is represented by the mouse sequence UniProtKB:P29020-1." [PMID:2150596]
comment: Category=sequence.
synonym: "CD-3-eta" EXACT []
is_a: PRO:000001027 ! CD247

[Term]
id: PRO:000001029
name: CD247 isoform CD3 zeta
def: "A CD3 that is a translation product of a mature transcript of the CD247 gene, that contains three copies of the ITAM domain. It has a shorter and disctinct C-terminus compared to isoform CD3 eta. This form is represented by the mouse sequence UniProtKB:P24161-1." [PMID:2150596]
comment: Category=sequence.
synonym: "CD-3-zeta" EXACT []
synonym: "CD3Z" EXACT []
synonym: "TCRZ" EXACT []
is_a: PRO:000001027 ! CD247

[Term]
id: PRO:000001030
name: erm protein
def: "A protein that contain 3 domains, an N-terminal globular domain, an extended alpha-helical domain, and a charged C-terminal domain. Ezrin, radixin and merlin also contain a polyproline region between the helical and C-terminal domains. The N-terminal domain is highly conserved, and is also found in merlin, band 4.1 proteins and members of the band 4.1 superfamily. ERM proteins are involved in crosslinking actin filaments with plasma membranes." [Interpro:IPR011259]
comment: Category=family.
xref: PIRSF:PIRSF002305
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001031
name: ezrin
def: "An erm protein that is a translation product of the EZR gene." [PRO:CNA]
comment: Category=gene.
synonym: "cytovillin" EXACT []
synonym: "p81" EXACT []
synonym: "VIL2" RELATED []
synonym: "villin-2" EXACT []
is_a: PRO:000001030 ! erm protein

[Term]
id: PRO:000001032
name: ezrin isoform 1
def: "An ezrin that is a translation product of a mature transcript of the EZR gene. Represented by the sequence UniProtKB:P15311-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000001031 ! ezrin

[Term]
id: PRO:000001033
name: ezrin isoform 1 phosphorylated form
def: "An ezrin isoform 1 that has been post-translationally modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000001032 ! ezrin isoform 1
intersection_of: has_modification MOD:00696 ! phosphorylated residue

[Term]
id: PRO:000001034
name: ezrin isoform 1 phosphorylated 1
def: "An ezrin phosphorylated form that has been phosphorylated after EGF stimulation. Example:UniProtKB:P15311-1, has_modification MOD:00048:O4'-phosphorylated L-tyrosine, Tyr-146/Tyr-354." [PMID:1382070]
comment: Category=modification.
is_a: PRO:000001033 ! ezrin isoform 1 phosphorylated form

[Term]
id: PRO:000001035
name: ezrin isoform 1 phosphorylated 2
def: "An ezrin phosphorylated form that has been phosphorylated by protein kinase A (PKA). Example:UniProtKB:P15311-1, has_modification MOD:00046 O-phospho-L-serine, Ser-66." [PhosphoSitePlus:http\://www.phosphosite.org/siteAction.do?id=28933, PMID:12840026, PMID:16438931]
comment: Category=modification.
is_a: PRO:000001033 ! ezrin isoform 1 phosphorylated form

[Term]
id: PRO:000001036
name: ww domain-containing oxidoreductase
def: "A protein that is a translation product of the WWOX gene." [PRO:CNA]
comment: Category=gene.
synonym: "EC 1.1.1.-" RELATED []
synonym: "Wox1" RELATED []
xref: PANTHER:PTHR19410\:SF99
xref: PIRSF:PIRSF038706
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001037
name: ww domain-containing oxidoreductase isoform 1
def: "A ww domain-containing oxidoreductase that is a translation product of a mature transcript of the WWOX gene, represented by the human sequence UniProtKB:Q9NZC7-1." [PRO:CNA]
comment: Category=sequence.
synonym: "FOR II" RELATED []
synonym: "FOR2" RELATED []
synonym: "Wox1" EXACT []
synonym: "WWOX v8" RELATED []
synonym: "WWOXv1" RELATED []
is_a: PRO:000001036 ! ww domain-containing oxidoreductase

[Term]
id: PRO:000001038
name: ezrin isoform 1 phosphorylated 3
def: "An ezrin phosphorylated form that has been phosphorylated in the first Tyr residue within the ITAM-like motif EYLKIAQDLEMYGINYFEI. Example:UniProtKB:P15311-1, has_modification MOD:00048:O4'-phosphorylated L-tyrosine, Tyr-191." [PMID:15647376, PMID:9052872]
comment: Category=modification.
is_a: PRO:000001033 ! ezrin isoform 1 phosphorylated form

[Term]
id: PRO:000001039
name: ezrin isoform 1 phosphorylated 4
def: "An ezrin phosphorylated form that has been phosphorylated both in a Tyr residue within the FERM central domain, and the first Tyr residue within the ITAM-like motif EYLKIAQDLEMYGINYFEI. Example:UniProtKB:P15311-1, has_modification MOD:00048 O4'-phosphorylated L-tyrosine, Tyr-146/Tyr-191, has_modification MOD:00047 O-phosphorylated L-threonine, Thr-567." [PMID:15647376]
comment: Category=modification.
is_a: PRO:000001033 ! ezrin isoform 1 phosphorylated form

[Term]
id: PRO:000001040
name: ezrin isoform 1 phosphorylated 5
def: "An ezrin phosphorylated form that has been phosphorylated at a Thr residue located within the C-terminal domain. Example:UniProtKB:P15311-1, has_modification MOD:00047 O-phospho-L-threonine, Thr-567." [PMID:16144865]
comment: Category=modification.
is_a: PRO:000001033 ! ezrin isoform 1 phosphorylated form

[Term]
id: PRO:000001041
name: ezrin-radixin-moesin-binding phosphoprotein 50
def: "A Na(+)/H(+) exchange regulatory cofactor with ERM-binding domain that is a translation product of the SLC9A3R1 gene. It contains two copies of the PDZ domain at the N-terminus and a EBP50 domain at the C-terminus. The latter allows interaction with FERM domains, resulting in the activation of ERM proteins (PRO:000001030), with subsequent cytoskeletal modulation and cellular growth control." [PRO:CNA]
comment: Category=gene.
synonym: "EBP50" EXACT []
synonym: "Na(+)/H(+) exchange regulatory cofactor NHE-RF" EXACT []
synonym: "NHERF" RELATED []
synonym: "sodium-hydrogen exchanger regulatory factor 1" EXACT []
synonym: "solute carrier family 9 isoform A3 regulatory factor 1" EXACT []
is_a: PRO:000001043 ! Na(+)/H(+) exchange regulatory cofactor with ERM-binding domain

[Term]
id: PRO:000001042
name: ezrin-radixin-moesin-binding phosphoprotein 50 isoform 1
def: "An ezrin-radixin-moesin-binding phosphoprotein 50 that is a translation product of a mature transcript of the SLC9A3R1 gene. Represented by the human sequence UniProtKB:O14745-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000001041 ! ezrin-radixin-moesin-binding phosphoprotein 50

[Term]
id: PRO:000001043
name: Na(+)/H(+) exchange regulatory cofactor with ERM-binding domain
def: "A protein that consists of two copies of the PDZ domain (PF00595) and a copy of the EBP50, C-terminal (PF09007) domain." [PMID:15905209]
comment: Category=family.
synonym: "NHERF" RELATED []
xref: PIRSF:PIRSF037866
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001044
name: cystic fibrosis transmembrane conductance regulator (cftr)
def: "A protein that is a translational product of the CFTR gene. Involved in the transport of chloride ions. The characteristic domain composition of the functional isoform consists of two modules of a membrane-spanning domain (ABC transporter transmembrane region) followed by a nucleotide-binding domain (ABC transporter domains), separated by an intracellular regulatory domain (R-domain). It also contains a C-terminal PDZ-binding region. The R-domain is an inhibitory domain of CFTR,\nand phosphorylation of the R-domain removes this inhibition, allowing activation of chloride flux." [PMID:9922375, PRO:CNA]
comment: Category=gene.
synonym: "ABCC7" RELATED []
synonym: "ATP-binding cassette transporter sub-family C member 7" RELATED []
synonym: "cAMP-dependent chloride channel" EXACT []
synonym: "CFTR" EXACT []
xref: PIRSF:PIRSF002777
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001045
name: cftr isoform 1
def: "A cystic fibrosis transmembrane conductance regulator that is a translation product of a mature transcript of the CFTR gene. This form is represented by the human sequence UniProtKB:P13569-1. This form represents the normal or wild type protein and is composed of two modules of a membrane-spanning domain (ABC transporter transmembrane region) followed by a nucleotide-binding domain (ABC transporter domains), separated by an intracellular regulatory domain (R-domain). It also contains a C-terminal PDZ-binding region. The R-domain is an inhibitory domain of CFTR,\nand phosphorylation of the R-domain removes this inhibition, allowing activation of chloride flux." [PMID:9922375, PRO:CNA]
comment: Category=sequence.
synonym: "cystic fibrosis transmembrane conductance regulator isoform 1" EXACT []
is_a: PRO:000001044 ! cystic fibrosis transmembrane conductance regulator (cftr)

[Term]
id: PRO:000001046
name: cftr isoform 2
def: "A cystic fibrosis transmembrane conductance regulator that is a translation product of a mature transcript of the CFTR gene, represented by the human sequence UniProtKB:P13569-2. This form, generated by exon skipping, lacks a region of about 60 residues including part of the N-terminus of the first ABC transporter domain." [OMIM:277180, PMID:10766763]
comment: Category=sequence.
is_a: PRO:000001044 ! cystic fibrosis transmembrane conductance regulator (cftr)

[Term]
id: PRO:000001047
name: cftr isoform 3
def: "A cystic fibrosis transmembrane conductance regulator that is a translation product of a mature transcript of the CFTR gene, represented by the human sequence UniProtKB:P13569-3. This isoform is generated by usage of a cryptic 3' splice site within an exonic splicing enhancer (ESE) region, leading to a frameshift and a protein truncation within the first ABC transporter domain." [PRO:CNA]
comment: Category=sequence.
synonym: "Delta248" RELATED []
is_a: PRO:000001044 ! cystic fibrosis transmembrane conductance regulator (cftr)

[Term]
id: PRO:000001048
name: cftr isoform 1 glycosylated form
def: "A cftr isoform 1 that has been post-translationally modified to include glycosylated residues." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000001045 ! cftr isoform 1
intersection_of: has_modification MOD:00693 ! glycosylated residue

[Term]
id: PRO:000001049
name: cftr isoform 1 glycosylated 1
def: "A cftr isoform 1 glycosylates form glycosylated at two Asn residues, within the N{P}[ST]{P} motif, located in the fourth extracellular loop. Example: UniProtKB:P13569-1, has_modification MOD:00160 N4-glycosyl-L-asparagine, Asn-894/Asn-900." [PMID:7518437]
comment: Category=modification.
is_a: PRO:000001048 ! cftr isoform 1 glycosylated form

[Term]
id: PRO:000001050
name: cftr isoform 1 phosphorylated form
comment: Category=modification.
intersection_of: PRO:000001045 ! cftr isoform 1
intersection_of: has_modification MOD:00696 ! phosphorylated residue

[Term]
id: PRO:000001051
name: cftr isoform 1 phosphorylated 1
def: "A cftr isoform 1 phosphorylated form that has been phosphorylated at multiple Ser and/or Thr residues within the PKA consensus sites R[RK]x [ST] located in the regulatory domain (R-domain). This is an active form. Example: UniProtKB:P13569-1, has_modification MOD:00046 O-phospho-L-serine, Ser-737/Ser-813/Ser-768/Ser- 795." [PMID:1377674, PMID:14602047]
comment: Category=modification.
synonym: "cftr PKA phosphorylated form" RELATED []
is_a: PRO:000001050 ! cftr isoform 1 phosphorylated form

[Term]
id: PRO:000001052
name: cftr isoform 1 phosphorylated 2
def: "A cftr isoform 1 phosphorylated form that has been phosphorylated by PKA and PKC at multiple Ser and/or Thr residues within the regulatory domain (R-domain). This is an active form. Example: UniProtKB:P13569-1, has_modification MOD:00046 O-phospho-L-serine, Ser-686/Ser-737/Ser-790/Ser-813/Ser-768/Ser-795." [PMID:1377674]
comment: Category=modification.
is_a: PRO:000001050 ! cftr isoform 1 phosphorylated form

[Term]
id: PRO:000001053
name: ww domain-containing oxidoreductase isoform 2
def: "A ww domain-containing oxidoreductase that is a translation product of a mature transcript of the WWOX gene, represented by the human sequence UniProtKB:Q9NZC7-2." [PRO:CNA]
comment: Category=sequence.
synonym: "FOR I)" RELATED []
synonym: "FOR1" RELATED []
synonym: "WOX2" RELATED []
synonym: "WWOXv2" RELATED []
is_a: PRO:000001036 ! ww domain-containing oxidoreductase

[Term]
id: PRO:000001054
name: ww domain-containing oxidoreductase isoform 3
def: "A ww domain-containing oxidoreductase that is a translation product of a mature transcript of the WWOX gene, represented by the human sequence UniProtKB:Q9NZC7-3. This form lacks the C-terminal short chain dehydrogenase domain." [PRO:CNA]
comment: Category=sequence.
synonym: "FOR III" EXACT []
synonym: "FOR3" EXACT []
synonym: "wox3" EXACT []
is_a: PRO:000001036 ! ww domain-containing oxidoreductase

[Term]
id: PRO:000001055
name: ww domain-containing oxidoreductase isoform 4
def: "A ww domain-containing oxidoreductase that is a translation product of a mature transcript of the WWOX gene, represented by the human sequence UniProtKB:Q9NZC7-4. This is form is truncated within the first ww domain, and is about 37 residues long." [PRO:CNA]
comment: Category=sequence.
synonym: "FOR IV" EXACT []
is_a: PRO:000001036 ! ww domain-containing oxidoreductase

[Term]
id: PRO:000001056
name: ww domain-containing oxidoreductase isoform 5
def: "A ww domain-containing oxidoreductase that is a translation product of a mature transcript of the WWOX gene, represented by the human sequence UniProtKB:Q9NZC7-5. This form lacks the short chain dehydrogenase domain but includes the rest of the C-terminal sequence." [PMID:11719429]
comment: Category=sequence.
synonym: "WWOXdelta6-8" EXACT []
synonym: "WWOXv4" RELATED []
is_a: PRO:000001036 ! ww domain-containing oxidoreductase

[Term]
id: PRO:000001057
name: ww domain-containing oxidoreductase isoform 6
def: "A ww domain-containing oxidoreductase that is a translation product of a mature transcript of the WWOX gene, represented by the human sequence UniProtKB:Q9NZC7-6. This form contains an alternative sequence after the two WW domains and the predicted nucleotide binding site, as compared to isoform 1. Originated by exons deletions and frameshift." [PMID:11719429]
comment: Category=sequence.
synonym: "WWOXdelta5-8" RELATED []
is_a: PRO:000001036 ! ww domain-containing oxidoreductase

[Term]
id: PRO:000001058
name: ezrin-radixin-moesin-binding phosphoprotein 50 isoform 2
def: "An ezrin-radixin-moesin-binding phosphoprotein 50 that is a translation product of a mature transcript of the SLC9A3R1 gene. Represented by the mouse sequence UniProtKB:P70441-2. This form lacks the N-terminal region containing the first PDZ domain." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000001041 ! ezrin-radixin-moesin-binding phosphoprotein 50

[Term]
id: PRO:000001059
name: transient receptor potential cation channel TRPA1 isoform 1
def: "A transient receptor potential cation channel TRPA1 that is a translation product of a mature transcript of the TRPA1 gene. This form is represented by the mouse sequence UniProtKB:Q8BLA8-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000000699 ! transient receptor potential cation channel TRPA1

[Term]
id: PRO:000001060
name: transient receptor potential cation channel TRPV3
def: "A transient receptor potential cation channel TRPV that is a translation product of the TRPV3 gene." [PRO:CNA]
comment: Category=gene.
synonym: "Transient receptor potential cation channel subfamily V member 3" EXACT []
synonym: "vanilloid receptor-like protein 3" EXACT []
synonym: "VRL3" RELATED []
is_a: PRO:000000681 ! transient receptor potential cation channel TRPV

[Term]
id: PRO:000001061
name: transient receptor potential cation channel TRPV3 isoform 2
def: "A transient receptor potential cation channel TRPV3 that is a translation product of a mature transcript of the TRPV3 gene. This form is represented by the mouse sequence UniProtKB:Q8K424-1." [PRO:CNA]
comment: Category=sequence.
synonym: "Isoform A" EXACT []
is_a: PRO:000001060 ! transient receptor potential cation channel TRPV3

[Term]
id: PRO:000001062
name: transient receptor potential cation channel TRPV3 isoform 1
def: "A transient receptor potential cation channel TRPV3 that is a translation product of a mature transcript of the TRPV3 gene. This form is represented by the human sequence UniProtKB:Q8NET8-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000001060 ! transient receptor potential cation channel TRPV3

[Term]
id: PRO:000001063
name: transient receptor potential cation channel TRPV3 isoform 3
def: "A transient receptor potential cation channel TRPV3 that is a translation product of a mature transcript of the TRPV3 gene, and that lacks the C-terminal cytoplasmic domain. This form is represented by the human sequence UniProtKB:Q8NET8-3." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000001060 ! transient receptor potential cation channel TRPV3

[Term]
id: PRO:000001064
name: transient receptor potential cation channel TRPV2
def: "A transient receptor potential cation channel TRPV that is a translation product of the TRPV2 gene." [PRO:CNA]
comment: Category=gene.
synonym: "GRC" RELATED []
synonym: "Growth factor-regulated calcium channel " RELATED []
synonym: "Osm-9-like TRP channel 2" EXACT []
synonym: "OTRPC2" EXACT []
synonym: "Transient receptor potential cation channel subfamily V member 2 " EXACT []
synonym: "Vanilloid receptor-like protein 1 " EXACT []
synonym: "VRL1" RELATED []
is_a: PRO:000000681 ! transient receptor potential cation channel TRPV

[Term]
id: PRO:000001065
name: transient receptor potential cation channel TRPV1
def: "A transient receptor potential cation channel TRPV that is a translation product of the TRPV1 gene." [PRO:CNA]
comment: Category=gene.
synonym: "Transient receptor potential cation channel subfamily V member 1" EXACT []
is_a: PRO:000000681 ! transient receptor potential cation channel TRPV

[Term]
id: PRO:000001066
name: transient receptor potential cation channel TRPV2 isoform 1
def: "A transient receptor potential cation channel TRPV1 that is a translation product of a mature transcript of the TRPV1 gene. This form is represented by the sequence mouse UniProtKB:Q9WTR1-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000001064 ! transient receptor potential cation channel TRPV2

[Term]
id: PRO:000001067
name: transient receptor potential cation channel TRPV1 isoform 1
def: "A transient receptor potential cation channel TRPV1 that is a translation product of a mature transcript of the TRPV1 gene. This form is represented by the human sequence UniProtKB:Q8NER1-1." [PRO:CNA]
comment: Category=sequence.
synonym: "Alpha" RELATED []
is_a: PRO:000001065 ! transient receptor potential cation channel TRPV1

[Term]
id: PRO:000001068
name: transient receptor potential cation channel TRPV4
def: "A transient receptor potential cation channel TRPV that is a translation product of the TRPV4 gene. The functional subunits are ion-selective calcium permeant cation channel probably involved in osmotic sensitivity and mechanosensitivity. Activation by exposure to hypotonicity within the physiological range exhibits an outward rectification." [PRO:CNA, UniProtKB:Q9HBA0]
comment: Category=gene.
synonym: "osm-9-like TRP channel 4" EXACT []
synonym: "OTRPC4" EXACT []
synonym: "SAC1" EXACT []
synonym: "transient receptor potential protein 12" EXACT []
synonym: "TRP12" EXACT []
synonym: "TRPV4" RELATED []
synonym: "vanilloid receptor-like channel 2 " RELATED []
synonym: "vanilloid receptor-related osmotically-activated channel " EXACT []
synonym: "VR-OAC" EXACT []
is_a: PRO:000000681 ! transient receptor potential cation channel TRPV

[Term]
id: PRO:000001069
name: transient receptor potential cation channel TRPV4 isoform 1
def: "A transient receptor potential cation channel TRPV4 that is a translation product of a mature transcript of the TRPV4 gene. Predicted to contain six transmembrane segments (S1-S6) with a putative pore loop between S5 and S6 and intracellular N- and C-tails, the former containing three ankyrin domains. This form is represented by the human sequence UniProtKB:Q9HBA0-1." [PMID:11025659, PMID:16293632, PRO:CNA]
comment: Category=sequence.
synonym: "A" RELATED []
synonym: "TRPV4-A" EXACT []
is_a: PRO:000001068 ! transient receptor potential cation channel TRPV4

[Term]
id: PRO:000001070
name: transient receptor potential cation channel TRPV4 isoform 2
def: "A transient receptor potential cation channel TRPV4 that is a translation product of a mature transcript of the TRPV4 gene. Predicted to contain six transmembrane segments (S1-S6) with a putative pore loop between S5 and S6 and intracellular N- and C-tails, the former containing 2 full ankyrin domains. This form lacks the C-terminal half of the third ankiryn domain as compared to isoform 1. This form is represented by the human sequence UniProtKB:Q9HBA0-2." [PMID:16293632]
comment: Category=sequence.
synonym: "B" RELATED []
synonym: "OTRPC4beta" EXACT []
synonym: "TRPV4-B" EXACT []
is_a: PRO:000001068 ! transient receptor potential cation channel TRPV4

[Term]
id: PRO:000001071
name: transient receptor potential cation channel TRPV4 isoform 3
def: "A transient receptor potential cation channel TRPV4 that is a translation product of a mature transcript of the TRPV4 gene. Predicted to contain six transmembrane segments (S1-S6) with a putative pore loop between S5 and S6 and intracellular N- and C-tails, the former containing 2 ankyrin domains. This form lacks the region including the most N-terminal ankiryn domain found in isoform 1. This form is represented by the human sequence UniProtKB:Q9HBA0-4." [PMID:16293632]
comment: Category=sequence.
synonym: "C" RELATED []
synonym: "TRPV4-C" EXACT []
is_a: PRO:000001068 ! transient receptor potential cation channel TRPV4

[Term]
id: PRO:000001072
name: transient receptor potential cation channel TRPV4 isoform 4
def: "A transient receptor potential cation channel TRPV4 that is a translation product of a mature transcript of the TRPV4 gene. Predicted to contain six transmembrane segments (S1-S6) with a putative pore loop between S5 and S6 and intracellular N- and C-tails, the former containing 3 ankyrin domains. This form lacks a region os around 34 residues, close to the N-terminus as compared to isoform 1. This form is represented by the human sequence UniProtKB:Q9HBA0-5." [PMID:16293632]
comment: Category=sequence.
synonym: "D" RELATED []
synonym: "TRPV4-D" EXACT []
is_a: PRO:000001068 ! transient receptor potential cation channel TRPV4

[Term]
id: PRO:000001073
name: transient receptor potential cation channel TRPV4 isoform 5
def: "A transient receptor potential cation channel TRPV4 that is a translation product of a mature transcript of the TRPV4 gene. Predicted to contain six transmembrane segments (S1-S6) with a putative pore loop between S5 and S6 and intracellular N- and C-tails, the former containing 1full ankyrin domain. This form lacks the first and the third ankiryn domains as compared to isoform 1. This form is represented by the human sequence UniProtKB:Q9HBA0-6." [PMID:16293632]
comment: Category=sequence.
synonym: "E" RELATED []
synonym: "TRPV-E" EXACT []
is_a: PRO:000001068 ! transient receptor potential cation channel TRPV4

[Term]
id: PRO:000001074
name: transient receptor potential cation channel TRPC with PDZ-binding motif
def: "A transient receptor potential cation channel TRPC with a carboxyl-terminal PDZ-binding motif (VTTRL). They form homomeric or heteromeric (with TRPC1) cation channels that are activated following stimulation of Gq-coupled receptors." [PMID:16382100, PMID:16460286, PMID:17579562, PRO:WCB]
comment: Category=family.
is_a: PRO:000000680 ! transient receptor potential cation channel TRPC

[Term]
id: PRO:000001075
name: transient receptor potential cation channel TRPC4
def: "A transient receptor potential cation channel TRPC with PDZ-binding motif that is a translation product of the TRPC4 gene." [PRO:CNA]
comment: Category=gene.
synonym: "Trp-related protein 4" EXACT []
is_a: PRO:000001074 ! transient receptor potential cation channel TRPC with PDZ-binding motif

[Term]
id: PRO:000001076
name: transient receptor potential cation channel TRPC4 isoform 1
def: "A transient receptor potential cation channel TRPC4 that is a translation product of a mature transcript of the TRPC4 gene. This form is represented by the human sequence UniProtKB:Q9UBN4-1." [PMID:11163362, PRO:CNA]
comment: Category=sequence.
is_a: PRO:000001075 ! transient receptor potential cation channel TRPC4

[Term]
id: PRO:000001077
name: transient receptor potential cation channel TRPC4 isoform 2
def: "A transient receptor potential cation channel TRPC4 that is a translation product of a mature transcript of the TRPC4 gene. This form is represented by the human sequence UniProtKB:Q9UBN4-2. This form lacks a region of around 84 residues at the C-terminal domain, but conserves the PDZ-binding motif as compared to isoform 1." [PMID:11713258, PRO:CNA]
comment: Category=sequence.
synonym: "isoform beta" EXACT []
is_a: PRO:000001075 ! transient receptor potential cation channel TRPC4

[Term]
id: PRO:000001078
name: transient receptor potential cation channel TRPC4 isoform 3
def: "A transient receptor potential cation channel TRPC4 that is a translation product of a mature transcript of the TRPC4 gene. This form is represented by the human sequence UniProtKB:Q9UBN4-3. This form lacks a region of around 140 residues at the C-terminal domain, but conserves the PDZ-binding motif as compared to isoform 1." [PMID:11163362, PRO:CNA]
comment: Category=sequence.
synonym: "isoform delta" EXACT []
is_a: PRO:000001075 ! transient receptor potential cation channel TRPC4

[Term]
id: PRO:000001079
name: transient receptor potential cation channel TRPC4 isoform 4
def: "A transient receptor potential cation channel TRPC4 that is a translation product of a mature transcript of the TRPC4 gene. This form is represented by the human sequence UniProtKB:Q9UBN4-4." [PMID:11163362, PRO:CNA]
comment: Category=sequence.
synonym: "isoform gamma" EXACT []
is_a: PRO:000001075 ! transient receptor potential cation channel TRPC4

[Term]
id: PRO:000001080
name: transient receptor potential cation channel TRPC7
def: "A transient receptor potential cation channel TRPC3/6/7 that is a translation product of the TRPC7 gene." [PRO:CNA]
comment: Category=gene.
synonym: "Short transient receptor potential channel 7" EXACT []
synonym: "TRP7" EXACT []
synonym: "TRP7 protein" EXACT []
synonym: "TrpC7" EXACT []
synonym: "Trrp8" RELATED []
is_a: PRO:000000718 ! transient receptor potential cation channel TRPC3/6/7

[Term]
id: PRO:000001081
name: transient receptor potential cation channel TRPC7 isoform 1
def: "A transient receptor potential cation channel TRPC7 that is a translation product of a mature transcript of the TRPC7 gene. This form is represented by the mouse sequence UniProtKB:Q9WVC5-1." [PMID:10488066]
comment: Category=sequence.
is_a: PRO:000001080 ! transient receptor potential cation channel TRPC7

[Term]
id: PRO:000001082
name: CD160 antigen
def: "A protein that is a translation product of the CD160 gene." [PRO:CNA]
comment: Category=gene.
synonym: "BY55/CD160" EXACT []
synonym: "Natural killer cell receptor BY55 " RELATED []
xref: PIRSF:PIRSF038702
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001083
name: T-cell surface glycoprotein CD2
def: "A protein that is a translation product of the CD2 gene." [PRO:CNA]
comment: Category=gene.
synonym: "CD2" EXACT []
synonym: "CD2 antigen" EXACT []
synonym: "LFA-2" RELATED []
synonym: "LFA-3 receptor" EXACT []
synonym: "SRBC" RELATED []
synonym: "T-cell surface antigen T11/Leu- 5" EXACT []
xref: PIRSF:PIRSF001984
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001084
name: T-cell surface glycoprotein CD8 alpha chain
def: "A protein that is a translation product of the CD8A gene. CD8 is a transmembrane that is a co-receptor for MHC class-I antigen/T-cell receptor interaction. The most common form of CD8 is composed of a CD8 alpha and a CD8 beta chain." [PMID:11114424, PRO:CNA, Wikipedia:CD8]
comment: Category=gene.
synonym: "CD8 alpha" EXACT []
synonym: "cluster of differentiation 8" EXACT []
xref: PANTHER:PTHR10441\:SF1
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001085
name: T-cell surface glycoprotein CD8 beta chain
def: "A protein that is a translation product of the CD8B1 gene. CCD8 is a transmembrane that is a co-receptor for MHC class-I antigen/T-cell receptor interaction. The most common form of CD8 is composed of a CD8 alpha and a CD8 beta chain." [PRO:CNA, Wikipidia:CD8]
comment: Category=gene.
synonym: "CD8B" EXACT []
xref: PIRSF:PIRSF002020
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001086
name: VVC2C2C2 Ig-like domain arrangement-containing protein
def: "A protein that is single-pass type I membrane proteins with an extracellular domain that includes five immunoglobulin-like domains of the type VVC2C2C2. These molecules are involved in the development and maintenance of tissue architecture, neurogenesis, hematopoiesis, immune responses and tumor progression." [PMID:15769845]
comment: Category=family.
xref: PIRSF:PIRSF038703
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001087
name: adhesion G protein-coupled receptor
def: "A protein with a 7 transmembrane (secretin family) domain (PF00002) preceded by an amino-terminal region containing one or more functional domains with adhesion-like motifs." [PRO:WCB, Pubmed:12761335]
synonym: "secretin receptor-like G protein-coupled receptor" RELATED []
synonym: "subfamily B2 G protein-coupled receptor" EXACT [PubMed:11790261]
is_obsolete: true

[Term]
id: PRO:000001088
name: alpha-latrotoxin
def: "A protein that is a constituent neurotoxin of the black widow spider venom, and contains multiple ankyrin repeats (20-22). The active form assembles into homotetrameric complexes which harbor a central channel and can insert into target lipid membranes. But relies on the binding to specific receptors in the plasma membrane to exert its function." [PMID:18064415, PMID:1888339, PRO:CNA]
comment: Category=gene.
synonym: "alpha-LTX" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001089
name: immunoglobulin superfamily member 2
def: "A protein that is a translation product of the IGSF2 gene. Plays a role as inhibitor of T-cells proliferation." [PRO:CNA]
comment: Category=gene.
synonym: "CD101" EXACT []
synonym: "Cell surface glycoprotein V7" EXACT []
synonym: "EWI-101" RELATED []
synonym: "Glu-Trp-Ile EWI motif-containing protein 101 " EXACT []
synonym: "Immunoglobulin superfamily member 2 precursor" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001090
name: immunoglobulin superfamily member 8
def: "A protein that is a translation product of the IGSF8 gene." [PRO:CNA]
comment: Category=gene.
synonym: "Immunoglobulin superfamily member 8 precursor" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001091
name: interleukin-1
def: "A protein with a core domain composition consisting of a propeptide region and an Interleukin-1 / 18 domain." [PMID:8001745, PRO:CNA]
comment: Category=family.
synonym: "interleukin-1" RELATED []
xref: PIRSF:PIRSF001937
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001092
name: interleukin-17
def: "A protein that is a T cell-derived cytokine that may play an important role in the initiation or maintenance of the proinflammatory response. Except for IL-17B, all other IL-17 family members are homodimers containing five highly conserved cysteine residues forming characteristic cystein-knot structure, similar to that found in the TGF-beta-like cystine-knot (PRO:000000008). This class consists of six cytokines. Among them, interleukin 17A (IL-17) and IL-17F are expressed by a novel subset of CD4+ helper T (Th) cells and play a critical role in inflammation and autoimmunity. On the other hand, IL-17E, also called IL-25, has been associated with allergic responses." [PMID:17982105, PMID:18280574]
comment: Category=family.
synonym: "IL-17" EXACT []
synonym: "IL17" EXACT []
xref: PANTHER:PTHR21295
xref: PIRSF:PIRSF003430
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001093
name: lymphocyte function-associated antigen 3
def: "A protein that is a translation product of the CD58 gene. The active forms are ligands of the T-lymphocyte CD2 glycoprotein." [PRO:CNA]
comment: Category=gene.
synonym: "CD58" RELATED []
synonym: "LFA3" RELATED []
synonym: "Surface glycoprotein LFA-3 " EXACT []
xref: PANTHER:PTHR21063
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001094
name: rhodopsin-like G protein-coupled receptor
def: "A protein that contains the 7 transmembrane receptor (rhodopsin family) domain (Pfam:PF00001), which includes 7 transmembrane helices (TMI-TM7) with 3 intracellular loops (IL1-IL3) and 3 extracellular loops (EL1-EL3) between the helices. The amino-terminal region is extracellular and the carboxyl-terminal region is intracellular. Rhodopsin-like G-protein coupled receptors (GPCRs) are unique among the several classes of GPCRs in that most have a very short amino-terminal segment and several characteristic sequence motifs, particularly NSxxNPxxY in TM7 and D/E-R-Y/F between TM3 and loop IL2. Most bind their ligands within a cavity between the TM regions." [PRO:WCB, PubMed:12761335]
comment: Category=family.
synonym: "class 1 G protein-coupled receptor" EXACT [PubMed:15914470]
synonym: "class A G protein-coupled receptor" EXACT [IUPHAR:http\://www.iuphar-db.org/GPCR/ReceptorListForward]
xref: PIRSF:PIRSF800006
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001095
name: secretin receptor-like G protein-coupled receptor
def: "A protein that contains the 7 transmembrane receptor (secretin family) domain (Pfam:PF00002) and has an amino-terminal segment of about 50-80 residues that contains conserved disulfide bonds and participates in ligand binding." [PRO:WCB, PubMed:15862553]
synonym: "class 2 G protein-coupled receptor" BROAD [PubMed:15914470]
synonym: "subfamily B1 G protein-coupled receptor" EXACT [PubMed:11790261]
is_obsolete: true

[Term]
id: PRO:000001096
name: toll-like receptor
def: "A protein with a core domain composition consisting of a signal peptide, an extracellular domain with multiple Leu-rich repeats (LRR), a cysteine-rich region, a single-pass transmembrane domain and a C-terminal cytoplasmic tail containing a TIR domain (PF01582)." [PMID:11022119]
comment: Category=family.
xref: PIRSF:PIRSF800008
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001097
name: 2-oxoglutarate receptor 1
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the OXGR1 gene. The preferred ligand is 2-oxoglutarate (alpha-ketoglutarate)." [PRO:WCB]
comment: Category=gene.
synonym: "2-oxoglutarate receptor 1" EXACT []
synonym: "Alpha-ketoglutarate receptor 1" EXACT []
synonym: "G-protein coupled receptor 80" EXACT []
synonym: "G-protein coupled receptor 99" EXACT []
synonym: "GPR80" RELATED []
synonym: "Gpr99" RELATED []
synonym: "GPR99" RELATED []
synonym: "OXGR1" RELATED []
synonym: "Oxgr1" RELATED []
synonym: "P2RY15" RELATED []
synonym: "P2Y purinoceptor 15" EXACT []
synonym: "P2Y-like GPCR" EXACT []
synonym: "P2Y-like nucleotide receptor" EXACT []
synonym: "P2Y15" RELATED []
xref: PIRSF:PIRSF038614
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001098
name: 5-hydroxytryptamine receptor 1
def: "A rhodopsin-like G protein-coupled receptor that is the translation product of genes HTR1A, HTR1B, HTR1D, HTR1E or HTR1F. The preferred ligand is 5-hydroxytryptamine (serotonin)." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF005474
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001099
name: 5-hydroxytryptamine receptor 2
def: "A rhodopsin-like G protein-coupled receptor that is the translation product of genes HTR2A, HTR2B, or HTR2C. The preferred ligand is 5-hydroxytryptamine (serotonin)." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF038549
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001100
name: 5-hydroxytryptamine receptor 4
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the HTR4 gene. The preferred ligand is 5-hydroxytryptamine (serotonin)." [PRO:WCB]
comment: Category=gene.
synonym: "5-HT-4" EXACT []
synonym: "5-HT4" EXACT []
synonym: "5-hydroxytryptamine receptor 4" EXACT []
synonym: "Htr4" RELATED []
synonym: "HTR4" RELATED []
synonym: "Serotonin receptor 4" EXACT []
xref: PIRSF:PIRSF038635
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001101
name: 5-hydroxytryptamine receptor 5
def: "A rhodopsin-like G protein-coupled receptor that is the translation product of genes HTR5A or HTR5B. The preferred ligand is 5-hydroxytryptamine (serotonin)." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF038636
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001102
name: 5-hydroxytryptamine receptor 6
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the HTR6 gene. The preferred ligand is 5-hydroxytryptamine (serotonin)." [PRO:WCB]
comment: Category=gene.
synonym: "5-HT-6" EXACT []
synonym: "5-hydroxytryptamine receptor 6" EXACT []
synonym: "Htr6" RELATED []
synonym: "HTR6" RELATED []
synonym: "Serotonin receptor 6" EXACT []
xref: PIRSF:PIRSF038552
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001103
name: 5-hydroxytryptamine receptor 7
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the HTR7 gene. The preferred ligand is 5-hydroxytryptamine (serotonin)." [PRO:WCB]
comment: Category=gene.
synonym: "5-HT-7" EXACT []
synonym: "5-HT-X" EXACT []
synonym: "5-hydroxytryptamine receptor 7" EXACT []
synonym: "5HT7" EXACT []
synonym: "HTR7" RELATED []
synonym: "Htr7" RELATED []
synonym: "Serotonin receptor 7" EXACT []
xref: PIRSF:PIRSF038551
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001104
name: C3a anaphylatoxin chemotactic receptor
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the C3AR1 gene. The preferred ligand is C3a anaphylatoxin." [PRO:WCB]
comment: Category=gene.
synonym: "AZ3B" RELATED []
synonym: "C3a anaphylatoxin chemotactic receptor" EXACT []
synonym: "C3a-R" EXACT []
synonym: "C3AR" EXACT []
synonym: "C3AR1" RELATED []
synonym: "C3ar1" RELATED []
synonym: "C3R1" RELATED []
synonym: "C3r1" RELATED []
synonym: "Complement component 3a receptor 1" EXACT []
xref: PIRSF:PIRSF038663
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001105
name: C5a anaphylatoxin chemotactic receptor
def: "A rhodopsin-like G protein-coupled receptor whose active form binds C5a anaphylatoxin." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF038566
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001106
name: CD166 antigen
def: "A VVC2C2C2 Ig-like domain arrangement-containing protein that is a translation product of the ALCAM gene." [PRO:CNA]
comment: Category=gene.
synonym: "Activated leukocyte cell adhesion molecule" EXACT []
is_a: PRO:000001086 ! VVC2C2C2 Ig-like domain arrangement-containing protein

[Term]
id: PRO:000001107
name: D(1)-like dopamine receptor
def: "A rhodopsin-like G protein-coupled receptor that is a product of the DRD1 or DRD5 gene. The active form binds dopamine and its activity is mediated by G proteins that cause activation of adenylate cyclase." [PRO:WCB, Wikipedia:Dopamine_receptor]
comment: Category=family.
xref: PIRSF:PIRSF038629
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001108
name: D(2)-like dopamine receptor
def: "A rhodopsin-like G protein-coupled receptor that is a product of the DRD2, DRD3, or DRD4 gene. The active form binds dopamine and its activity is mediated by G proteins that cause inhibition of adenylate cyclase." [PRO:WCB, Wikipedia:Dopamine_receptor]
comment: Category=family.
xref: PIRSF:PIRSF038553
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001109
name: EBV-induced G protein-coupled receptor 2
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the EBI2 gene. It is currently classed as an orphan receptor." [PRO:WCB]
comment: Category=gene.
synonym: "Ebi2" RELATED []
synonym: "EBI2" EXACT []
synonym: "EBV-induced G-protein coupled receptor 2" EXACT []
synonym: "EBV-induced G-protein coupled receptor 2 homolog" EXACT []
xref: PIRSF:PIRSF038628
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001110
name: G protein-coupled bile acid receptor 1
def: "A rhodopsin-like G protein-coupled receptor 1 that is a translation product of the GPBAR1 gene. The preferred ligands are bile acids." [PRO:WCB]
comment: Category=gene.
synonym: "BG37" EXACT []
synonym: "G-protein coupled bile acid receptor 1" EXACT []
synonym: "GPBAR1" RELATED []
synonym: "Gpbar1" RELATED []
synonym: "hBG37" EXACT []
synonym: "hGPCR19" EXACT []
synonym: "M-BAR" EXACT []
synonym: "Membrane-type receptor for bile acids" EXACT []
synonym: "TGR5" RELATED []
synonym: "Tgr5" RELATED []
xref: PIRSF:PIRSF038592
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001111
name: G protein-coupled estrogen receptor 1
def: "A rhodopsin-like G protein-coupled receptor 1 that is a translation product of the GPER gene. The preferred ligand is estrogen." [PRO:WCB]
comment: Category=gene.
synonym: "CEPR" RELATED []
synonym: "Chemokine receptor-like 2" EXACT []
synonym: "CMKRL2" RELATED []
synonym: "Cmkrl2" RELATED []
synonym: "DRY12" RELATED []
synonym: "FEG-1" EXACT []
synonym: "Flow-induced endothelial G-protein coupled receptor 1" EXACT []
synonym: "G-protein coupled estrogen receptor 1" EXACT []
synonym: "G-protein coupled receptor 30" EXACT []
synonym: "GPCR-BR" EXACT []
synonym: "GPER" RELATED []
synonym: "Gper" RELATED []
synonym: "Gpr30" RELATED []
synonym: "GPR30" RELATED []
synonym: "IL8-related receptor DRY12" EXACT []
synonym: "LYGPR" EXACT []
synonym: "Lymphocyte-derived G-protein coupled receptor" EXACT []
synonym: "Membrane estrogen receptor" EXACT []
synonym: "mER" EXACT []
xref: PIRSF:PIRSF038579
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001112
name: G protein-coupled receptor 37-like 1
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the GPR37L1 gene. It is currently classed as an orphan receptor. Although about 50% identical to G protein-coupled receptor 37 over a carboxyl-terminal span of about 360 residues, the amino-terminal region of about 120 residues is dissimilar and about 120 residues shorter." [PRO:WCB]
comment: Category=gene.
synonym: "Endothelin B receptor-like protein 2 precursor" EXACT []
synonym: "ETBR-LP-2" EXACT []
synonym: "Etbrlp2" RELATED []
synonym: "ETBRLP2" RELATED []
synonym: "G-protein coupled receptor 37-like 1" EXACT []
synonym: "Gpr37l1" RELATED []
synonym: "GPR37L1" RELATED []
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001113
name: interleukin-17E
def: "An interleukin-17 that is a translation product of the IL25 gene." [PRO:CNA]
comment: Category=gene.
synonym: "IL-25" EXACT []
synonym: "Interleukin-25" EXACT []
is_a: PRO:000001092 ! interleukin-17

[Term]
id: PRO:000001114
name: T-cell surface antigen CD2 isoform 1
def: "A T-cell surface that is a translation product of a mature transcript of the CD2 gene, and contains a signal sequence, an extracellular domain containing a copy of the Ig-like V-type domain and the Ig-like C2-type domain, followed by a single-pass transmembrane domain and a cytoplasmic Pro-rich domain. This form represents the precursor. This form is represented by the human sequence UniProtKB:P06729-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000001083 ! T-cell surface glycoprotein CD2

[Term]
id: PRO:000001115
name: alpha-1 adrenergic receptor
def: "A rhodopsin-like G protein-coupled receptor whose active form binds adrenaline and related compounds and whose activity is mediated by G proteins that activate a phosphatidylinositol-calcium second messenger system." [PRO:WCB, Wikipedia:Adrenergic_receptor]
comment: Category=family.
xref: PIRSF:PIRSF038550
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001116
name: alpha-2 adrenergic receptor
def: "A rhodopsin-like G protein-coupled receptor whose active form binds adrenaline and related compounds and whose activity is mediated by G proteins that cause inhibition of adenylate cyclase." [PRO:WCB, Wikipedia:Adrenergic_receptor]
comment: Category=family.
xref: PIRSF:PIRSF038554
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001117
name: alpha-latrotoxin isoform 1
def: "An alpha-latrotoxin form that is represented by the black widow spider sequence UniProtKB:P23631-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000001088 ! alpha-latrotoxin

[Term]
id: PRO:000001118
name: angiotensin II receptor
def: "A rhodopsin-like G protein-coupled receptor whose active form binds anagiotensin II." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF038557
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001119
name: animal opsins
def: "A rhodopsin-like G protein-coupled receptor occurring in animals that binds a vitamin A-based retinaldehyde chromophore through a Schiff base linkage to a Lys residue in the seventh transmembrane alpha helix." [PRO:WCB, Wikipedia:Opsin]
comment: Category=family.
xref: PIRSF:PIRSF038544
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001120
name: apelin receptor
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the APLNR gene. The preferred ligand is apelin." [PRO:WCB]
comment: Category=gene.
synonym: "Agtrl1" RELATED []
synonym: "AGTRL1" RELATED []
synonym: "Angiotensin receptor-like 1" EXACT []
synonym: "Apelin receptor" EXACT []
synonym: "Apj" RELATED []
synonym: "APJ" RELATED []
synonym: "G-protein coupled receptor APJ" EXACT []
synonym: "HG11" EXACT []
synonym: "MSR" EXACT []
xref: PIRSF:PIRSF038558
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001121
name: beta adrenergic receptor
def: "A rhodopsin-like G protein-coupled receptor whose active form binds adrenaline and related compounds and whose activity is mediated by G proteins that cause activation of adenylate cyclase." [PRO:WCB, Wikipedia:Adrenergic_receptor]
comment: Category=family.
xref: PIRSF:PIRSF038556
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001122
name: bombesin receptor
def: "A rhodopsin-like G protein-coupled receptor whose active form binds bombesin (a 14 amino acid peptide originally isolated from the skin of a frog) or its homologs. Mammalian homologs of bombesin include gastrin-releasing peptide and neuromedin-B." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF038623
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001123
name: bradykinin receptor
def: "A rhodopsin-like G protein-coupled receptor whose active form binds bradykinin." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF038572
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001124
name: calcium-independent alpha-latrotoxin receptor
def: "A protein whose active form binds alpha-latrotoxin, an excitatory neurotoxin present in black widow spider venom." [PMID:11520923, PMID:1881448, PRO:CNA]
comment: Category=family.
synonym: "latrophilin" EXACT []
xref: PIRSF:PIRSF010401
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001125
name: cannabinoid receptor 1
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the CNR1 gene. Preferred ligands are cannabinoids--molecules related to tetrahydrocannabinol (THC), the psychoactive ingredient of cannabis. Endogenous cannabinoids serve as neurotransmitters. This receptor is expressed primarily in the brain." [PRO:WCB, Wikipedia:Cannabinoids]
comment: Category=gene.
synonym: "Brain-type cannabinoid receptor" EXACT []
synonym: "CANN6" EXACT []
synonym: "Cannabinoid receptor 1" EXACT []
synonym: "CB-R" EXACT []
synonym: "CB1" EXACT []
synonym: "CNR" RELATED []
synonym: "Cnr1" RELATED []
synonym: "CNR1" RELATED []
xref: PIRSF:PIRSF037995
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001126
name: cannabinoid receptor 2
def: "A cannabinoid receptor 2 that is a translation product of the CNR2 gene. Preferred ligands are cannabinoids--molecules related to tetrahydrocannabinol (THC), the psychoactive ingredient of cannabis. This receptor is expressed primarily in the immune system." [PRO:WCB]
comment: Category=gene.
synonym: "CB-2" EXACT []
synonym: "CB2" EXACT []
synonym: "CNR2" RELATED []
synonym: "Cnr2" RELATED []
synonym: "CX5" EXACT []
xref: PIRSF:PIRSF038633
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001127
name: cell surface glycoprotein MUC18
def: "A VVC2C2C2 Ig-like domain arrangement-containing protein that is a translation product of the MCAM gene." [PRO:CNA]
comment: Category=gene.
synonym: "CD146" RELATED []
synonym: "Gicerin" EXACT []
synonym: "Melanoma cell adhesion molecule" EXACT []
synonym: "Melanoma-associated antigen MUC18 " EXACT []
synonym: "MUC18" EXACT []
is_a: PRO:000001086 ! VVC2C2C2 Ig-like domain arrangement-containing protein

[Term]
id: PRO:000001128
name: chemokine receptor
def: "A rhodopsin-like G protein coupled receptor whose active form binds one or more chemokines. Only those that have been unequivocally shown to activate a G protein-coupled signaling pathway appear on the official IUPHAR list." [PRO:WCB, PubMed:12037138]
comment: Category=family.
xref: PIRSF:PIRSF038545
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001129
name: chemokine receptor-like protein CMKLR1
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the CMKLR1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Chemokine receptor-like 1" EXACT []
synonym: "CHEMR23" RELATED []
synonym: "Cmklr1" RELATED []
synonym: "CMKLR1" RELATED []
synonym: "Dez" RELATED []
synonym: "DEZ" RELATED []
synonym: "G-protein coupled receptor ChemR23" EXACT []
synonym: "G-protein coupled receptor DEZ" EXACT []
synonym: "Gpcr27" RELATED []
xref: PIRSF:PIRSF038564
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001130
name: cholecystokinin receptor
def: "A rhodopsin-like G protein-coupled receptor whose active form binds cholecystokinin (CCK)." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF038581
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001131
name: cysteinyl leukotriene receptor
def: "A rhodopsin-like G protein-coupled receptor whose active form binds cysteinyl leukotriene." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF038618
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001132
name: duffy antigen chemokine receptor
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the DARC gene. This is a non-specific, non-signaling chemokine receptor." [PRO:WCB]
comment: Category=gene.
synonym: "CD234" EXACT []
synonym: "DARC" RELATED []
synonym: "Darc" RELATED []
synonym: "Dfy" RELATED []
synonym: "Duffy antigen/chemokine receptor" EXACT []
synonym: "Fy" RELATED []
synonym: "FY" RELATED []
synonym: "Fy glycoprotein" EXACT []
synonym: "Glycoprotein D" EXACT []
synonym: "GPD" RELATED []
synonym: "GpFy" EXACT []
synonym: "Plasmodium vivax receptor" EXACT []
xref: PIRSF:PIRSF018556
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001133
name: endothelin receptor
def: "A rhodopsin-like G protein-coupled receptor whose active form binds endothelins." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF001842
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001134
name: growth hormone secretagogue/motilin receptor
def: "A rhodopsin-like G protein-coupled receptor whose active form binds either growth hormone secretagogues (principally ghrelin) or motilin. The motilin and ghrelin receptors are about 45% identical in amino acid sequence." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF038641
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001135
name: interleukin-1 alpha
def: "An interleukin-1 that is a translation product of the IL1A gene. Critical mediator of the immune and inflammatory responses." [PRO:CNA, Wikipedia:Interleukin_1]
comment: Category=gene.
synonym: "Hematopoietin-1" EXACT []
synonym: "IL-1A" EXACT []
synonym: "IL1F1" RELATED []
is_a: PRO:000001091 ! interleukin-1

[Term]
id: PRO:000001136
name: interleukin-1 beta
def: "An interleukin-1 that is a translation product of the IL1B gene." [PRO:CNA]
comment: Category=gene.
synonym: "IL-1B" EXACT []
is_a: PRO:000001091 ! interleukin-1

[Term]
id: PRO:000001137
name: interleukin-1 receptor antagonist protein
def: "An interleukin-1 receptor antagonist protein that is a translation product of the IL1RN gene. The active forms inhibits the activity of IL-1 by binding to its receptor." [PRO:CNA]
comment: Category=gene.
synonym: "IL-1RN" EXACT []
synonym: "IL1 inhibitor" EXACT []
synonym: "IL1F3" RELATED []
synonym: "IRAP" EXACT []
is_a: PRO:000001091 ! interleukin-1

[Term]
id: PRO:000001138
name: interleukin-17A
def: "An interleukin-17 that is a translation product of the IL17A gene. The active product is a proinflammatory cytokine produced by activated T cells. This cytokine regulates the activities of NF-kappaB and mitogen-activated protein kinases." [PRO:CNA, Wikipedia:IL17A]
comment: Category=gene.
synonym: "IL-17A" EXACT []
synonym: "IL17A" RELATED []
synonym: "interleukin 17" RELATED []
xref: PIRSF:PIRSF501045
is_a: PRO:000001092 ! interleukin-17

[Term]
id: PRO:000001139
name: interleukin-17B
def: "An interleukin-17 that is a translation product of the IL17B gene." [PRO:CNA]
comment: Category=gene.
synonym: "cytokine-like protein Zcyto7" EXACT []
synonym: "interleukin-20 " EXACT []
synonym: "neuronal interleukin-17-related factor" EXACT []
synonym: "Zcyto7" EXACT []
xref: PIRSF:PIRSF501047
is_a: PRO:000001092 ! interleukin-17

[Term]
id: PRO:000001140
name: interleukin-17C
def: "An interleukin-17 that is a translation product of the IL17C gene." [PRO:CNA]
comment: Category=gene.
synonym: "Cytokine CX2" EXACT []
synonym: "IL-17C" EXACT []
synonym: "IL17C" RELATED []
is_a: PRO:000001092 ! interleukin-17

[Term]
id: PRO:000001141
name: interleukin-17D
def: "An interleukin-17 that is a translation product of the IL17D gene." [PRO:CNA]
comment: Category=gene.
synonym: "IL-17D" EXACT []
synonym: "IL-27" EXACT []
synonym: "IL17D" RELATED []
synonym: "IL27" RELATED []
synonym: "Interleukin-27" EXACT []
is_a: PRO:000001092 ! interleukin-17

[Term]
id: PRO:000001142
name: interleukin-17F
def: "An interleukin-17 that is a translation product of the IL17F gene." [PRO:CNA]
comment: Category=gene.
synonym: "Cytokine ML-1" EXACT []
synonym: "IL-17F" EXACT []
synonym: "IL-24" EXACT []
synonym: "IL17F" RELATED []
synonym: "IL24" RELATED []
synonym: "Interleukin-24" EXACT []
xref: PIRSF:PIRSF501046
is_a: PRO:000001092 ! interleukin-17

[Term]
id: PRO:000001143
name: lutheran blood group glycoprotein
def: "A VVC2C2C2 Ig-like domain arrangement-containing protein that is a translation product of the BCAM gene." [PRO:CNA]
comment: Category=gene.
synonym: "Basal cell adhesion molecule" EXACT []
synonym: "CD239" EXACT []
synonym: "F8/G253 antigen " EXACT []
synonym: "Lutheran blood group glycoprotein " EXACT []
synonym: "lutheran glycoprotein" EXACT []
is_a: PRO:000001086 ! VVC2C2C2 Ig-like domain arrangement-containing protein

[Term]
id: PRO:000001144
name: melanin-concentrating hormone receptor 1
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the MCHR1 gene. The preferred ligand is melanin-concentrating hormone. This receptor is expressed in all mammals." [PRO:WCB, Wikipedia:Melanin-concentrating_hormone_receptor]
comment: Category=gene.
synonym: "G-protein coupled receptor 24" EXACT []
synonym: "GPR24" RELATED []
synonym: "Gpr24" RELATED []
synonym: "MCH receptor 1" EXACT []
synonym: "MCH-1R" EXACT []
synonym: "MCH-R1" EXACT []
synonym: "MCH1R" EXACT []
synonym: "MCHR" EXACT []
synonym: "MCHR-1" EXACT []
synonym: "MCHR1" RELATED []
synonym: "Mchr1" RELATED []
synonym: "Melanin-concentrating hormone receptor 1" EXACT []
synonym: "SLC-1" EXACT []
synonym: "SLC1" RELATED []
synonym: "Slc1" RELATED []
synonym: "Somatostatin receptor-like protein" EXACT []
xref: PIRSF:PIRSF038602
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001145
name: melanin-concentrating hormone receptor 2
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the MCHR2 gene. The preferred ligand is melanin-concentrating hormone. This receptor is expressed in humans and in some primates and carnivores." [PRO:WCB, Wikipedia:Melanin-concentrating_hormone_receptor]
comment: Category=gene.
synonym: "G-protein coupled receptor 145" EXACT []
synonym: "GPR145" RELATED []
synonym: "GPRv17" EXACT []
synonym: "MCH receptor 2" EXACT []
synonym: "MCH-2R" EXACT []
synonym: "MCH-R2" EXACT []
synonym: "MCH2" EXACT []
synonym: "MCH2R" EXACT []
synonym: "MCHR-2" EXACT []
synonym: "MCHR2" RELATED []
synonym: "Melanin-concentrating hormone receptor 2" EXACT []
synonym: "SLT" RELATED []
xref: PIRSF:PIRSF038603
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001146
name: melanocortin receptor
def: "A rhodopsin-like G protein-coupled receptor whose active form binds one or more melanocortins, the pituitary peptides ACTH and alpha-, beta-, and gamma-melanocyte-stimulating hormone." [PRO:WCB, Wikipedia:Melanocortin]
comment: Category=family.
xref: PIRSF:PIRSF005524
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001147
name: probable G protein-coupled receptor 123
def: "A protein that is a translation product of the GPR123 gene." [PRO:WCB]
comment: Category=gene.
synonym: "GPR123" RELATED []
synonym: "Gpr123" RELATED []
synonym: "KIAA1828" RELATED []
synonym: "mKIAA1828" RELATED []
synonym: "Probable G-protein coupled receptor 123" EXACT []
xref: PIRSF:PIRSF038687
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001148
name: probable G protein-coupled receptor 37
def: "An rhodopsin-like G protein-coupled receptor that is a translation product of the GPR37 gene. It is currently classed as an orphan receptor." [PRO:WCB]
comment: Category=gene.
synonym: "Endothelin B receptor-like protein 1" EXACT []
synonym: "ETBR-LP-1" EXACT []
synonym: "GPR37" RELATED []
synonym: "Gpr37" RELATED []
synonym: "PAELR" EXACT []
synonym: "Parkin-associated endothelin receptor-like receptor" EXACT []
synonym: "Probable G-protein coupled receptor 37" EXACT []
synonym: "Probable G-protein coupled receptor 37 precursor" EXACT []
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001149
name: probable G-protein coupled receptor 157
def: "A protein that is a translation product of the GPR157 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Gpr157" RELATED []
synonym: "GPR157" RELATED []
synonym: "Probable G-protein coupled receptor 157" EXACT []
synonym: "RP23-123I20.1-001" RELATED []
xref: PIRSF:PIRSF038116
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001150
name: tachykinin receptor
def: "A rhodopsin-like G protein-coupled receptor that binds tachykinin peptides--neuropeptides of 10-12 amino acids derived from the translation products of the TAC1 and TAC3 genes. Tachykinin receptors are not specific but have different affinities for the various peptides." [PRO:WCB, Wikipedia:tachykinin_peptides]
comment: Category=family.
xref: PIRSF:PIRSF001840
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001151
name: toll-like receptor 1
def: "A toll-like receptor that is a translation product of the TLR1 gene." [PRO:CNA]
comment: Category=gene.
synonym: "Toll-like receptor 1 precursor" EXACT []
is_a: PRO:000001096 ! toll-like receptor

[Term]
id: PRO:000001152
name: toll-like receptor 10
def: "A toll-like receptor that is a translation product of the TLR10 gene." [PRO:CNA]
comment: Category=gene.
synonym: "CD290" EXACT []
synonym: "TLR10" RELATED []
is_a: PRO:000001096 ! toll-like receptor

[Term]
id: PRO:000001153
name: toll-like receptor 2
def: "A toll-like receptor that is a translation product of the TLR2 gene." [PRO:CNA]
comment: Category=gene.
synonym: "Toll-like receptor 2 precursor" EXACT []
xref: PANTHER:PTHR23154\:SF63
is_a: PRO:000001096 ! toll-like receptor

[Term]
id: PRO:000001154
name: toll-like receptor 3
def: "A toll-like receptor that is a translation product of the TLR3 gene." [PRO:CNA]
comment: Category=gene.
synonym: "Toll-like receptor 3 precursor" EXACT []
xref: PANTHER:PTHR23154\:SF57
is_a: PRO:000001096 ! toll-like receptor

[Term]
id: PRO:000001155
name: toll-like receptor 4
def: "A toll-like receptor that is a translation product of the TLR4 gene." [PRO:CNA]
comment: Category=gene.
synonym: "Toll-like receptor 4 precursor" EXACT []
is_a: PRO:000001096 ! toll-like receptor

[Term]
id: PRO:000001156
name: toll-like receptor 5
def: "A toll-like receptor that is a translation product of the TLR5 gene." [PRO:CNA]
comment: Category=gene.
synonym: "Toll-like receptor 5 precursor" EXACT []
xref: PANTHER:PTHR23154\:SF61
is_a: PRO:000001096 ! toll-like receptor

[Term]
id: PRO:000001157
name: toll-like receptor 6
def: "A toll-like receptor that is a translation product of the TLR6 gene." [PRO:CNA]
comment: Category=gene.
synonym: "Toll-like receptor 6 precursor" EXACT []
is_a: PRO:000001096 ! toll-like receptor

[Term]
id: PRO:000001158
name: toll-like receptor 7
def: "A toll-like receptor that is a translation product of the TLR7 gene." [PRO:CNA]
comment: Category=gene.
synonym: "TLR7" RELATED []
xref: PANTHER:PTHR23154\:SF60
is_a: PRO:000001096 ! toll-like receptor

[Term]
id: PRO:000001159
name: toll-like receptor 8
def: "A toll-like receptor that is a translation product of the TLR8 gene." [PRO:CNA]
comment: Category=gene.
synonym: "Toll-like receptor 8" EXACT []
synonym: "Toll-like receptor 8 precursor" EXACT []
xref: PANTHER:PTHR23154\:SF59
is_a: PRO:000001096 ! toll-like receptor

[Term]
id: PRO:000001160
name: toll-like receptor 9
def: "A toll-like receptor that is a translation product of the TLR9 gene. Non-methylated CpG motifs, present in viral and bacterial DNA, are one of many pathogen-associated molecular patterns (PAMP) recognized by the mammalian innate immune system. Recognition of this PAMP occurs through a specific interaction with toll-like receptor 9 and this interaction can induce cytokine responses that influence both innate and adaptive immune responses." [PMID:11022119]
comment: Category=gene.
synonym: "Toll-like receptor 9" EXACT []
synonym: "Toll-like receptor 9 precursor" EXACT []
xref: PANTHER:PTHR23154\:SF58
is_a: PRO:000001096 ! toll-like receptor

[Term]
id: PRO:000001161
name: 5-hydroxytryptamine receptor 1A
def: "A 5-hydroxytryptamine receptor 1 that is a translation product of the HTR1A gene." [PRO:WCB]
comment: Category=gene.
synonym: "5-HT-1A" EXACT []
synonym: "5-HT1A" EXACT []
synonym: "5-hydroxytryptamine receptor 1A" EXACT []
synonym: "ADRB2RL1" RELATED []
synonym: "ADRBRL1" RELATED []
synonym: "G-21" EXACT []
synonym: "Gpcr18" RELATED []
synonym: "Htr1a" RELATED []
synonym: "HTR1A" RELATED []
synonym: "mCG_22910" RELATED []
synonym: "Serotonin receptor 1A" EXACT []
is_a: PRO:000001098 ! 5-hydroxytryptamine receptor 1

[Term]
id: PRO:000001162
name: 5-hydroxytryptamine receptor 1B
def: "A 5-hydroxytryptamine receptor 1 that is a translation product of the HTR1B gene." [PRO:WCB]
comment: Category=gene.
synonym: "5-HT-1B" EXACT []
synonym: "5-HT-1D-beta" EXACT []
synonym: "5-HT1B" EXACT []
synonym: "5-hydroxytryptamine receptor 1B" EXACT []
synonym: "5ht1b" RELATED []
synonym: "HTR1B" RELATED []
synonym: "Htr1b" RELATED []
synonym: "HTR1DB" RELATED []
synonym: "S12" EXACT []
synonym: "Serotonin 1D beta receptor" EXACT []
synonym: "Serotonin receptor 1B" EXACT []
is_a: PRO:000001098 ! 5-hydroxytryptamine receptor 1

[Term]
id: PRO:000001163
name: 5-hydroxytryptamine receptor 1D
def: "A 5-hydroxytryptamine receptor 1 that is a translation product of the HTR1D gene." [PRO:WCB]
comment: Category=gene.
synonym: "5-HT-1D" EXACT []
synonym: "5-HT-1D-alpha" EXACT []
synonym: "5-hydroxytryptamine receptor 1D" EXACT []
synonym: "Gpcr14" RELATED []
synonym: "Htr1d" RELATED []
synonym: "HTR1D" RELATED []
synonym: "HTR1DA" RELATED []
synonym: "HTRL" RELATED []
synonym: "RP23-32L5.3-001" RELATED []
synonym: "Serotonin receptor 1D" EXACT []
is_a: PRO:000001098 ! 5-hydroxytryptamine receptor 1

[Term]
id: PRO:000001164
name: 5-hydroxytryptamine receptor 1E
def: "A 5-hydroxytryptamine receptor 1 that is a translation product of the HTR1E gene." [PRO:WCB]
comment: Category=gene.
synonym: "5-HT-1E" EXACT []
synonym: "5-HT1E" EXACT []
synonym: "5-hydroxytryptamine receptor 1E" EXACT []
synonym: "HTR1E" RELATED []
synonym: "S31" EXACT []
synonym: "Serotonin receptor 1E" EXACT []
is_a: PRO:000001098 ! 5-hydroxytryptamine receptor 1

[Term]
id: PRO:000001165
name: 5-hydroxytryptamine receptor 1F
def: "A 5-hydroxytryptamine receptor 1 that is a translation product of the HTR1F gene." [PRO:WCB]
comment: Category=gene.
synonym: "5-HT-1E-beta" EXACT []
synonym: "5-HT-1F" EXACT []
synonym: "5-hydroxytryptamine receptor 1F" EXACT []
synonym: "5ht1f" RELATED []
synonym: "Htr1eb" RELATED []
synonym: "HTR1EL" RELATED []
synonym: "HTR1F" RELATED []
synonym: "Htr1f" RELATED []
synonym: "Serotonin receptor 1F" EXACT []
is_a: PRO:000001098 ! 5-hydroxytryptamine receptor 1

[Term]
id: PRO:000001166
name: 5-hydroxytryptamine receptor 2A
def: "A 5-hydroxytryptamine receptor 2 that is a translation product of the HTR2A gene." [PRO:WCB]
comment: Category=gene.
synonym: "5-HT-2" EXACT []
synonym: "5-HT-2A" EXACT []
synonym: "5-hydroxytryptamine receptor 2A" EXACT []
synonym: "Htr2" RELATED []
synonym: "HTR2" RELATED []
synonym: "HTR2A" RELATED []
synonym: "Htr2a" RELATED []
synonym: "Serotonin receptor 2A" EXACT []
is_a: PRO:000001099 ! 5-hydroxytryptamine receptor 2

[Term]
id: PRO:000001167
name: 5-hydroxytryptamine receptor 2B
def: "A 5-hydroxytryptamine receptor 2 that is a translation product of the HTR2B gene." [PRO:WCB]
comment: Category=gene.
synonym: "5-HT-2B" EXACT []
synonym: "5-HT-2F" EXACT []
synonym: "5-hydroxytryptamine receptor 2B" EXACT []
synonym: "Htr2b" RELATED []
synonym: "HTR2B" RELATED []
synonym: "NP75 protein" EXACT []
synonym: "Serotonin receptor 2B" EXACT []
is_a: PRO:000001099 ! 5-hydroxytryptamine receptor 2

[Term]
id: PRO:000001168
name: 5-hydroxytryptamine receptor 2C
def: "A 5-hydroxytryptamine receptor 2 that is a translation product of the HTR2C gene." [PRO:WCB]
comment: Category=gene.
synonym: "5-HT-2C" EXACT []
synonym: "5-HT2C" EXACT []
synonym: "5-HTR2C" EXACT []
synonym: "5-hydroxytryptamine receptor 2C" EXACT []
synonym: "5HT-1C" EXACT []
synonym: "5ht1c" RELATED []
synonym: "Htr1c" RELATED []
synonym: "HTR1C" RELATED []
synonym: "HTR2C" RELATED []
synonym: "Htr2c" RELATED []
synonym: "Serotonin receptor 2C" EXACT []
is_a: PRO:000001099 ! 5-hydroxytryptamine receptor 2

[Term]
id: PRO:000001169
name: 5-hydroxytryptamine receptor 5A
def: "A 5-hydroxytryptamine receptor 5 that is a translation product of the HTR5A gene." [PRO:WCB]
comment: Category=gene.
synonym: "5-HT-5" EXACT []
synonym: "5-HT-5A" EXACT []
synonym: "5-hydroxytryptamine receptor 5A" EXACT []
synonym: "5ht5a" RELATED []
synonym: "Htr5a" RELATED []
synonym: "HTR5A" RELATED []
synonym: "Serotonin receptor 5A" EXACT []
is_a: PRO:000001101 ! 5-hydroxytryptamine receptor 5

[Term]
id: PRO:000001170
name: 5-hydroxytryptamine receptor 5B
def: "A 5-hydroxytryptamine receptor 5 that is a translation product of the Htr5b gene. A human homolog has not been characterized." [PRO:WCB]
comment: Category=gene.
synonym: "5-HT-5B" EXACT []
synonym: "5-hydroxytryptamine receptor 5B" EXACT []
synonym: "5ht5b" RELATED []
synonym: "Htr5b" RELATED []
synonym: "Serotonin receptor 5B" EXACT []
is_a: PRO:000001101 ! 5-hydroxytryptamine receptor 5

[Term]
id: PRO:000001171
name: B1 bradykinin receptor
def: "A bradykinin receptor that is a translation product of the BDKRB1 gene. The preferred ligand is bradykinin." [PRO:WCB]
comment: Category=gene.
synonym: "B1 bradykinin receptor" EXACT []
synonym: "B1R" EXACT []
synonym: "Bdkrb" RELATED []
synonym: "BDKRB1" RELATED []
synonym: "Bdkrb1" RELATED []
synonym: "BK-1 receptor" EXACT []
synonym: "BRADYB1" RELATED []
is_a: PRO:000001123 ! bradykinin receptor

[Term]
id: PRO:000001172
name: B2 bradykinin receptor
def: "A bradykinin receptor that is a translation product of the BDKRB2 gene. The preferred ligand is bradykinin." [PRO:WCB]
comment: Category=gene.
synonym: "B2 bradykinin receptor" EXACT []
synonym: "B2R" EXACT []
synonym: "Bdkrb2" RELATED []
synonym: "BDKRB2" RELATED []
synonym: "BK-2 receptor" EXACT []
synonym: "BKR2" RELATED []
is_a: PRO:000001123 ! bradykinin receptor

[Term]
id: PRO:000001173
name: C5a anaphylatoxin chemotactic receptor C5AR1
def: "A C5a anaphylatoxin chemotactic receptor that is a translation product of the C5AR1 gene. The preferred ligand is C5a anaphylatoxin." [PRO:WCB]
comment: Category=gene.
synonym: "C5a anaphylatoxin chemotactic receptor" EXACT []
synonym: "C5a-R" EXACT []
synonym: "C5ar" RELATED []
synonym: "C5AR" RELATED []
synonym: "C5aR" EXACT []
synonym: "C5ar1" RELATED []
synonym: "C5AR1" RELATED []
synonym: "C5r1" RELATED []
synonym: "C5R1" RELATED []
synonym: "CD88" EXACT []
is_a: PRO:000001105 ! C5a anaphylatoxin chemotactic receptor

[Term]
id: PRO:000001174
name: C5a anaphylatoxin chemotactic receptor C5L2
def: "A C5a anaphylatoxin chemotactic receptor that is a translation product of the GPR77 (C5L2) gene. Preferred ligands are C5a, C4a and C3a and their desarginated derivatives. Couples weakly to Gi-mediated signaling pathways." [PRO:WCB, UniProtKB:Q9P296]
comment: Category=gene.
synonym: "C5a anaphylatoxin chemotactic receptor C5L2" EXACT []
synonym: "C5l2" RELATED []
synonym: "C5L2" RELATED []
synonym: "G-protein coupled receptor 77" EXACT []
synonym: "Gpr77" RELATED []
synonym: "GPR77" RELATED []
is_a: PRO:000001105 ! C5a anaphylatoxin chemotactic receptor

[Term]
id: PRO:000001175
name: D(1A) dopamine receptor
def: "A D(1)-like dopamine receptor that is a translation product of the DRD1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "D(1A) dopamine receptor" EXACT []
synonym: "D1dr" RELATED []
synonym: "DRD1" RELATED []
synonym: "Drd1" RELATED []
synonym: "Drd1a" RELATED []
synonym: "Gpcr15" RELATED []
is_a: PRO:000001107 ! D(1)-like dopamine receptor

[Term]
id: PRO:000001176
name: D(1B) dopamine receptor
def: "A D(1)-like dopamine receptor that is a translation product of the DRD5 gene." [PRO:WCB]
comment: Category=gene.
synonym: "D(1B) dopamine receptor" EXACT []
synonym: "D(5) dopamine receptor" EXACT []
synonym: "D1beta dopamine receptor" EXACT []
synonym: "DRD1B" RELATED []
synonym: "DRD1L2" RELATED []
synonym: "DRD5" RELATED []
synonym: "Drd5" RELATED []
is_a: PRO:000001107 ! D(1)-like dopamine receptor

[Term]
id: PRO:000001177
name: D(2) dopamine receptor
def: "A D(2)-like dopamine receptor that is a translation product of the DRD2 gene." [PRO:WCB]
comment: Category=gene.
synonym: "D(2) dopamine receptor" EXACT []
synonym: "Dopamine D2 receptor" EXACT []
synonym: "DRD2" RELATED []
synonym: "Drd2" RELATED []
is_a: PRO:000001108 ! D(2)-like dopamine receptor

[Term]
id: PRO:000001178
name: D(3) dopamine receptor
def: "A D(2)-like dopamine receptor that is a translation product of the DRD3 gene." [PRO:WCB]
comment: Category=gene.
synonym: "D(3) dopamine receptor" EXACT []
synonym: "Drd3" RELATED []
synonym: "DRD3" RELATED []
is_a: PRO:000001108 ! D(2)-like dopamine receptor

[Term]
id: PRO:000001179
name: D(4) dopamine receptor
def: "A D(2)-like dopamine receptor that is a translation product of the DRD4 gene." [PRO:WCB]
comment: Category=gene.
synonym: "D(2C) dopamine receptor" EXACT []
synonym: "D(4) dopamine receptor" EXACT []
synonym: "Dopamine D4 receptor" EXACT []
synonym: "Drd4" RELATED []
synonym: "DRD4" RELATED []
is_a: PRO:000001108 ! D(2)-like dopamine receptor

[Term]
id: PRO:000001180
name: G protein-coupled receptor PGR12
def: "An animal opsin that is a translation product of the OPN5 gene." [PRO:WCB]
comment: Category=gene.
synonym: "G-protein coupled receptor 136" EXACT []
synonym: "G-protein coupled receptor PGR12" EXACT []
synonym: "Gpr136" RELATED []
synonym: "GPR136" RELATED []
synonym: "Neuropsin" EXACT []
synonym: "Opn5" RELATED []
synonym: "OPN5" RELATED []
synonym: "Opsin-5" EXACT []
synonym: "Pgr12" RELATED []
synonym: "PGR12" RELATED []
synonym: "TMEM13" RELATED []
synonym: "Transmembrane protein 13" EXACT []
is_a: PRO:000001119 ! animal opsins

[Term]
id: PRO:000001181
name: T-cell surface antigen CD2 isoform 1 cleaved and glycosylated form
def: "A T-cell surface antigen CD2 isoform 1 that has been processed by proteolytic cleavage and has been post-translationally process to include glycosylated residues." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000001114 ! T-cell surface antigen CD2 isoform 1
intersection_of: has_modification MOD:00693 ! glycosylated residue
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000001182
name: adrenocorticotropic hormone receptor
def: "A melanocortin receptor that is a translation product of the MC2R gene. The preferred ligand is ACTH." [PRO:WCB]
comment: Category=gene.
synonym: "ACTH receptor" EXACT []
synonym: "ACTH-R" EXACT []
synonym: "ACTHR" RELATED []
synonym: "Acthr" RELATED []
synonym: "Adrenocorticotropic hormone receptor" EXACT []
synonym: "Adrenocorticotropin receptor" EXACT []
synonym: "MC2-R" EXACT []
synonym: "MC2R" RELATED []
synonym: "Mc2r" RELATED []
synonym: "Melanocortin receptor 2" EXACT []
is_a: PRO:000001146 ! melanocortin receptor

[Term]
id: PRO:000001183
name: alpha-1A adrenergic receptor
def: "An alpha-1 adrenergic receptor that is a translation product of the ADRA1A gene." [PRO:WCB]
comment: Category=gene.
synonym: "Adra1a" RELATED []
synonym: "ADRA1A" RELATED []
synonym: "Adra1c" RELATED []
synonym: "ADRA1C" RELATED []
synonym: "Alpha 1A-adrenoceptor" EXACT []
synonym: "Alpha 1A-adrenoreceptor" EXACT []
synonym: "Alpha-1A adrenergic receptor" EXACT []
synonym: "Alpha-1C adrenergic receptor" EXACT []
synonym: "Alpha-adrenergic receptor 1c" EXACT []
is_a: PRO:000001115 ! alpha-1 adrenergic receptor

[Term]
id: PRO:000001184
name: alpha-1B adrenergic receptor
def: "An alpha-1 adrenergic receptor that is a translation product of the ADRA1B gene." [PRO:WCB]
comment: Category=gene.
synonym: "Adra1b" RELATED []
synonym: "ADRA1B" RELATED []
synonym: "Alpha 1B-adrenoceptor" EXACT []
synonym: "Alpha 1B-adrenoreceptor" EXACT []
synonym: "Alpha-1B adrenergic receptor" EXACT []
is_a: PRO:000001115 ! alpha-1 adrenergic receptor

[Term]
id: PRO:000001185
name: alpha-1D adrenergic receptor
def: "An alpha-1 adrenergic receptor that is a translation product of the ADRA1D gene." [PRO:WCB]
comment: Category=gene.
synonym: "Adra1a" RELATED []
synonym: "ADRA1A" RELATED []
synonym: "ADRA1D" RELATED []
synonym: "Adra1d" RELATED []
synonym: "Alpha 1D-adrenoceptor" EXACT []
synonym: "Alpha 1D-adrenoreceptor" EXACT []
synonym: "Alpha-1A adrenergic receptor" EXACT []
synonym: "Alpha-1D adrenergic receptor" EXACT []
synonym: "Alpha-adrenergic receptor 1a" EXACT []
synonym: "Gpcr8" RELATED []
is_a: PRO:000001115 ! alpha-1 adrenergic receptor

[Term]
id: PRO:000001186
name: alpha-2A adrenergic receptor
def: "An alpha-2 adrenergic receptor that is a translation product of the ADRA2A gene." [PRO:WCB]
comment: Category=gene.
synonym: "Adra2a" RELATED []
synonym: "ADRA2A" RELATED []
synonym: "ADRA2R" RELATED []
synonym: "ADRAR" RELATED []
synonym: "Alpha-2 adrenergic receptor subtype C10" EXACT []
synonym: "Alpha-2A adrenergic receptor" EXACT []
synonym: "Alpha-2A adrenoceptor" EXACT []
synonym: "Alpha-2A adrenoreceptor" EXACT []
synonym: "Alpha-2AAR" EXACT []
is_a: PRO:000001116 ! alpha-2 adrenergic receptor

[Term]
id: PRO:000001187
name: alpha-2B adrenergic receptor
def: "An alpha-2 adrenergic receptor that is a translation product of the ADRA2B gene." [PRO:WCB]
comment: Category=gene.
synonym: "ADRA2B" RELATED []
synonym: "Adra2b" RELATED []
synonym: "ADRA2L1" RELATED []
synonym: "ADRA2RL1" RELATED []
synonym: "Alpha-2 adrenergic receptor subtype C2" EXACT []
synonym: "Alpha-2B adrenergic receptor" EXACT []
synonym: "Alpha-2B adrenoceptor" EXACT []
synonym: "Alpha-2B adrenoreceptor" EXACT []
is_a: PRO:000001116 ! alpha-2 adrenergic receptor

[Term]
id: PRO:000001188
name: alpha-2C adrenergic receptor
def: "An alpha-2 adrenergic receptor that is a translation product of the ADRA2C gene." [PRO:WCB]
comment: Category=gene.
synonym: "ADRA2C" RELATED []
synonym: "Adra2c" RELATED []
synonym: "ADRA2L2" RELATED []
synonym: "ADRA2RL2" RELATED []
synonym: "Alpha-2 adrenergic receptor subtype C4" EXACT []
synonym: "Alpha-2C adrenergic receptor" EXACT []
synonym: "Alpha-2C adrenoceptor" EXACT []
synonym: "Alpha-2C adrenoreceptor" EXACT []
is_a: PRO:000001116 ! alpha-2 adrenergic receptor

[Term]
id: PRO:000001189
name: alpha-latrotoxin isoform 1 cleaved form
def: "An alpha-latrotoxin isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000001117 ! alpha-latrotoxin isoform 1

[Term]
id: PRO:000001190
name: angiotensin II receptor 1
def: "An angiotensin II receptor that is a translation product of the AGTR1 or MTNR1B gene." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF501034
is_a: PRO:000001118 ! angiotensin II receptor

[Term]
id: PRO:000001191
name: angiotensin II receptor 2
def: "An angiotensin II receptor that is a translation product of the AGTR2 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Agtr2" RELATED []
synonym: "AGTR2" RELATED []
synonym: "AT2" EXACT []
synonym: "Type-2 angiotensin II receptor" EXACT []
xref: PIRSF:PIRSF501035
is_a: PRO:000001118 ! angiotensin II receptor

[Term]
id: PRO:000001192
name: beta-1 adrenergic receptor
def: "A beta adrenergic receptor that is a translation product of the ADRB1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "ADRB1" RELATED []
synonym: "Adrb1" RELATED []
synonym: "Adrb1r" RELATED []
synonym: "ADRB1R" RELATED []
synonym: "B1AR" RELATED []
synonym: "Beta-1 adrenergic receptor" EXACT []
synonym: "Beta-1 adrenoceptor" EXACT []
synonym: "Beta-1 adrenoreceptor" EXACT []
is_a: PRO:000001121 ! beta adrenergic receptor

[Term]
id: PRO:000001193
name: beta-2 adrenergic receptor
def: "A beta adrenergic receptor that is a translation product of the ADRB2 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Adrb2" RELATED []
synonym: "ADRB2" RELATED []
synonym: "Adrb2r" RELATED []
synonym: "ADRB2R" RELATED []
synonym: "B2AR" RELATED []
synonym: "Beta-2 adrenergic receptor" EXACT []
synonym: "Beta-2 adrenoceptor" EXACT []
synonym: "Beta-2 adrenoreceptor" EXACT []
is_a: PRO:000001121 ! beta adrenergic receptor

[Term]
id: PRO:000001194
name: beta-3 adrenergic receptor
def: "A beta adrenergic receptor that is a translation product of the ADRB3 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Adrb3" RELATED []
synonym: "ADRB3" RELATED []
synonym: "ADRB3R" RELATED []
synonym: "Adrb3r" RELATED []
synonym: "B3AR" RELATED []
synonym: "B3bar" RELATED []
synonym: "Beta-3 adrenergic receptor" EXACT []
synonym: "Beta-3 adrenoceptor" EXACT []
synonym: "Beta-3 adrenoreceptor" EXACT []
is_a: PRO:000001121 ! beta adrenergic receptor

[Term]
id: PRO:000001195
name: blue-sensitive opsin
def: "An animal opsin that is a translation product of the OPN1SW gene." [PRO:WCB]
comment: Category=gene.
synonym: "BCP" RELATED []
synonym: "Bcp" RELATED []
synonym: "Blue cone photoreceptor pigment" EXACT []
synonym: "Blue-sensitive opsin" EXACT []
synonym: "BOP" EXACT []
synonym: "OPN1SW" RELATED []
synonym: "Opn1sw" RELATED []
synonym: "S opsin" EXACT []
synonym: "Short wavelength-sensitive cone opsin" EXACT []
is_a: PRO:000001119 ! animal opsins

[Term]
id: PRO:000001196
name: bombesin receptor subtype-3
def: "A bombesin receptor that is a translation product of the BRS3 gene. It has low affinity for the known bombesin-related peptides and is currently classed as an orphan receptor." [PRO:WCB]
comment: Category=gene.
synonym: "Bombesin receptor subtype-3" EXACT []
synonym: "BRS-3" EXACT []
synonym: "Brs3" RELATED []
synonym: "BRS3" RELATED []
is_a: PRO:000001122 ! bombesin receptor

[Term]
id: PRO:000001197
name: chemokine receptor CCR1/3/1L
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the CCR1, CCR3, or CCR1L1 genes (the last found so far only in mouse)." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF501024
is_a: PRO:000001128 ! chemokine receptor

[Term]
id: PRO:000001198
name: chemokine receptor CCR10
def: "A chemokine receptor that is a translation product of the CCR10 gene. The preferred ligands are CCL27 and CCL28." [PRO:WCB, PubMed:10781587]
comment: Category=gene.
synonym: "C-C chemokine receptor type 10" EXACT []
synonym: "C-C CKR-10" EXACT []
synonym: "CC-CKR-10" EXACT []
synonym: "CCR-10" EXACT []
synonym: "CCR10" RELATED []
synonym: "Ccr10" RELATED []
synonym: "Chemokine C-C receptor 9" EXACT []
synonym: "Cmkbr9" RELATED []
synonym: "G-protein coupled receptor 2" EXACT []
synonym: "Gpr2" RELATED []
synonym: "GPR2" RELATED []
xref: PANTHER:PTHR19264\:SF249
is_a: PRO:000001128 ! chemokine receptor

[Term]
id: PRO:000001199
name: chemokine receptor CCR2
def: "A chemokine receptor that is a translation product of the CCR2 gene. The preferred ligands include CCL2, CCL7, CCL8, CCL13." [PRO:WCB, PubMed:12037138]
comment: Category=gene.
synonym: "C-C chemokine receptor type 2" EXACT []
synonym: "C-C CKR-2" EXACT []
synonym: "CC-CKR-2" EXACT []
synonym: "CCR-2" EXACT []
synonym: "Ccr2" RELATED []
synonym: "CCR2" RELATED []
synonym: "CD192" EXACT []
synonym: "Cmkbr2" RELATED []
synonym: "CMKBR2" RELATED []
synonym: "JE/FIC receptor" EXACT []
synonym: "mCG_16379" RELATED []
synonym: "MCP-1 receptor" EXACT []
synonym: "MCP-1-R" EXACT []
synonym: "Monocyte chemoattractant protein 1 receptor" EXACT []
is_a: PRO:000001128 ! chemokine receptor

[Term]
id: PRO:000001200
name: chemokine receptor CCR4
def: "A chemokine receptor that is a translation product of the CCR4 gene. The preferred ligands include CCL17 and CCL22." [PRO:WCB, PubMed:12037138]
comment: Category=gene.
synonym: "C-C chemokine receptor type 4" EXACT []
synonym: "C-C CKR-4" EXACT []
synonym: "CC-CKR-4" EXACT []
synonym: "CCR-4" EXACT []
synonym: "Ccr4" RELATED []
synonym: "CCR4" RELATED []
synonym: "CD194" EXACT []
synonym: "Cmkbr4" RELATED []
synonym: "CMKBR4" RELATED []
synonym: "K5-5" EXACT []
is_a: PRO:000001128 ! chemokine receptor

[Term]
id: PRO:000001201
name: chemokine receptor CCR5
def: "A chemokine receptor that is a translation product of the CCR5 gene. The preferred ligands include CCL3, CCL4, CCL5, CCL8, CCL14." [PRO:WCB, PubMed:12037138]
comment: Category=gene.
synonym: "C-C chemokine receptor type 5" EXACT []
synonym: "C-C CKR-5" EXACT []
synonym: "CC-CKR-5" EXACT []
synonym: "CCR-5" EXACT []
synonym: "Ccr5" RELATED []
synonym: "CCR5" RELATED []
synonym: "CD195" EXACT []
synonym: "CHEMR13" EXACT []
synonym: "Cmkbr5" RELATED []
synonym: "CMKBR5" RELATED []
synonym: "HIV-1 fusion coreceptor" EXACT []
synonym: "MIP-1 alpha receptor" EXACT []
is_a: PRO:000001128 ! chemokine receptor

[Term]
id: PRO:000001202
name: chemokine receptor CCR6
def: "A chemokine receptor that is a translation product of the CCR6 gene. The preferred ligand is CCL20." [PRO:WCB, PubMed:12037138]
comment: Category=gene.
synonym: "C-C chemokine receptor type 6" EXACT []
synonym: "C-C CKR-6" EXACT []
synonym: "CC-CKR-6" EXACT []
synonym: "CCR-6" EXACT []
synonym: "Ccr6" RELATED []
synonym: "CCR6" RELATED []
synonym: "CD196" EXACT []
synonym: "Chemokine receptor-like 3" EXACT []
synonym: "CKR-L3" EXACT []
synonym: "CKRL3" RELATED []
synonym: "Cmkbr6" RELATED []
synonym: "CMKBR6" RELATED []
synonym: "DRY6" EXACT []
synonym: "G-protein coupled receptor 29" EXACT []
synonym: "GPR-CY4" EXACT []
synonym: "GPR29" RELATED []
synonym: "GPRCY4" EXACT []
synonym: "KY411" EXACT []
synonym: "LARC receptor" EXACT []
synonym: "mCCR6" RELATED []
synonym: "STRL22" RELATED []
is_a: PRO:000001128 ! chemokine receptor

[Term]
id: PRO:000001203
name: chemokine receptor CCR7
def: "A chemokine receptor that is a translation product of the CCR7 gene. The preferred ligands are CCL19 and CCL21." [PRO:WCB, PubMed:12037138]
comment: Category=gene.
synonym: "BLR2" EXACT []
synonym: "C-C chemokine receptor type 7" EXACT []
synonym: "C-C chemokine receptor type 7 precursor" EXACT []
synonym: "C-C CKR-7" EXACT []
synonym: "CC-CKR-7" EXACT []
synonym: "CCR-7" EXACT []
synonym: "Ccr7" RELATED []
synonym: "CCR7" RELATED []
synonym: "CD197" EXACT []
synonym: "CDw197" EXACT []
synonym: "Cmkbr7" RELATED []
synonym: "CMKBR7" RELATED []
synonym: "EBI1" RELATED []
synonym: "Ebi1" RELATED []
synonym: "EBI1" EXACT []
synonym: "Ebi1h" RELATED []
synonym: "EBV-induced G-protein coupled receptor 1" EXACT []
synonym: "EVI1" RELATED []
synonym: "MIP-3 beta receptor" EXACT []
is_a: PRO:000001128 ! chemokine receptor

[Term]
id: PRO:000001204
name: chemokine receptor CCR8
def: "A chemokine receptor that is a translation product of the CCR8 gene. The preferred ligands include CCL1, CCL4, CCL17." [PRO:WCB, PubMed:12037138]
comment: Category=gene.
synonym: "C-C chemokine receptor type 8" EXACT []
synonym: "C-C CKR-8" EXACT []
synonym: "CC-chemokine receptor CHEMR1" EXACT []
synonym: "CC-CKR-8" EXACT []
synonym: "CCR-8" EXACT []
synonym: "Ccr8" RELATED []
synonym: "CCR8" RELATED []
synonym: "CDw198" EXACT []
synonym: "Chemokine receptor-like 1" EXACT []
synonym: "CKR-L1" EXACT []
synonym: "CKRL1" RELATED []
synonym: "CMKBR8" RELATED []
synonym: "Cmkbr8" RELATED []
synonym: "CMKBRL2" EXACT []
synonym: "GPR-CY6" EXACT []
synonym: "GPRCY6" EXACT []
synonym: "Ter1" RELATED []
synonym: "TER1" EXACT []
xref: PIRSF:PIRSF501026
is_a: PRO:000001128 ! chemokine receptor

[Term]
id: PRO:000001205
name: chemokine receptor CCR9
def: "A chemokine receptor that is a translation product of the CCR9 gene. The preferred ligand is CCL25." [PRO:WCB, PubMed:12037138]
comment: Category=gene.
synonym: "C-C chemokine receptor type 9" EXACT []
synonym: "C-C CKR-9" EXACT []
synonym: "CC-CKR-9" EXACT []
synonym: "CCR-9" EXACT []
synonym: "CCR9" RELATED []
synonym: "Ccr9" RELATED []
synonym: "CDw199" EXACT []
synonym: "Chemokine C-C receptor 10" EXACT []
synonym: "Cmkbr10" RELATED []
synonym: "CMKBR9" RELATED []
synonym: "G-protein coupled receptor 28" EXACT []
synonym: "GPR-9-6" EXACT []
synonym: "GPR28" RELATED []
xref: PANTHER:PTHR19264\:SF210
is_a: PRO:000001128 ! chemokine receptor

[Term]
id: PRO:000001206
name: chemokine receptor CX3CR1
def: "A chemokine receptor that is a translation product of the CX3CR1 gene. The preferred ligand is CX3CL1." [PRO:WCB, PubMed:12037138]
comment: Category=gene.
synonym: "Beta chemokine receptor-like 1" EXACT []
synonym: "C-X3-C CKR-1" EXACT []
synonym: "CMK-BRL-1" EXACT []
synonym: "CMKBLR1" EXACT []
synonym: "CMKBRL1" RELATED []
synonym: "CX3C chemokine receptor 1" EXACT []
synonym: "CX3CR1" RELATED []
synonym: "Cx3cr1" RELATED []
synonym: "Fractalkine receptor" EXACT []
synonym: "G-protein coupled receptor 13" EXACT []
synonym: "GPR13" RELATED []
synonym: "V28" EXACT []
xref: PIRSF:PIRSF501025
is_a: PRO:000001128 ! chemokine receptor

[Term]
id: PRO:000001207
name: chemokine receptor CXCR3
def: "A chemokine receptor that is a translation product of the CXCR3 gene. The preferred ligands include CXCL9, CXCL10, CXCL11." [PRO:WCB, PubMed:12037138]
comment: Category=gene.
synonym: "C-X-C chemokine receptor type 3" EXACT []
synonym: "CD183" EXACT []
synonym: "CKR-L2" EXACT []
synonym: "Cmkar3" RELATED []
synonym: "CXC-R3" EXACT []
synonym: "CXCR-3" EXACT []
synonym: "Cxcr3" RELATED []
synonym: "CXCR3" RELATED []
synonym: "G protein-coupled receptor 9" EXACT []
synonym: "GPR9" RELATED []
synonym: "Interferon-inducible protein 10 receptor" EXACT []
synonym: "IP-10 receptor" EXACT []
xref: PIRSF:PIRSF501023
is_a: PRO:000001128 ! chemokine receptor

[Term]
id: PRO:000001208
name: chemokine receptor CXCR4
def: "A chemokine receptor that is a translation product of the CXCR4 gene. The preferred ligand is CXCL12." [PRO:WCB, PubMed:12037138]
comment: Category=gene.
synonym: "C-X-C chemokine receptor type 4" EXACT []
synonym: "CD184" EXACT []
synonym: "Cmkar4" RELATED []
synonym: "CXC-R4" EXACT []
synonym: "CXCR-4" EXACT []
synonym: "CXCR4" RELATED []
synonym: "Cxcr4" RELATED []
synonym: "FB22" EXACT []
synonym: "Fusin" EXACT []
synonym: "HM89" EXACT []
synonym: "LCR1" EXACT []
synonym: "Lestr" RELATED []
synonym: "LESTR" EXACT []
synonym: "Leukocyte-derived seven transmembrane domain receptor" EXACT []
synonym: "NPYRL" EXACT []
synonym: "PB-CKR" EXACT []
synonym: "Pre-B-cell-derived chemokine receptor" EXACT []
synonym: "SDF-1 receptor" EXACT []
synonym: "Sdf1r" RELATED []
synonym: "Stromal cell-derived factor 1 receptor" EXACT []
xref: PIRSF:PIRSF501021
is_a: PRO:000001128 ! chemokine receptor

[Term]
id: PRO:000001209
name: chemokine receptor CXCR5
def: "A chemokine receptor that is a translation product of the CXCR5 gene. The preferred ligand is CXCL13." [PRO:WCB, PubMed:12037138]
comment: Category=gene.
synonym: "BLR1" RELATED []
synonym: "Blr1" RELATED []
synonym: "Burkitt lymphoma receptor 1" EXACT []
synonym: "Burkitt lymphoma receptor 1 homolog" EXACT []
synonym: "C-X-C chemokine receptor type 5" EXACT []
synonym: "CD185" EXACT []
synonym: "CXC-R5" EXACT []
synonym: "CXCR-5" EXACT []
synonym: "CXCR5" RELATED []
synonym: "Cxcr5" RELATED []
synonym: "Gpcr6" RELATED []
synonym: "mCG_10708" RELATED []
synonym: "MDR-15" EXACT []
synonym: "MDR15" RELATED []
synonym: "Monocyte-derived receptor 15" EXACT []
xref: PANTHER:PTHR19264\:SF213
is_a: PRO:000001128 ! chemokine receptor

[Term]
id: PRO:000001210
name: chemokine receptor CXCR6
def: "A chemokine receptor that is a translation product of the CXCR6 gene. The preferred ligand is CXCL16." [PRO:WCB, PubMed:12037138]
comment: Category=gene.
synonym: "BONZO" RELATED []
synonym: "C-X-C chemokine receptor type 6" EXACT []
synonym: "CD186" EXACT []
synonym: "CDw186" EXACT []
synonym: "CXC-R6" EXACT []
synonym: "CXCR-6" EXACT []
synonym: "Cxcr6" RELATED []
synonym: "CXCR6" RELATED []
synonym: "G-protein coupled receptor bonzo" EXACT []
synonym: "G-protein coupled receptor STRL33" EXACT []
synonym: "STRL33" RELATED []
synonym: "TYMSTR" RELATED []
xref: PANTHER:PTHR19264\:SF208
is_a: PRO:000001128 ! chemokine receptor

[Term]
id: PRO:000001211
name: chemokine receptor CXCR7
def: "A chemokine receptor CXCR7 that is a translation product of the CXCR7 gene. The preferred ligand may be CXCL12. No signaling pathway has been identified." [PRO:WCB, PubMed:16107333]
comment: Category=gene.
synonym: "C-X-C chemokine receptor type 7" EXACT []
synonym: "Chemokine orphan receptor 1" EXACT []
synonym: "Cmkor1" RELATED []
synonym: "CMKOR1" RELATED []
synonym: "CXC-R7" EXACT []
synonym: "CXCR-7" EXACT []
synonym: "CXCR7" RELATED []
synonym: "Cxcr7" RELATED []
synonym: "G-protein coupled receptor 159" EXACT []
synonym: "G-protein coupled receptor RDC1 homolog" EXACT []
synonym: "GPR159" RELATED []
synonym: "RDC-1" EXACT []
synonym: "Rdc1" RELATED []
synonym: "RDC1" RELATED []
xref: PIRSF:PIRSF501030
is_a: PRO:000001128 ! chemokine receptor

[Term]
id: PRO:000001212
name: chemokine receptor XCR1
def: "A chemokine receptor that is a translation product of the XCR1 gene. The preferred ligands are XCL1 and XCL2." [PRO:WCB, PubMed:12037138]
comment: Category=gene.
synonym: "CCXCR1" RELATED []
synonym: "Ccxcr1" RELATED []
synonym: "Chemokine XC receptor 1" EXACT []
synonym: "G-protein coupled receptor 5" EXACT []
synonym: "GPR5" RELATED []
synonym: "Lymphotactin receptor" EXACT []
synonym: "mXCR1" EXACT []
synonym: "SCM1 receptor" EXACT []
synonym: "XC chemokine receptor 1" EXACT []
synonym: "Xcr1" RELATED []
synonym: "XCR1" RELATED []
xref: PANTHER:PTHR19264\:SF260
is_a: PRO:000001128 ! chemokine receptor

[Term]
id: PRO:000001213
name: chemokine receptor-like protein CCRL1
def: "A chemokine receptor that is a translation product of the CCRL1 gene. The preferred ligands may be CCL19, CCL21, CCL25. This is a non-signaling chemokine receptor." [PRO:WCB]
comment: Category=gene.
synonym: "C-C chemokine receptor type 11" EXACT []
synonym: "C-C CKR-11" EXACT []
synonym: "CC chemokine receptor-like 1" EXACT []
synonym: "CC-CKR-11" EXACT []
synonym: "CCBP2" RELATED []
synonym: "CCR-11" EXACT []
synonym: "CCR11" RELATED []
synonym: "Ccr11" RELATED []
synonym: "CCRL1" RELATED []
synonym: "Ccrl1" RELATED []
synonym: "CCX CKR" EXACT []
synonym: "VSHK1" RELATED []
xref: PIRSF:PIRSF501028
is_a: PRO:000001128 ! chemokine receptor

[Term]
id: PRO:000001214
name: chemokine receptor-like protein CCRL2
def: "A chemokine receptor that is a translation product of the CCRL2 gene. The preferred ligands may be CCL2, CCL5, CCL7, CCL8. The signaling pathway is not known." [PRO:WCB, PubMed:12885941]
comment: Category=gene.
synonym: "C-C chemokine receptor-like 2" EXACT []
synonym: "CCR11" RELATED []
synonym: "Ccr11" RELATED []
synonym: "CCR6" RELATED []
synonym: "CCRL2" RELATED []
synonym: "Ccrl2" RELATED []
synonym: "Chemokine receptor CCR11" EXACT []
synonym: "Chemokine receptor X" EXACT []
synonym: "CKRX" RELATED []
synonym: "CRAM" RELATED []
synonym: "G-protein coupled beta chemokine receptor" EXACT []
synonym: "HCR" RELATED []
synonym: "L-CCR" EXACT []
synonym: "Lccr" RELATED []
synonym: "Lipopolysacharide-inducible C-C chemokine receptor" EXACT []
synonym: "Putative MCP-1 chemokine receptor" EXACT []
xref: PIRSF:PIRSF501027
is_a: PRO:000001128 ! chemokine receptor

[Term]
id: PRO:000001215
name: chemokine-binding protein 2
def: "A chemokine receptor that is a translation product of the CCBP2 gene. The preferred ligands may be CCL2, CCL3, CCL5, CCL7. The signaling pathway is not known." [PRO:WCB, PubMed:9405404]
comment: Category=gene.
synonym: "C-C chemokine receptor D6" EXACT []
synonym: "CCBP2" RELATED []
synonym: "Ccbp2" RELATED []
synonym: "CCR10" RELATED []
synonym: "Chemokine receptor CCR-10" EXACT []
synonym: "Chemokine receptor CCR-9" EXACT []
synonym: "Chemokine-binding protein 2" EXACT []
synonym: "Chemokine-binding protein D6" EXACT []
synonym: "CMKBR9" RELATED []
synonym: "D6" RELATED []
xref: PIRSF:PIRSF501029
is_a: PRO:000001128 ! chemokine receptor

[Term]
id: PRO:000001216
name: cholecystokinin receptor 1
def: "A cholecystokinin receptor that is a translation product of the CCKAR gene. The preferred ligand is sulfated CCK, which is bound with a 500- to 1000-fold higher affinity than sulfated gastrin or nonsulfated CCK." [PRO:WCB, PubMed:10581329]
comment: Category=gene.
synonym: "CCK-A receptor" EXACT []
synonym: "CCK-AR" EXACT []
synonym: "CCK1-R" EXACT []
synonym: "Cckar" RELATED []
synonym: "CCKAR" RELATED []
synonym: "CCKRA" RELATED []
synonym: "Cholecystokinin receptor type A" EXACT []
synonym: "Cholecystokinin-1 receptor" EXACT []
is_a: PRO:000001130 ! cholecystokinin receptor

[Term]
id: PRO:000001217
name: cholecystokinin receptor 2
def: "A cholecystokinin receptor that is a translation product of the CCKBR gene. The active receptor binds sulfated and non-sulfated forms of gastrin and CCK and their analogs." [PRO:WCB, PubMed:10581329]
comment: Category=gene.
synonym: "CCK-B receptor" EXACT []
synonym: "CCK-BR" EXACT []
synonym: "CCK2-R" EXACT []
synonym: "Cckbr" RELATED []
synonym: "CCKBR" RELATED []
synonym: "CCKRB" RELATED []
synonym: "Cholecystokinin-2 receptor" EXACT []
synonym: "Gastrin/cholecystokinin type B receptor" EXACT []
is_a: PRO:000001130 ! cholecystokinin receptor

[Term]
id: PRO:000001218
name: cysteinyl leukotriene receptor 1
def: "A cysteinyl leukotriene receptor that is a translation product of the CYSLTR1 gene. The preferred ligand is the cysteinyl leukotriene D4." [PRO:WCB]
comment: Category=gene.
synonym: "Cyslt1" RELATED []
synonym: "CYSLT1" RELATED []
synonym: "Cyslt1r" RELATED []
synonym: "CYSLTR1" RELATED []
synonym: "Cysltr1" RELATED []
synonym: "CysLTR1" EXACT []
synonym: "Cysteinyl leukotriene D4 receptor" EXACT []
synonym: "Cysteinyl leukotriene receptor 1" EXACT []
synonym: "HG55" EXACT []
synonym: "HMTMF81" EXACT []
synonym: "LTD4 receptor" EXACT []
is_a: PRO:000001131 ! cysteinyl leukotriene receptor

[Term]
id: PRO:000001219
name: cysteinyl leukotriene receptor 2
def: "A cysteinyl leukotriene receptor that is a translation product of the CYSLTR2 gene. The preferred ligand is the cysteinyl leukotriene C4." [PRO:WCB]
comment: Category=gene.
synonym: "Cyslt2" RELATED []
synonym: "CYSLT2" RELATED []
synonym: "CYSLT2R" RELATED []
synonym: "CYSLTR2" RELATED []
synonym: "Cysltr2" RELATED []
synonym: "CysLTR2" EXACT []
synonym: "Cysteinyl leukotriene receptor 2" EXACT []
synonym: "HG57" EXACT []
is_a: PRO:000001131 ! cysteinyl leukotriene receptor

[Term]
id: PRO:000001220
name: encephalopsin
def: "An animal opsin that is a translation product of the OPN3 gene." [PRO:WCB]
comment: Category=gene.
synonym: "ECPN" RELATED []
synonym: "Ecpn" RELATED []
synonym: "Encephalopsin" EXACT []
synonym: "OPN3" RELATED []
synonym: "Opn3" RELATED []
synonym: "Opsin-3" EXACT []
synonym: "Panopsin" EXACT []
is_a: PRO:000001119 ! animal opsins

[Term]
id: PRO:000001221
name: endothelin receptor A
def: "An endothelin receptor that is a translation product of the EDNRA gene. The active form binds endothelin 1 (ET-1) and ET-2 with much higher affinity than ET-3." [PRO:WCB, PubMed:12037137]
comment: Category=gene.
synonym: "Ednra" RELATED []
synonym: "EDNRA" RELATED []
synonym: "Endothelin A receptor" EXACT []
synonym: "Endothelin-1 receptor" EXACT []
synonym: "Endothelin-1 receptor precursor" EXACT []
synonym: "ET-A" EXACT []
synonym: "ET-AR" EXACT []
synonym: "ETA" RELATED []
synonym: "ETA-R" EXACT []
synonym: "ETRA" RELATED []
synonym: "Gpcr10" RELATED []
synonym: "hET-AR" EXACT []
is_a: PRO:000001133 ! endothelin receptor

[Term]
id: PRO:000001222
name: endothelin receptor B
def: "An endothelin receptor that is a translation product of the EDNRB gene. The active form binds endothelin 1 (ET-1), ET-2, and ET-3 with equal affinity." [PRO:WCB, PubMed:12037137]
comment: Category=gene.
synonym: "EDNRB" RELATED []
synonym: "Ednrb" RELATED []
synonym: "Endothelin B receptor" EXACT []
synonym: "Endothelin B receptor precursor" EXACT []
synonym: "Endothelin receptor Non-selective type" EXACT []
synonym: "ET-B" EXACT []
synonym: "ETRB" RELATED []
is_a: PRO:000001133 ! endothelin receptor

[Term]
id: PRO:000001223
name: gastrin-releasing peptide receptor
def: "A bombesin receptor that is a translation product of the GRPR gene. The preferred ligand is gastrin releasing peptide." [PRO:WCB]
comment: Category=gene.
synonym: "Gastrin-releasing peptide receptor" EXACT []
synonym: "GRP-preferring bombesin receptor" EXACT []
synonym: "GRP-R" RELATED []
synonym: "Grpr" RELATED []
synonym: "GRPR" RELATED []
is_a: PRO:000001122 ! bombesin receptor

[Term]
id: PRO:000001224
name: green-sensitive opsin
def: "An animal opsin that is a translation product of the OPN1MW gene." [PRO:WCB]
comment: Category=gene.
synonym: "Gcp" RELATED []
synonym: "GCP" RELATED []
synonym: "Green cone photoreceptor pigment" EXACT []
synonym: "Green-sensitive opsin" EXACT []
synonym: "M opsin" EXACT []
synonym: "Medium wavelength-sensitive cone opsin" EXACT []
synonym: "Opn1mw" RELATED []
synonym: "OPN1MW" RELATED []
synonym: "OPN1MW2" RELATED []
is_a: PRO:000001119 ! animal opsins

[Term]
id: PRO:000001225
name: growth hormone secretagogue receptor
def: "A growth hormone secretagogue/motilin receptor that is a translation product of the GHSR gene. Although its preferred ligand is ghrelin, it also binds other growth hormone releasing peptides and some nonpeptide ligands." [PRO:WCB, Wikipedia:growth_hormone_secretagogue_receptor]
comment: Category=gene.
synonym: "GH-releasing peptide receptor" EXACT []
synonym: "Ghrelin receptor" EXACT []
synonym: "GHS-R" EXACT []
synonym: "GHSR" RELATED []
synonym: "Ghsr" RELATED []
synonym: "GHSR" EXACT []
synonym: "Ghsr" EXACT []
synonym: "Growth hormone secretagogue receptor type 1" EXACT []
synonym: "mCG_49508" RELATED []
xref: PANTHER:PTHR19264\:SF266
is_a: PRO:000001134 ! growth hormone secretagogue/motilin receptor

[Term]
id: PRO:000001226
name: high affinity interleukin-8 receptor
def: "A chemokine receptor whose active form binds interleukin-8 with high affinity." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF501022
is_a: PRO:000001128 ! chemokine receptor

[Term]
id: PRO:000001227
name: interleukin-1 alpha isoform 1
def: "An interleukin-1 alpha that is a translation product of the mature transcript of IL1A gene, and includes the N-terminal propeptide region and the IL1 domain. This form is represented by the human sequence UniProtKB:P01583-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000001135 ! interleukin-1 alpha

[Term]
id: PRO:000001228
name: interleukin-1 receptor antagonist protein isoform 1
def: "An interleukin-1 receptor antagonist protein that is a translation product of the mature transcript of IL1RN gene, that includes the signal peptide. This form is represented by the human sequence UniProtKB:P18510-1." [PMID:2139180, PRO:CNA]
comment: Category=sequence.
synonym: "sIL-1ra" EXACT []
is_a: PRO:000001137 ! interleukin-1 receptor antagonist protein

[Term]
id: PRO:000001229
name: interleukin-1 receptor antagonist protein isoform 2
def: "An interleukin-1 receptor antagonist protein that is a translation product of the mature transcript of IL1RN gene, that lacks the signal peptide. This form is represented by the human sequence UniProtKB:P18510-2." [PMID:1827201]
comment: Category=sequence.
synonym: "icIL-1ra" RELATED []
is_a: PRO:000001137 ! interleukin-1 receptor antagonist protein

[Term]
id: PRO:000001230
name: interleukin-1 receptor antagonist protein isoform 3
def: "An interleukin-1 receptor antagonist protein that is a translation product of the mature transcript of IL1RN gene, that lacks the signal peptide, but includes a sequence of about 21 residues rich in Gly and Glu residues. This form is represented by the human sequence UniProtKB:P18510-3." [PMID:7629520]
comment: Category=sequence.
synonym: "icIL-1ra type II" EXACT []
is_a: PRO:000001137 ! interleukin-1 receptor antagonist protein

[Term]
id: PRO:000001231
name: interleukin-1 receptor antagonist protein isoform 4
def: "An interleukin-1 receptor antagonist protein that is a translation product of the mature transcript of IL1RN gene, that lacks the N-terminal region of about 34 residues, including the signal peptide. This form is represented by the human sequence UniProtKB:P18510-4." [PMID:9514884]
comment: Category=sequence.
is_a: PRO:000001137 ! interleukin-1 receptor antagonist protein

[Term]
id: PRO:000001232
name: interleukin-17A isoform 1
def: "An interleukin-17A that is a translation product of a mature transcript of the IL17A gene represented by the human sequence UniProtKB:Q16552-1. This form is the precursor." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000001138 ! interleukin-17A

[Term]
id: PRO:000001233
name: latrophilin-1
def: "A calcium-independent alpha-latrotoxin receptor that is a translation product of the LPHN1 gene." [PRO:CNA]
comment: Category=gene.
synonym: "Calcium-independent alpha-latrotoxin receptor 1" EXACT []
synonym: "Cirl1" RELATED []
synonym: "LEC2" RELATED []
synonym: "Lectomedin-2" EXACT []
synonym: "LPHN1" RELATED []
is_a: PRO:000001124 ! calcium-independent alpha-latrotoxin receptor

[Term]
id: PRO:000001234
name: latrophilin-2
def: "A calcium-independent alpha-latrotoxin receptor type that is a translation product of the LPHN2 gene." [PRO:CNA]
comment: Category=gene.
synonym: "Calcium-independent alpha-latrotoxin receptor 2" EXACT []
synonym: "Latrophilin homolog 1" EXACT []
synonym: "LEC1" RELATED []
synonym: "Lectomedin-1" EXACT []
synonym: "LPHH1" RELATED []
synonym: "LPHN2" RELATED []
is_a: PRO:000001124 ! calcium-independent alpha-latrotoxin receptor

[Term]
id: PRO:000001235
name: latrophilin-3
def: "A calcium-independent alpha-latrotoxin receptor that is a translation product of the LPHN3 gene." [PRO:CNA]
comment: Category=gene.
synonym: "Calcium-independent alpha-latrotoxin receptor 3" EXACT []
synonym: "LEC3" RELATED []
synonym: "Lectomedin-3" EXACT []
synonym: "LPHN3" RELATED []
is_a: PRO:000001124 ! calcium-independent alpha-latrotoxin receptor

[Term]
id: PRO:000001236
name: melanocortin receptor 3
def: "A melanocortin receptor that is a translation product of the MC3R gene." [PRO:WCB]
comment: Category=gene.
synonym: "MC3-R" EXACT []
synonym: "Mc3r" RELATED []
synonym: "MC3R" RELATED []
synonym: "Melanocortin receptor 3" EXACT []
is_a: PRO:000001146 ! melanocortin receptor

[Term]
id: PRO:000001237
name: melanocortin receptor 4
def: "A melanocortin receptor that is a translation product of the MC4R gene." [PRO:WCB]
comment: Category=gene.
synonym: "MC4-R" EXACT []
synonym: "MC4R" RELATED []
synonym: "Mc4r" RELATED []
synonym: "Melanocortin receptor 4" EXACT []
xref: PIRSF:PIRSF501014
is_a: PRO:000001146 ! melanocortin receptor

[Term]
id: PRO:000001238
name: melanocortin receptor 5
def: "A melanocortin receptor that is a translation product of the MC5R gene." [PRO:WCB]
comment: Category=gene.
synonym: "MC-2" EXACT []
synonym: "MC5-R" EXACT []
synonym: "Mc5r" RELATED []
synonym: "MC5R" RELATED []
synonym: "Melanocortin receptor 5" EXACT []
is_a: PRO:000001146 ! melanocortin receptor

[Term]
id: PRO:000001239
name: melanocyte-stimulating hormone receptor
def: "A melanocortin receptor that is a translation product of the MC1R gene." [PRO:WCB]
comment: Category=gene.
synonym: "MC1-R" EXACT []
synonym: "MC1R" RELATED []
synonym: "Mc1r" RELATED []
synonym: "Melanocortin receptor 1" EXACT []
synonym: "Melanocyte-stimulating hormone receptor" EXACT []
synonym: "Melanotropin receptor" EXACT []
synonym: "Msh-r" RELATED []
synonym: "MSH-R" EXACT []
synonym: "MSHR" RELATED []
is_a: PRO:000001146 ! melanocortin receptor

[Term]
id: PRO:000001240
name: motilin receptor
def: "A growth hormone secretagogue/motilin receptor that is a translation product of the MLNR gene. The preferred ligand is motilin, an intestinal peptide that stimulates contraction of gut smooth muscle." [PRO:WCB, Wikipedia:motilin_receptor]
comment: Category=gene.
synonym: "G-protein coupled receptor 38" EXACT []
synonym: "GPR38" RELATED []
synonym: "GPR38" EXACT []
synonym: "MLNR" RELATED []
synonym: "Motilin receptor" EXACT []
synonym: "MTLR" RELATED []
synonym: "MTLR1" RELATED []
xref: PANTHER:PTHR19264\:SF82
is_a: PRO:000001134 ! growth hormone secretagogue/motilin receptor

[Term]
id: PRO:000001241
name: neuromedin-B receptor
def: "A bombesin receptor that is a translation product of the NMBR gene. The preferred ligand is neuromedin-B." [PRO:WCB]
comment: Category=gene.
synonym: "Neuromedin-B receptor" EXACT []
synonym: "Neuromedin-B-preferring bombesin receptor" EXACT []
synonym: "NMB-R" EXACT []
synonym: "NMBR" RELATED []
synonym: "Nmbr" RELATED []
is_a: PRO:000001122 ! bombesin receptor

[Term]
id: PRO:000001242
name: neuromedin-K receptor
def: "A tachykinin receptor that is a translation product of the TACR3 gene. The preferred ligand is neurokinin B, also known as neuromedin-K." [PRO:WCB, Wikipedia:tachykinin_peptides, Wikipedia:tachykinin_receptor]
comment: Category=gene.
synonym: "Neurokinin B receptor" EXACT []
synonym: "Neuromedin-K receptor" EXACT []
synonym: "NK-3 receptor" EXACT []
synonym: "NK-3R" EXACT []
synonym: "NK3R" EXACT []
synonym: "NKR" EXACT []
synonym: "Tac3r" RELATED []
synonym: "TAC3R" RELATED []
synonym: "Tachykinin receptor 3" EXACT []
synonym: "Tacr3" RELATED []
synonym: "TACR3" RELATED []
xref: PIRSF:PIRSF501016
is_a: PRO:000001150 ! tachykinin receptor

[Term]
id: PRO:000001243
name: opsin-4
def: "An animal opsin that is a translation product of the OPN4 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Melanopsin" EXACT []
synonym: "MOP" RELATED []
synonym: "Mop" RELATED []
synonym: "Mopn" RELATED []
synonym: "Opn4" RELATED []
synonym: "OPN4" RELATED []
synonym: "Opsin-4" EXACT []
is_a: PRO:000001119 ! animal opsins

[Term]
id: PRO:000001244
name: red-sensitive opsin
def: "An animal opsin that is a translation product of the OPN1LW gene." [PRO:WCB]
comment: Category=gene.
synonym: "OPN1LW" RELATED []
synonym: "RCP" RELATED []
synonym: "Red cone photoreceptor pigment" EXACT []
synonym: "Red-sensitive opsin" EXACT []
is_a: PRO:000001119 ! animal opsins

[Term]
id: PRO:000001245
name: rhodopsin
def: "An animal opsin that is a translation product of the RHO gene." [PRO:WCB]
comment: Category=gene.
synonym: "OPN2" RELATED []
synonym: "Opsin-2" EXACT []
synonym: "RHO" RELATED []
synonym: "Rho" RELATED []
synonym: "Rhodopsin" EXACT []
is_a: PRO:000001119 ! animal opsins

[Term]
id: PRO:000001246
name: substance-K receptor
def: "A tachkinin receptor that is a translation product of the TACR2 gene. The preferred ligand is neurokinin A, also known as substance-K." [PRO:WCB, Wikipedia:tachykinin_peptides, Wikipedia:tachykinin_receptor]
comment: Category=gene.
synonym: "Neurokinin A receptor" EXACT []
synonym: "NK-2 receptor" EXACT []
synonym: "NK-2R" EXACT []
synonym: "NK2R" EXACT []
synonym: "NKNAR" EXACT []
synonym: "SKR" EXACT []
synonym: "Substance-K receptor" EXACT []
synonym: "Tac2r" RELATED []
synonym: "TAC2R" RELATED []
synonym: "Tachykinin receptor 2" EXACT []
synonym: "TACR2" RELATED []
synonym: "Tacr2" RELATED []
xref: PANTHER:PTHR19264\:SF104
xref: PIRSF:PIRSF501017
is_a: PRO:000001150 ! tachykinin receptor

[Term]
id: PRO:000001247
name: substance-P receptor
def: "A tachykinin receptor that is a translation product of the TACR1 gene. The preferred ligand is substance-P." [PRO:WCB, Wikipedia:tachykinin_receptor]
comment: Category=gene.
synonym: "NK-1 receptor" EXACT []
synonym: "NK-1R" EXACT []
synonym: "NK1R" EXACT []
synonym: "SPR" EXACT []
synonym: "Substance-P receptor" EXACT []
synonym: "Tac1r" RELATED []
synonym: "TAC1R" RELATED []
synonym: "Tachykinin receptor 1" EXACT []
synonym: "TACR1" RELATED []
synonym: "Tacr1" RELATED []
xref: PIRSF:PIRSF501015
is_a: PRO:000001150 ! tachykinin receptor

[Term]
id: PRO:000001248
name: visual pigment-like receptor peropsin
def: "An animal opsin that is a translation product of the RRH gene." [PRO:WCB]
comment: Category=gene.
synonym: "Rrh" RELATED []
synonym: "RRH" RELATED []
synonym: "Visual pigment-like receptor peropsin" EXACT []
is_a: PRO:000001119 ! animal opsins

[Term]
id: PRO:000001249
name: T-cell surface antigen CD2 isoform 1 cleaved and glycosylated 1
def: "A T-cell surface antigen CD2 isoform 1 cleaved and glycosylated form that is the mature protein. The N-glycosylation seems to be essential for adhesion functions. Example:P06729-1 (25-359), has_modification MOD:00160 N4-glycosyl-L-asparagine, Asn-89." [PMID:1385399]
comment: Category=modification.
is_a: PRO:000001181 ! T-cell surface antigen CD2 isoform 1 cleaved and glycosylated form

[Term]
id: PRO:000001250
name: alpha-latrotoxin isoform 1 cleaved 1
def: "An alpha-latrotoxin isoform 1 whose signal peptide has been removed and represents the secreted form." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000001189 ! alpha-latrotoxin isoform 1 cleaved form

[Term]
id: PRO:000001251
name: angiotensin II receptor 1A
def: "An angiotensin II receptor 1 that is a translation product of the AGTR1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Agtr1" RELATED []
synonym: "AGTR1" RELATED []
synonym: "Agtr1a" RELATED []
synonym: "AGTR1A" RELATED []
synonym: "AGTR1B" RELATED []
synonym: "AT1" EXACT []
synonym: "AT1A" EXACT []
synonym: "AT1AR" EXACT []
synonym: "AT1BR" EXACT []
synonym: "AT2R1" RELATED []
synonym: "AT2R1B" RELATED []
synonym: "Type-1 angiotensin II receptor" EXACT []
synonym: "Type-1A angiotensin II receptor" EXACT []
is_a: PRO:000001190 ! angiotensin II receptor 1

[Term]
id: PRO:000001252
name: angiotensin II receptor 1B
def: "An angiotensin II receptor 1 that is a translation product of the MTNR1B gene." [PRO:WCB]
comment: Category=gene.
synonym: "Agtr1b" RELATED []
synonym: "AT1B" EXACT []
synonym: "AT3" EXACT []
synonym: "Type-1B angiotensin II receptor" EXACT []
is_a: PRO:000001190 ! angiotensin II receptor 1

[Term]
id: PRO:000001253
name: chemokine receptor 1-like protein CCR1L1
def: "A chemokine receptor CCR1/3/1L that is a translation product of the CCR1L1 gene. A human homolog has not been characterized." [PRO:WCB]
comment: Category=gene.
synonym: "C-C chemokine receptor 1-like protein 1" EXACT []
synonym: "Ccr1l1" RELATED []
synonym: "Cmkbr1l1" RELATED []
synonym: "Macrophage inflammatory protein 1 alpha receptor-like 1" EXACT []
is_a: PRO:000001197 ! chemokine receptor CCR1/3/1L

[Term]
id: PRO:000001254
name: chemokine receptor CCR1
def: "A chemokine receptor CCR1/3/1L that is a translation product of the CCR1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "C-C chemokine receptor type 1" EXACT []
synonym: "C-C CKR-1" EXACT []
synonym: "CC-CKR-1" EXACT []
synonym: "CCR-1" EXACT []
synonym: "Ccr1" RELATED []
synonym: "CCR1" RELATED []
synonym: "CD191" EXACT []
synonym: "CMKBR1" RELATED []
synonym: "Cmkbr1" RELATED []
synonym: "CMKR1" RELATED []
synonym: "HM145" EXACT []
synonym: "LD78 receptor" EXACT []
synonym: "Macrophage inflammatory protein 1-alpha receptor" EXACT []
synonym: "MIP-1 alpha R" RELATED []
synonym: "MIP-1alpha-R" EXACT []
synonym: "RANTES-R" EXACT []
synonym: "SCYAR1" RELATED []
is_a: PRO:000001197 ! chemokine receptor CCR1/3/1L

[Term]
id: PRO:000001255
name: chemokine receptor CCR3
def: "A chemokine receptor CCR1/3/1L that is a translation product of the CCR3 gene." [PRO:WCB, PubMed:12037138]
comment: Category=gene.
synonym: "C-C chemokine receptor type 3" EXACT []
synonym: "C-C CKR-3" EXACT []
synonym: "CC-CKR-3" EXACT []
synonym: "CCR-3" EXACT []
synonym: "Ccr3" RELATED []
synonym: "CCR3" RELATED []
synonym: "CD193" EXACT []
synonym: "CKR3" EXACT []
synonym: "Cmkbr1l2" RELATED []
synonym: "CMKBR3" RELATED []
synonym: "Cmkbr3" RELATED []
synonym: "Eosinophil eotaxin receptor" EXACT []
synonym: "Eotaxin receptor (Chemokine (C-C motif) receptor 3) (Adult male aorta and vein cDNA, RIKEN full-length enriched library, clone:A530083H05 product:chemokine (C-C) receptor 3, full insert sequence" EXACT []
synonym: "Macrophage inflammatory protein 1-alpha receptor-like 2" EXACT []
synonym: "MIP-1 alpha RL2" EXACT []
synonym: "Probable C-C chemokine receptor type 3" EXACT []
is_a: PRO:000001197 ! chemokine receptor CCR1/3/1L

[Term]
id: PRO:000001256
name: high affinity interleukin-8 receptor A
def: "A high affinity interleukin-8 receptor that is a translation product of the IL8RA gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD181" EXACT []
synonym: "CDw128a" EXACT []
synonym: "chemokine receptor CXCR1" EXACT []
synonym: "CMKAR1" RELATED []
synonym: "CXCR-1" EXACT []
synonym: "Cxcr1" RELATED []
synonym: "CXCR1" RELATED []
synonym: "high affinity interleukin-8 receptor A" EXACT []
synonym: "IL-8 receptor type 1" EXACT []
synonym: "IL-8R A" EXACT []
synonym: "IL8RA" RELATED []
synonym: "Il8ra" RELATED []
is_a: PRO:000001226 ! high affinity interleukin-8 receptor

[Term]
id: PRO:000001257
name: high affinity interleukin-8 receptor B
def: "A high affinity interleukin-8 receptor that is a translation product of the IL8RB gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD182" EXACT []
synonym: "CDw128b" EXACT []
synonym: "chemokine receptor CXCR2" EXACT []
synonym: "Cmkar2" RELATED []
synonym: "CXCR-2" EXACT []
synonym: "Cxcr2" RELATED []
synonym: "CXCR2" RELATED []
synonym: "Gpcr16" RELATED []
synonym: "GRO/MGSA receptor" EXACT []
synonym: "High affinity interleukin-8 receptor B" EXACT []
synonym: "IL-8 receptor type 2" EXACT []
synonym: "IL-8R B" EXACT []
synonym: "IL8RB" RELATED []
synonym: "Il8rb" RELATED []
is_a: PRO:000001226 ! high affinity interleukin-8 receptor

[Term]
id: PRO:000001258
name: interleukin-1 alpha isoform 1 cleaved form
def: "An interleukin-1 alpha isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000001227 ! interleukin-1 alpha isoform 1
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000001259
name: interleukin-1 alpha isoform 1 myristoylated form
def: "An interleukin-1 isoform 1 that has been co-translationally modified to include a myristoylated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000001227 ! interleukin-1 alpha isoform 1
intersection_of: has_modification MOD:00438 ! myristoylated residue

[Term]
id: PRO:000001260
name: interleukin-1 alpha isoform 1 phosphorylated form
def: "An interleukin-1 isoform 1 that has been post-translationally modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000001227 ! interleukin-1 alpha isoform 1
intersection_of: has_modification MOD:00696 ! phosphorylated residue

[Term]
id: PRO:000001261
name: interleukin-1 receptor antagonist protein isoform 1 cleaved form
def: "An interleukin-1 receptor antagonist protein isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000001228 ! interleukin-1 receptor antagonist protein isoform 1
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000001262
name: interleukin-17A isoform 1 cleaved form
def: "An interleukin-17A isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000001232 ! interleukin-17A isoform 1

[Term]
id: PRO:000001263
name: latrophilin-1 isoform 1
def: "A latrophilin-1 that is a translation product of a mature transcript of the LPHN1 gene, represented by the rat sequence UniProtKB:O88917-1." [PRO:CNA]
comment: Category=sequence.
synonym: "CL1BB" EXACT []
is_a: PRO:000001233 ! latrophilin-1

[Term]
id: PRO:000001264
name: latrophilin-1 isoform 2
def: "A latrophilin-1 that is a translation product of a mature transcript of the LPHN1 gene, represented by the rat sequence UniProtKB:O88917-2." [PRO:CNA]
comment: Category=sequence.
synonym: "CL1AA" RELATED []
is_a: PRO:000001233 ! latrophilin-1

[Term]
id: PRO:000001265
name: latrophilin-1 isoform 3
def: "A latrophilin-1 that is a translation product of a mature transcript of the LPHN1 gene, represented by the rat sequence UniProtKB:O88917-3." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000001233 ! latrophilin-1

[Term]
id: PRO:000001266
name: latrophilin-1 isoform 4
def: "A latrophilin-1 that is a translation product of a mature transcript of the LPHN1 gene, represented by the rat sequence UniProtKB:O88917-4." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000001233 ! latrophilin-1

[Term]
id: PRO:000001267
name: interleukin-1 alpha isoform 1 cleaved 1
def: "An interleukin-1 alpha isoform 1 cleaved form that is a mature peptide." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000001258 ! interleukin-1 alpha isoform 1 cleaved form

[Term]
id: PRO:000001268
name: interleukin-1 alpha isoform 1 myristoylated 1
def: "An interleukin-1 alpha isoform 1 myristoylated form with an N6-myristoyl Lys residue in the second Lys of the propeptide region." [PMID:8346241]
comment: Category=modification.
is_a: PRO:000001259 ! interleukin-1 alpha isoform 1 myristoylated form

[Term]
id: PRO:000001269
name: interleukin-1 alpha isoform 1 myristoylated 2
def: "An interleukin-1 alpha isoform 1 myristoylated form with an N6-myristoyl Lys residue in the first Lys of the propeptide region." [PMID:8346241]
comment: Category=modification.
is_a: PRO:000001259 ! interleukin-1 alpha isoform 1 myristoylated form

[Term]
id: PRO:000001270
name: interleukin-1 alpha isoform 1 phosphorylated 1
def: "An interleukin-1 isoform 1 phosphorylated form that has been phosphorylated at a Ser residue within the propeptide region. Example: UniProtKB:P01582-1, has_modification MOD:00046 O-phospho-L-serine, Ser-90." [PMID:3126184, PMID:3258335]
comment: Category=modification.
is_a: PRO:000001260 ! interleukin-1 alpha isoform 1 phosphorylated form

[Term]
id: PRO:000001271
name: interleukin-1 receptor antagonist protein isoform 1 cleaved 1
def: "An interleukin-1 receptor antagonist protein isoform 1 cleaved form that is a mature peptide." [PMID:2139180]
comment: Category=modification.
is_a: PRO:000001261 ! interleukin-1 receptor antagonist protein isoform 1 cleaved form

[Term]
id: PRO:000001272
name: interleukin-17A isoform 1 cleaved 1
def: "An interleukin-17A isoform 1 cleaved form that has been processed to the mature form by removal of the signal peptide." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000001262 ! interleukin-17A isoform 1 cleaved form

[Term]
id: PRO:000001273
name: latrophilin-1 isoform 4 cleaved form
def: "A latrophilin-1 isoform 4 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000001266 ! latrophilin-1 isoform 4

[Term]
id: PRO:000001274
name: latrophilin-1 isoform 4 cleaved 1
def: "A latrophilin-1 isoform 4 cleaved form whose signal peptide has been removed and is the N-terminal product of the cleavage upstream a Thr residue within the GPS domain, corresponding to Thr-838 in the rat sequence UniProtKB:O88917-4. This form remains non-covalently bound to C-terminal product." [PMID:12270923]
comment: Category=modification.
synonym: "p120" EXACT []
is_a: PRO:000001273 ! latrophilin-1 isoform 4 cleaved form

[Term]
id: PRO:000001275
name: latrophilin-1 isoform 4 cleaved 2
def: "A latrophilin-1 isoform 4 cleaved form that is the C-terminal product of the cleavage upstream a Thr residue within the GPS domain, corresponding to Thr-838 in the rat sequence UniProtKB:O88917-4." [PMID:12270923]
comment: Category=modification.
synonym: "p85" RELATED []
is_a: PRO:000001273 ! latrophilin-1 isoform 4 cleaved form

[Term]
id: PRO:000001276
name: anti-Muellerian hormone isoform 1 cleaved form
comment: Category=modification.
intersection_of: PRO:000000220 ! anti-Muellerian hormone isoform 1
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000001277
name: anti-Muellerian hormone isoform 1 cleaved 1
def: "An anti-Muellerian hormone isoform 1 cleaved form that has been cleaved after the signal peptide and also at the RxxR dibasic cleavage site releasing the propeptide. This form is the mature protein." [PMID:8755541, PRO:CNA]
comment: Category=modification.
is_a: PRO:000001276 ! anti-Muellerian hormone isoform 1 cleaved form

[Term]
id: PRO:000001278
name: ADAM 10 endopeptidase
def: "A protein that is a translation product of the ADAM10 gene." [PRO:WCB]
comment: Category=gene.
synonym: "A disintegrin and metalloproteinase domain 10" EXACT []
synonym: "ADAM10" RELATED []
synonym: "CD156c antigen" EXACT []
synonym: "CDw156" EXACT []
synonym: "KUZ" RELATED []
synonym: "Kuzbanian protein homolog" EXACT []
synonym: "MADM" RELATED []
synonym: "Mammalian disintegrin-metalloprotease" EXACT []
synonym: "Myelin-associated disintegrin metalloproteinase" RELATED []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001279
name: ADAM 17 endopeptidase
def: "A protein that is a translation product of the ADAM17 gene." [PRO:WCB]
comment: Category=gene.
synonym: "A disintegrin and metalloproteinase domain 17" EXACT []
synonym: "ADAM 17 endopeptidase" EXACT []
synonym: "ADAM17" RELATED []
synonym: "CD156b antigen" EXACT []
synonym: "CSVP" RELATED []
synonym: "Snake venom-like protease" EXACT []
synonym: "TACE" RELATED []
synonym: "TNF-alpha convertase" EXACT []
synonym: "TNF-alpha-converting enzyme" EXACT []
synonym: "Tumor necrosis factor alpha-converting enzyme" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001280
name: ADAM 8 endopeptidase
def: "A protein that is a translation product of the ADAM8 gene." [PRO:WCB]
comment: Category=gene.
synonym: "A disintegrin and metalloproteinase domain 8" EXACT []
synonym: "ADAM 8 endopeptidase" EXACT []
synonym: "ADAM8" RELATED []
synonym: "CD156a antigen" EXACT []
synonym: "Cell surface antigen MS2" EXACT []
synonym: "Macrophage cysteine-rich glycoprotein" EXACT []
synonym: "MS2" RELATED []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001281
name: ADP-ribosyl cyclase
def: "A protein that contains the ADP-ribosyl cyclase domain (PF02267)." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF005736
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001282
name: ALK receptor tyrosine kinase
def: "A protein that is a translation product of the ALK gene." [PRO:WCB]
comment: Category=gene.
synonym: "ALK" EXACT []
synonym: "ALK tyrosine kinase receptor" EXACT []
synonym: "Anaplastic lymphoma kinase" EXACT []
synonym: "CD246 antigen" EXACT []
synonym: "Ki-1" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001283
name: ATP-binding cassette sub-family G member 2
def: "A protein that is a translation product of the ABCG2 gene." [PRO:WCB]
comment: Category=gene.
synonym: "ABCG2" RELATED []
synonym: "ABCP" RELATED []
synonym: "BCRP" RELATED []
synonym: "BCRP1" RELATED []
synonym: "Breast cancer resistance protein" EXACT []
synonym: "CD338 antigen" EXACT []
synonym: "CDw338" EXACT []
synonym: "Mitoxantrone resistance-associated protein" EXACT []
synonym: "MXR" RELATED []
synonym: "Placenta-specific ATP-binding cassette transporter" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001284
name: B- and T-lymphocyte attenuator
def: "A protein that is a translation product of the BTLA gene." [PRO:WCB]
comment: Category=gene.
synonym: "B- and T-lymphocyte attenuator " EXACT []
synonym: "B- and T-lymphocyte-associated protein" EXACT []
synonym: "BTLA" RELATED []
synonym: "CD272 antigen" EXACT []
xref: PIRSF:PIRSF038341
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001285
name: B-cell antigen receptor complex-associated protein alpha-chain
def: "A protein that is a translation product of the CD79A gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD79A" RELATED []
synonym: "CD79a antigen" EXACT []
synonym: "Ig-alpha" EXACT []
synonym: "IGA" RELATED []
synonym: "MB-1 membrane glycoprotein" EXACT []
synonym: "MB1" RELATED []
synonym: "Membrane-bound immunoglobulin-associated protein" EXACT []
synonym: "Surface IgM-associated protein" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001286
name: B-cell antigen receptor complex-associated protein beta-chain
def: "A protein that is a translation product of the CD79B gene." [PRO:WCB]
comment: Category=gene.
synonym: "B-cell-specific glycoprotein B29" EXACT []
synonym: "B29" RELATED []
synonym: "CD79B" RELATED []
synonym: "CD79b antigen" RELATED []
synonym: "IG-beta" EXACT []
synonym: "IGB" RELATED []
synonym: "Immunoglobulin-associated B29 protein" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001287
name: B-cell differentiation antigen CD72
def: "A protein that is a translation product of the CD72 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD72" RELATED []
synonym: "CD72 antigen" EXACT []
synonym: "Ly-32" EXACT []
synonym: "Ly32" RELATED []
synonym: "Lyb-2" EXACT []
synonym: "Lymphocyte antigen 32" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001288
name: B-cell receptor CD22
def: "A protein that is a translation product of the CD22 gene." [PRO:WCB]
comment: Category=gene.
synonym: "B-lymphocyte cell adhesion molecule" EXACT []
synonym: "BL-CAM" EXACT []
synonym: "CD22" RELATED []
synonym: "CD22 antigen" EXACT []
synonym: "Leu-14" EXACT []
synonym: "Sialic acid-binding Ig-like lectin 2" EXACT []
synonym: "Siglec-2" EXACT []
synonym: "SIGLEC2" RELATED []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001289
name: B-cell surface antigen CD20
def: "A protein that is a translation product of the MS4A1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "B-lymphocyte antigen CD20" EXACT []
synonym: "B1" EXACT []
xref: PIRSF:PIRSF001995
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001290
name: B7-related protein
def: "A protein that is a member of a family that includes translation products of genes CD86, CD276, ICOSLG, and others. These are membrane-anchored proteins with a small intracellular domain and an extracellular domain with signal sequence, an Immunoglobulin V-set domain (PF07686), and a CD80-like C2-set immunoglobulin domain (PF08205)." [PRO:WCB]
comment: Category=family.
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001291
name: C-type asialoglycoprotein receptor
def: "A protein that is an integral membrane protein and is responsible for the clearance of desialylated, galactose-terminal glycoproteins from the circulation by receptor-mediated endocytosis. It can be subdivided into four functional domains: the cytosolic domain, the transmembrane domain, the stalk and the carbohydrate recognition domain (CRD). The functional receptor, a galactose lectin, is an oligomer of two types of similar polypeptide chains, each of which weakly binds galactose. High-affinity binding of complex oligosaccharides requires a precise geometric arrangement of receptor subunits. The two subunits have different functions in receptor assembly, ligand binding and endocytosis." [PMID:10891274, PMID:1785139]
comment: Category=family.
xref: PIRSF:PIRSF002424
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001292
name: C-type lectin domain family 4 member C
def: "A protein that is a translation product of the CLEC4C gene." [PRO:WCB]
comment: Category=gene.
synonym: "BDCA-2" EXACT []
synonym: "BDCA2" RELATED []
synonym: "Blood dendritic cell antigen 2 protein" EXACT []
synonym: "C-type lectin superfamily member 7" EXACT []
synonym: "CD303" EXACT []
synonym: "CD303 antigen" RELATED []
synonym: "CLEC4C" RELATED []
synonym: "CLECSF11" RELATED []
synonym: "Dendritic lectin" EXACT []
synonym: "DLEC" RELATED []
synonym: "HECL" RELATED []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001293
name: C-type lectin domain family 4 member K
def: "A protein that is a translation product of the CD207 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD207" RELATED []
synonym: "CD207 antigen" EXACT []
synonym: "CLEC4K" EXACT []
synonym: "Langerin" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001294
name: C-type lectin domain family 4 member M
def: "A protein that is a translation product of the CLEC4M gene. This gene and CD209 are products of a recent gene duplication in the primate lineage. Independent duplications of an ancestral gene have given rise to several orthologs in rodents, including CD209A." [PRO:WCB]
comment: Category=gene.
synonym: "CD209 antigen-like protein 1" EXACT []
synonym: "CD209L" RELATED []
synonym: "CD209L1" RELATED []
synonym: "CD299" RELATED []
synonym: "CD299 antigen" EXACT []
synonym: "CLEC4M" RELATED []
synonym: "DC-SIGN-related protein" EXACT []
synonym: "DC-SIGN2" EXACT []
synonym: "DC-SIGNR" EXACT []
synonym: "Dendritic cell-specific ICAM-3-grabbing non-integrin 2" EXACT []
synonym: "L-SIGN" EXACT []
synonym: "Liver/lymph node-specific ICAM- 3-grabbing non-integrin" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001295
name: CAMPATH-1 antigen
def: "A protein that is a translation product of the CD52 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Cambridge pathology 1 antigen" EXACT []
synonym: "CAMPATH-1 antigen " EXACT []
synonym: "CD52" RELATED []
synonym: "CD52 antigen" EXACT []
synonym: "CDW52" RELATED []
synonym: "CDw52" EXACT []
synonym: "Epididymal secretory protein E5" EXACT []
synonym: "HE5" RELATED []
synonym: "Lymphocyte differentiation antigen B7" EXACT []
synonym: "Mb7" RELATED []
xref: PIRSF:PIRSF038743
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001296
name: CD109 antigen
def: "A protein that is a translation product of the CD109 gene." [PRO:WCB]
comment: Category=gene.
synonym: "150 KDa TGF-beta-1-binding protein" EXACT []
synonym: "C3 and PZP-like alpha-2-macroglobulin domain-containing protein 7" EXACT []
synonym: "CD109" RELATED []
synonym: "CD109 antigen" EXACT []
synonym: "CPAMD7" RELATED []
synonym: "p180" EXACT []
synonym: "Platelet-specific Gov antigen" EXACT []
synonym: "r150" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001297
name: CD177 antigen
def: "A protein that is a translation product of the CD177 gene. The mouse protein has 4 copies of the u-PAR/Ly-6 domain (PF00021), whereas the human sequence has 2." [PRO:WCB]
comment: Category=gene.
synonym: "CD177" RELATED []
synonym: "CD177 antigen " EXACT []
synonym: "HNA- 2a" EXACT []
synonym: "Human neutrophil alloantigen 2a" EXACT []
synonym: "NB1" RELATED []
synonym: "NB1 glycoprotein" EXACT []
synonym: "NB1 GP" EXACT []
synonym: "Polycythemia rubra vera protein 1" EXACT []
synonym: "PRV-1" EXACT []
synonym: "PRV1" RELATED []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001298
name: CD180 antigen
def: "A protein that is a translation product of the CD180 gene." [PMID:8741667, PRO:WCB]
comment: Category=gene.
synonym: "CD180" EXACT []
synonym: "LY-78" EXACT []
synonym: "Lymphocyte antigen 78 " EXACT []
synonym: "Radioprotective 105 kDa protein" EXACT []
synonym: "RP105" EXACT []
xref: PIRSF:PIRSF038744
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001300
name: CD209 antigen
def: "A protein that is a translation product of the CD209 gene. This gene and CLEC4M are products of a recent gene duplication in the primate lineage. Independent duplications of an ancestral gene have given rise to several orthologs in rodents, including CD209A." [PRO:WCB]
comment: Category=gene.
synonym: "C-type lectin domain family 4 member L" EXACT []
synonym: "CD209" RELATED []
synonym: "CLEC4L" RELATED []
synonym: "DC-SIGN1" EXACT []
synonym: "Dendritic cell-specific ICAM-3-grabbing non-integrin 1" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001301
name: CD209 antigen-like protein A
def: "A protein that is a translation product of the CD209A gene. This gene is one of several produced by independent duplications in the rodent lineage. They are homologous to CD209 and CLEC4M, produced by a recent duplication in the primate lineage." [PRO:WCB]
comment: Category=gene.
synonym: "CD209 antigen-like protein A" EXACT []
synonym: "CD209A" RELATED []
synonym: "Cire" RELATED []
synonym: "DC-SIGN" EXACT []
synonym: "Dendritic cell-specific ICAM-3-grabbing non-integrin" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001302
name: CD226 antigen
def: "A protein that is a translation product of the CD226 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD226" RELATED []
synonym: "CD226 antigen " EXACT []
synonym: "DNAM-1" EXACT []
synonym: "DNAM1" RELATED []
synonym: "DNAX accessory molecule 1" EXACT []
synonym: "Pta1" RELATED []
synonym: "TLiSA1" EXACT [MGI:3039602]
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001304
name: CD300 antigen-like protein
def: "A protein that is a type I transmembrane protein containing an N-terminal signal peptide, an extracellular region with a single Immunoglobulin V-set domain (PF07686), a transmembrane region, and a cytoplasmic tail with two classical immunoreceptor tyrosine-based inhibitory motifs (ITIM), suggesting its inhibitory function." [PMID:15184070]
comment: Category=family.
xref: PIRSF:PIRSF036923
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001305
name: CD302 antigen
def: "A protein that is a translation product of the CD302 gene." [PRO:WCB]
comment: Category=gene.
synonym: "C- type lectin BIMLEC" EXACT []
synonym: "C-type lectin domain family 13 member A" EXACT []
synonym: "CD302" RELATED []
synonym: "CLEC13A" RELATED []
synonym: "DCL1" RELATED []
synonym: "Type I transmembrane C-type lectin receptor DCL- 1" EXACT []
xref: PIRSF:PIRSF038745
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001306
name: CD320 antigen
def: "A protein that is a translation product of the CD320 gene." [PRO:CNA]
comment: Category=gene.
synonym: "8D6 antigen" EXACT []
synonym: "8D6A" EXACT []
synonym: "CD320" EXACT []
synonym: "FDC-signaling molecule 8D6" EXACT []
synonym: "FDC-SM-8D6" EXACT []
synonym: "Transcobalamin receptor" RELATED []
xref: PIRSF:PIRSF038748
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001307
name: CD44 antigen
def: "A protein that is a translation product of the CD44 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD44" RELATED []
synonym: "CD44 antigen " EXACT []
synonym: "CDw44" EXACT []
synonym: "ECMR-III" EXACT []
synonym: "Epican" EXACT []
synonym: "Extracellular matrix receptor-III" EXACT []
synonym: "GP90 lymphocyte homing/adhesion receptor" EXACT []
synonym: "Heparan sulfate proteoglycan" RELATED []
synonym: "Hermes antigen" EXACT []
synonym: "HUTCH-I" EXACT []
synonym: "Hyaluronate receptor" EXACT []
synonym: "LHR" RELATED []
synonym: "Ly-24" EXACT []
synonym: "Lymphocyte antigen 24" EXACT []
synonym: "MDU2" RELATED []
synonym: "MDU3" RELATED []
synonym: "MIC4" RELATED []
synonym: "PGP-1" EXACT []
synonym: "Phagocytic glycoprotein I" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001308
name: CD48 antigen
def: "A protein that is a translation product of the CD48 gene." [PRO:WCB]
comment: Category=gene.
synonym: "B-cell surface glycoprotein blast-1" EXACT []
synonym: "BCM1" RELATED []
synonym: "BCM1 surface antigen" EXACT []
synonym: "BLAST-1" EXACT []
synonym: "BLAST1" RELATED []
synonym: "CD48 antigen " EXACT []
synonym: "HM48-1" EXACT []
synonym: "Leukocyte antigen MEM-102" EXACT []
synonym: "MRC OX-45 surface antigen" EXACT []
synonym: "sgp-60" EXACT []
synonym: "TCT.1" EXACT []
xref: PANTHER:PTHR12080\:SF3
xref: PIRSF:PIRSF001973
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001309
name: CD70 antigen
def: "A protein that is a translation product of the CD70 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD27 ligand" EXACT []
synonym: "CD27-L" EXACT []
synonym: "CD27L" RELATED []
synonym: "CD27LG" RELATED []
synonym: "CD70" RELATED []
synonym: "Ki-24" EXACT [MGI:1195273]
synonym: "TNFSF7" RELATED []
synonym: "Tumor necrosis factor ligand superfamily member 7" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001310
name: CD83 antigen
def: "A protein that is a translation product of the CD83 gene." [PRO:WCB]
comment: Category=gene.
synonym: "B-cell activation protein" EXACT []
synonym: "BL11" EXACT [MGI:1328316]
synonym: "CD83" RELATED []
synonym: "CD83 antigen " EXACT []
synonym: "Cell surface protein HB15" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001311
name: CD97 antigen
def: "A protein that is a translation product of the CD97 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD97" RELATED []
synonym: "Leukocyte antigen CD97" EXACT []
synonym: "TM7LN1" EXACT [MGI:1347095]
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001312
name: CD99 antigen
def: "A protein that is a translation product of the CD99 gene." [PRO:WCB]
comment: Category=gene.
synonym: "12E7" EXACT []
synonym: "CD99" RELATED []
synonym: "CD99 antigen " EXACT []
synonym: "E2 antigen" EXACT []
synonym: "MIC2" RELATED []
synonym: "MIC2X" RELATED []
synonym: "MIC2Y" RELATED []
synonym: "Paired immunoglobin-like type 2 receptor-ligand" EXACT []
synonym: "PILR-L" EXACT []
synonym: "Pilrl" RELATED []
synonym: "Protein MIC2" EXACT []
synonym: "T-cell surface glycoprotein E2" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001313
name: E/P-selectin
def: "A protein with core domain structure consisting of one lectin C-type domain (PF00059), followed by one EGF domain (PF00008), followed by 4-9 sushi domains (PF00084), with the P-selectins generally being longer." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF036331
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001314
name: Fc receptor-like protein 5
def: "A protein that is a translation product of the FCRL5 gene." [PRO:CNA]
comment: Category=gene.
synonym: "BXMAS1" EXACT []
synonym: "CD307" EXACT []
synonym: "Fc receptor homolog 5 " EXACT []
synonym: "FcRH5" EXACT []
synonym: "FcRL5 " EXACT []
synonym: "Immunoglobulin receptor translocation-associated protein 2" EXACT []
synonym: "IRTA2" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001315
name: G protein-coupled receptor frizzled
def: "A protein with core architecture consisting of an Fz domain (PF01392), also known as Frizzled CRD (cysteine rich domain), followed by a Frizzled/Smoothened family membrane region (PF01534), which includes 7 transmembrane helices, and a cytoplasmic domain containing the motif Lys-Thr-x-x-x-Trp. They generally function as cell-surface receptors for Wnts." [Interpro:IPR015526]
comment: Category=family.
synonym: "G-protein coupled receptor frizzled" EXACT []
xref: PIRSF:PIRSF006696
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001316
name: interleukin-31
def: "A protein that is a translation product of the IL31 gene." [PRO:CNA]
comment: Category=gene.
synonym: "IL-31" EXACT []
synonym: "IL31" RELATED []
xref: PIRSF:PIRSF038756
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001317
name: interleukin-7
def: "A protein that is a translation product of the IL7 gene." [PRO:JAN]
comment: Category=gene.
synonym: "interleukin-7 " EXACT []
xref: PIRSF:PIRSF001942
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001318
name: L-selectin
def: "A protein that is a translation product of the SELL gene. It is a leukocyte adhesion receptor that play an important role in regulating the inflammatory response by mediating leukocyte tethering and rolling on adherent leukocytes." [PMID:12403782, PRO:JAN]
comment: Category=gene.
synonym: "CD62 antigen-like family member L" EXACT []
synonym: "CD62L" EXACT []
synonym: "LAM-1" EXACT []
synonym: "LECAM1" EXACT []
synonym: "Leukocyte adhesion molecule 1" EXACT []
synonym: "Leukocyte surface antigen Leu-8" EXACT []
synonym: "Leukocyte-endothelial cell adhesion molecule 1" EXACT []
synonym: "LNHR" RELATED []
synonym: "LYAM1" RELATED []
synonym: "Lymph node homing receptor" EXACT []
synonym: "TQ1" EXACT []
xref: PIRSF:PIRSF002421
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001319
name: SLAM family member 5
def: "A protein that is a translation product of the CD84 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD84" RELATED []
synonym: "CD84 antigen" EXACT []
synonym: "Cell surface antigen MAX.3" EXACT []
synonym: "Hly9-beta" EXACT []
synonym: "Leukocyte differentiation antigen CD84" EXACT []
synonym: "Signaling lymphocytic activation molecule 5" EXACT []
synonym: "SLAM family member 5" EXACT []
synonym: "SLAM family member 5 " EXACT []
synonym: "SLAMF5" RELATED []
xref: PANTHER:PTHR12080\:SF6
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001320
name: alpha-(1,3)-fucosyltransferase
def: "A protein that is a stand alone version of the Glycosyltransferase family 10 (fucosyltransferase) (PF00852) domain. Proteins in this class may catalyze alpha-1,3 glycosidic linkages." [PMID:9451017]
comment: Category=family.
xref: PIRSF:PIRSF005726
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001321
name: alpha-taxilin
def: "A protein that is a translation product of the TXLNA gene." [PRO:WCB]
comment: Category=gene.
synonym: "TXLN" RELATED []
synonym: "TXLNA" RELATED []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001322
name: angiotensin-converting enzyme, somatic isoform
def: "A protein that is a translation product of the ACE gene." [PRO:WCB]
comment: Category=gene.
synonym: "ACE" RELATED []
synonym: "Angiotensin-converting enzyme, somatic isoform " EXACT []
synonym: "CD143 antigen" EXACT []
synonym: "DCP" RELATED []
synonym: "DCP1" RELATED []
synonym: "Dipeptidyl carboxypeptidase I" EXACT []
synonym: "Kininase II" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001323
name: autoimmune regulator
def: "A protein that is a translation product of the AIRE gene." [PRO:WCB]
comment: Category=gene.
synonym: "AIRE" RELATED []
synonym: "APECED" RELATED []
synonym: "APECED protein homolog" EXACT []
synonym: "Autoimmune polyendocrinopathy candidiasis ectodermal dystrophy protein homolog" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001324
name: basigin
def: "A protein that is a translation product of the BSG gene." [PRO:WCB]
comment: Category=gene.
synonym: "5F7" EXACT []
synonym: "Basic immunoglobulin superfamily" EXACT []
synonym: "Basigin" EXACT []
synonym: "Basigin " EXACT []
synonym: "BSG" RELATED []
synonym: "CD147 antigen" EXACT []
synonym: "Collagenase stimulatory factor" EXACT []
synonym: "EMMPRIN" EXACT []
synonym: "Extracellular matrix metalloproteinase inducer" EXACT []
synonym: "HT7 antigen" EXACT []
synonym: "Leukocyte activation antigen M6" EXACT []
synonym: "Membrane glycoprotein gp42" EXACT []
synonym: "OK blood group antigen" EXACT []
synonym: "TCSF" EXACT []
synonym: "Tumor cell-derived collagenase stimulatory factor" EXACT []
xref: PIRSF:PIRSF001983
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001325
name: beta-1,3-glucuronyltransferase
def: "A protein with a core domain structure consisting of a very small cytoplasmic domain followed by a transmembrane domain and a Glycosyltransferase family 43 (PF03360) domain." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF016413
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001326
name: bone marrow stromal antigen 2
def: "A protein that is a translation product of the BST2 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Bone marrow stromal antigen 2 " EXACT []
synonym: "BST-2" EXACT []
synonym: "BST2" RELATED []
synonym: "CD317 antigen" EXACT []
synonym: "HM1.24 antigen" RELATED []
xref: PIRSF:PIRSF023920
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001327
name: cadherin
def: "A protein that has a core domain structure of signal sequence, propeptide, five Cadherin domains (PF00028), a transmembrane region, and a Cadherin cytoplasmic region (PF01049). Cadherins function as adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in solid tissues." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF002504
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001328
name: carcinoembryonic antigen-related cell adhesion molecule 1
def: "A protein that is a translation product of the CEACAM1 gene." [PRO:CNA]
comment: Category=gene.
synonym: "BGP-1" EXACT []
synonym: "biliary glycoprotein" EXACT []
synonym: "Biliary glycoprotein " EXACT []
synonym: "Biliary glycoprotein 1" EXACT []
synonym: "Biliary glycoprotein D" EXACT []
synonym: "Carcinoembryonic antigen-related cell adhesion molecule 1 " EXACT []
synonym: "CD66a" EXACT []
synonym: "MHV-R" EXACT []
synonym: "MHVR1" EXACT []
synonym: "Murine hepatitis virus receptor" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001329
name: carcinoembryonic antigen-related cell adhesion molecule 3
def: "A protein that is a translation product of the CEACAM3 gene." [PRO:CNA]
comment: Category=gene.
synonym: "Carcinoembryonic antigen CGM1" EXACT []
synonym: "CD66D" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001330
name: carcinoembryonic antigen-related cell adhesion molecule 5
def: "A protein that is a translation product of the CEACAM5 gene." [PRO:CNA]
comment: Category=gene.
synonym: "carcinoembryonic antigen" RELATED []
synonym: "CD66e" EXACT []
synonym: "CD66e antigen" EXACT []
synonym: "CEA" EXACT []
synonym: "meconium antigen 100" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001331
name: carcinoembryonic antigen-related cell adhesion molecule 6
def: "A protein that is a translation product of the CEACAM6 gene." [PRO:CNA]
comment: Category=gene.
synonym: "CD66c" EXACT []
synonym: "CD66c antigen" EXACT []
synonym: "Non-specific crossreacting antigen " EXACT []
synonym: "Normal cross-reacting antigen" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001332
name: carcinoembryonic antigen-related cell adhesion molecule 8
def: "A protein that is a translation product of the CEACAM8 gene." [PRO:CNA]
comment: Category=gene.
synonym: "Carcinoembryonic antigen CGM6" EXACT []
synonym: "CD66b" EXACT []
synonym: "CD67 antigen " EXACT []
synonym: "Non-specific cross-reacting antigen NCA-95" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001333
name: cation-independent mannose 6-phosphate receptor
def: "A protein that is a translation product of the IGF2R gene." [PRO:WCB]
comment: Category=gene.
synonym: "300 kDa mannose 6-phosphate receptor" EXACT []
synonym: "Cation-independent mannose-6-phosphate receptor " EXACT []
synonym: "CD222" EXACT []
synonym: "CD222 antigen" EXACT []
synonym: "CI Man-6-P receptor" EXACT []
synonym: "CI-MPR" EXACT []
synonym: "IGF-II receptor" EXACT []
synonym: "Insulin-like growth factor 2 receptor" EXACT []
synonym: "Insulin-like growth factor II receptor" EXACT []
synonym: "M6P/IGF2 receptor" EXACT []
synonym: "M6P/IGF2R" EXACT []
synonym: "M6PR" EXACT []
synonym: "MPR 300" EXACT []
synonym: "MPR300" EXACT []
xref: PIRSF:PIRSF036993
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001334
name: choline transporter-like protein 1
def: "A protein that is a translation product of the SLC44A1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD92" RELATED []
synonym: "CD92 antigen" EXACT []
synonym: "CDW92" RELATED []
synonym: "CDw92" EXACT []
synonym: "Choline transporter-like protein 1" EXACT []
synonym: "CTL1" RELATED []
synonym: "SLC44A1" RELATED []
synonym: "Solute carrier family 44 member 1" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001335
name: class 2 cytokine, IL-10 type
def: "A protein with a core domain architecture consisting of an N-terminal Interleukin 10 (PF00726) domain." [PRO:CNA]
comment: Category=family.
xref: PIRSF:PIRSF003542
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001336
name: complement decay-accelerating factor
def: "A protein that is a translation product of the CD55 or CD55B genes. In human, alternative splicing of CD55 transcript produces either a single-pass type 1 membrane protein or a GPI-anchored form. In mouse, the single-pass transmembrane form is encoded by the closely related gene CD55B, which was produced by a recent lineage-specific duplication." [PRO:WCB]
comment: Category=gene.
synonym: "CD55" RELATED []
synonym: "CD55 antigen" EXACT []
synonym: "Cd55a" RELATED []
synonym: "Cd55b" RELATED []
synonym: "Complement decay-accelerating factor " EXACT []
synonym: "Complement decay-accelerating factor transmembrane isoform" EXACT []
synonym: "Complement decay-accelerating factor, GPI-anchored " EXACT []
synonym: "CR" RELATED []
synonym: "DAF" RELATED []
synonym: "DAF-GPI" EXACT []
synonym: "DAF-TM" EXACT []
synonym: "Daf1" RELATED []
synonym: "Daf2" RELATED []
xref: PIRSF:PIRSF002489
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001337
name: complement receptor type 1
def: "A protein that is a translation product of the CR1 gene. There is no counterpart in mouse." [PRO:WCB]
comment: Category=gene.
synonym: "C3b/C4b receptor" EXACT []
synonym: "C3BR" RELATED []
synonym: "CD35 antigen" EXACT []
synonym: "CR1" RELATED []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001338
name: complement receptor type 2
def: "A protein that is a translation product of the CR2 gene." [PRO:WCB]
comment: Category=gene.
synonym: "C3DR" RELATED []
synonym: "CD21 antigen" EXACT []
synonym: "Complement C3d receptor" EXACT []
synonym: "Complement receptor type 2 " EXACT []
synonym: "CR2" RELATED []
synonym: "Cr2" EXACT []
synonym: "EBV receptor" EXACT []
synonym: "Epstein-Barr virus receptor" EXACT []
xref: PIRSF:PIRSF002484
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001339
name: cytokine receptor common beta chain
def: "A protein that is a translation product of the CSF2RB gene. This gene encodes the receptor beta chain shared by high-affinity IL5, IL3, and GM-CSF receptors. In mouse, there is also a closely related gene that encodes an IL3-specific beta chain." [PRO:WCB, UniProtKB:P26954]
comment: Category=gene.
synonym: "CD131" EXACT [MGI:1339759]
synonym: "CDw131" EXACT [MGI:1339759]
synonym: "Cytokine receptor common subunit beta " EXACT []
synonym: "IL3RB" EXACT [MGI:1339759]
synonym: "IL5RB" EXACT [MGI:1339759]
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001340
name: cytokine receptor common gamma chain
def: "A protein that is a translation product of the IL2RG gene." [PRO:CNA]
comment: Category=gene.
synonym: "CD132 antigen" EXACT []
synonym: "Gamma-C" EXACT []
synonym: "IL-2R gamma chain" EXACT []
synonym: "IMD4" RELATED []
synonym: "interleukin-2 receptor gamma chain" EXACT []
synonym: "p64" RELATED []
synonym: "SCIDX" RELATED []
synonym: "SCIDX1" RELATED []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001341
name: dipeptidyl-peptidase IV
def: "A protein that is a translation product of the DPP4 gene." [PRO:WCB]
comment: Category=gene.
synonym: "ADABP" EXACT []
synonym: "ADCP2" RELATED []
synonym: "Adenosine deaminase complexing protein 2" EXACT []
synonym: "CD26" RELATED []
synonym: "Dipeptidyl peptidase 4" EXACT []
synonym: "DPP IV" EXACT []
synonym: "DPP4" RELATED []
synonym: "T-cell activation antigen CD26" EXACT []
synonym: "TP103" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001342
name: discoidin domain-containing receptor
def: "A protein that has a core domain structure of an F5/8 type C (PF00754) domain (or discoidin domain) followed by a Protein tyrosine kinase (PF07714) domain. The discoidin domain receptors (DDRs) are distinguished from other members of the receptor tyrosine kinase family by a discoidin homology repeat in their extracellular domains that is also found in a variety of other transmembrane and secreted proteins." [PMID:10352148, PMID:9684896]
comment: Category=family.
xref: PIRSF:PIRSF038747
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001343
name: early activation antigen CD69
def: "A protein that is a translation product of the CD69 gene. A type II transmembrane protein with a C-type lectin binding domain in the extracellular portion of the molecule. Involved in lymphocyte proliferation and functions as a signal transmitting receptor in lymphocytes, natural killer (NK) cells, and platelets." [PMID:10466080, PRO:CNA, UniProtKB:Q07108]
comment: Category=gene.
synonym: "Activation inducer molecule" EXACT []
synonym: "AIM" EXACT []
synonym: "BL-AC/P26" EXACT []
synonym: "CD69" RELATED []
synonym: "EA1" EXACT []
synonym: "Early T-cell activation antigen p60" EXACT []
synonym: "GP32/28" EXACT []
synonym: "Leu-23" EXACT []
synonym: "MLR-3" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001344
name: ectonucleotide pyrophosphatase/phosphodiesterase 3
def: "A protein that is a translation product of the ENPP3 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD203c" EXACT []
synonym: "CD203c antigen" EXACT []
synonym: "E- NPP 3" EXACT []
synonym: "Ectonucleotide pyrophosphatase/phosphodiesterase family member 3" EXACT []
synonym: "ENPP3" RELATED []
synonym: "PD-Ibeta" EXACT []
synonym: "PDNP3" RELATED []
synonym: "Phosphodiesterase I beta" EXACT []
synonym: "Phosphodiesterase I/nucleotide pyrophosphatase 3" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001345
name: endoglin
def: "A protein that is a translation product of the ENG gene." [PRO:CNA]
comment: Category=gene.
synonym: "CD105" EXACT [MGI:95392]
xref: PIRSF:PIRSF038746
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001346
name: endosialin
def: "A protein that is a translation product of the CD248 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD164L1" RELATED []
synonym: "CD248" RELATED []
synonym: "CD248 antigen" EXACT []
synonym: "Endosialin " EXACT []
synonym: "TEM1" RELATED []
synonym: "Tumor endothelial marker 1" EXACT []
xref: PIRSF:PIRSF038358
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001347
name: endothelial protein C receptor
def: "A protein that is a translation product of the PROCR gene." [PRO:CNA]
comment: Category=gene.
synonym: "CD201" EXACT [MGI:104596]
synonym: "EPC-R" EXACT [MGI:104596]
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001348
name: erythrocyte membrane protein Rh
def: "A protein that is a stand alone version of the Ammonium Transporter Family domain in vertebrates. This protein is related to the ammonium transporters in fungi and bacteria. In mammals, this protein defines the Rh blood group antigens." [PMID:7888828, PMID:9433124]
comment: Category=family.
xref: PIRSF:PIRSF017968
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001349
name: fibroblast growth factor receptor
def: "A protein with a an extracellular region containing three copies of the Immunoglobulin domain (PF00047), a single transmembrane region, and an intracellular region containing a Protein tyrosine kinase domain (PF07714). Its active form binds fibroblast growth factor (FGF). FGFs and its receptor comprise a signaling system that is conserved throughout metazoan evolution." [PMID:15475116]
comment: Category=family.
xref: PIRSF:PIRSF000628
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001350
name: forkhead box protein P3
def: "A protein that is a translation product of the FOXP3 gene." [PRO:CNA]
comment: Category=gene.
synonym: "FOXP3" RELATED []
synonym: "IPEX" RELATED []
synonym: "JM2" RELATED []
synonym: "Scurfin" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001351
name: gamma-glutamyltranspeptidase
def: "A protein that is the stand alone version of the Gamma-glutamyltranspeptidase (PF01019) domain. The functional protein catalyzes the transfer of the gamma-glutamyl moiety of glutathione to an acceptor that may be an amino acid, a peptide or water (forming glutamate), and consists of two polypeptide chains, a heavy and a light subunit, processed from a single chain precursor by an autocatalytic cleavage." [Interpro:IPR000101, PRO:CNA]
comment: Category=family.
xref: PIRSF:PIRSF000457
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001352
name: glycophorin
def: "A protein that contains an extracellular Glycophorin A domain (PF01102), followed by a single-pass transmembrane region and a small intracellular domain. A protein that is an integral protein of the red cell membrane. Proteins in this class are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane." [Interpro:IPR001195, PRO:CNA]
comment: Category=family.
xref: PIRSF:PIRSF002466
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001353
name: granulocyte colony-stimulating factor receptor
def: "A protein that is a translation product of the CSF3R gene. The active receptor is a homodimer which can bind G-CSF and transduce G-CSF-triggered growth signals into cells. Its extracellular domain contains a sequence of about 200 amino acids which can be found in various cytokine receptors. In addition, it contains an immunoglobulin-like domain and three fibronectin type III domains." [PMID:1723014, PRO:CNA]
comment: Category=gene.
synonym: "CD114" RELATED []
synonym: "CSF3R" RELATED []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001354
name: granulocyte-macrophage colony-stimulating factor receptor subunit alpha
def: "A protein that is a translation product of the CSF2RA gene." [PRO:CNA]
comment: Category=gene.
synonym: "CD116" EXACT []
synonym: "CDw116" EXACT []
synonym: "CSF2R" EXACT []
synonym: "CSF2RAX" EXACT []
synonym: "CSF2RAY" EXACT []
synonym: "GM-CSF-R-alpha" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001355
name: immunoglobulin gamma Fc receptor II/III/IV
def: "A protein with a core domain architecture consisting of an extracellular domain containing two copies of the Immunoglobulin domain (PF00047), followed by a single-pass transmembrane region and a small intracellular domain. The active protein is a low affinity receptor for immunoglobulin gamma chain Fc region. Human II-a, II-b, and II-c represent a recent gene expansion and are equally related to mouse II, III, and IV. Human III-A and III-B are closely related and closer to mouse IV than to mouse III." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF001980
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001356
name: immunoglobulin gamma Fc receptor I
def: "A protein with a core domain architecture consisting of an extracellular domain containing two or three copies of the Immunoglobulin domain (PF00047), followed by a single-pass transmembrane region and a small intracellular domain. The active protein is a low affinity receptor for immunoglobulin gamma chain Fc region. It comprises the translation products of the FCGR1 gene (mouse) or one of the closely related FCGR1A, FCGR1B, or FCGR1C genes (human). FCGR1C may be a pseudogene in humans." [PRO:CNA]
comment: Category=family.
synonym: "Fc-gamma receptor" RELATED []
xref: PIRSF:PIRSF001981
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001357
name: intercellular adhesion molecule 1/3
def: "A protein with a core domain architecture consisting of an Intercellular adhesion molecule (ICAM), N-terminal domain (PF03921), a type of Ig-like domain, and four copies of the Immunoglobulin domain (PF00047), most of which are not detected by Pfam." [PRO:WCB]
comment: Category=family.
synonym: "ICAM" RELATED []
xref: PIRSF:PIRSF002510
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001358
name: intercellular adhesion molecule 2
def: "A protein that is a translation product of the ICAM2 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD102" EXACT []
synonym: "ICAM-2" EXACT []
synonym: "ICAM2" RELATED []
xref: PANTHER:PTHR13771\:SF3
xref: PIRSF:PIRSF037975
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001359
name: intercellular adhesion molecule 4
def: "A protein that is a translation product of the ICAM4 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD242 antigen" EXACT []
synonym: "ICAM-4" EXACT []
synonym: "ICAM4" RELATED []
synonym: "Landsteiner- Wiener blood group glycoprotein" EXACT []
synonym: "LW" EXACT []
xref: PIRSF:PIRSF038752
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001360
name: intercellular adhesion molecule 5
def: "A protein that is a translation product of the ICAM5 gene." [PRO:WCB]
comment: Category=gene.
synonym: "ICAM-5" EXACT []
synonym: "ICAM5" RELATED []
synonym: "Telencephalin" EXACT []
synonym: "TLC" RELATED []
synonym: "TLCN" RELATED []
xref: PIRSF:PIRSF038690
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001361
name: interferon gamma receptor alpha chain
def: "A protein that is a translation product of the IFNGR1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD119 antigen" EXACT []
synonym: "CDw119" EXACT []
synonym: "IFN-gamma-R1" EXACT []
synonym: "Ifngr" RELATED []
synonym: "IFNGR1" RELATED []
synonym: "Interferon-gamma receptor alpha chain precursor" EXACT []
xref: PANTHER:PTHR20859\:SF5
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001362
name: interferon lambda
def: "A protein that is a cytokine distantly related to type I interferons (IFNs) and the interleukin-10 family. It comprises the translation product of the IL28A, IL28B and IL29 genes. Generally induced by viral infection and exert their antiviral and immunomodulatory activities through a unique receptor complex composed of IFN-lambdaR1 and interleukin 10 receptor 2." [PMID:16618774]
comment: Category=family.
synonym: "interleukin 28/29" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001363
name: interleukin-1 receptor type I
def: "A protein that is a translation product of the IL1R1 gene." [PRO:JAN]
comment: Category=gene.
synonym: "CD121 antigen-like family member A" EXACT []
synonym: "CD121a" EXACT []
synonym: "IL-1R-1" EXACT []
synonym: "p80" RELATED []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001364
name: interleukin-1 receptor type II
def: "A protein that is a translation product of the IL1R2 gene." [PRO:CNA]
comment: Category=gene.
synonym: "CD121 antigen-like family member B" EXACT []
synonym: "CD121b" EXACT []
synonym: "IL-1R-2" EXACT []
synonym: "IL-1R-beta" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001365
name: interleukin-10 receptor alpha chain
def: "A protein that is a translation product of the IL10RA gene." [PRO:CNA]
comment: Category=gene.
synonym: "CDw210" RELATED []
synonym: "CDw210a" EXACT []
synonym: "IL-10R1" EXACT []
xref: PIRSF:PIRSF018551
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001366
name: interleukin-11
def: "A protein that is a translation product of the IL11 gene." [PRO:CNA]
comment: Category=gene.
synonym: "Adipogenesis inhibitory factor" EXACT []
synonym: "AGIF" EXACT []
synonym: "IL-11" EXACT []
xref: PIRSF:PIRSF001944
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001367
name: interleukin-12 receptor beta 1
def: "A protein that is a translation product of the IL12RB1 gene." [PRO:CNA]
comment: Category=gene.
synonym: "CD212" EXACT []
synonym: "IL-12 receptor beta component" RELATED []
synonym: "IL-12R-beta1" EXACT []
synonym: "Interleukin-12 receptor beta-1 chain" EXACT []
xref: PIRSF:PIRSF029027
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001368
name: interleukin-12 subunit alpha
def: "A protein that is a translation product of the IL12A gene. It associates with interleukin-12 subunit beta to form the interleukin-23. Interleukin-12 subunit alpha associates with interleukin-27 subunit beta to form the interleukin-35." [PRO:CNA]
comment: Category=gene.
synonym: "CLMF p35" EXACT []
synonym: "Cytotoxic lymphocyte maturation factor 35 kDa subunit" EXACT []
synonym: "IL-12 subunit p35" EXACT []
synonym: "IL-12A" EXACT []
synonym: "Interleukin-12, subunit alpha" EXACT []
xref: PIRSF:PIRSF037684
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001369
name: interleukin-12 subunit beta
def: "A protein that is a translation product of the IL12B gene. interleukin-12 subunit beta associates with interleukin-12 subunit alpha or interleukin-23 subunit alpha to form the interleukin-23." [PRO:CNA]
comment: Category=gene.
synonym: "CLMF p40" EXACT []
synonym: "Cytotoxic lymphocyte maturation factor 40 kDa subunit" EXACT []
synonym: "IL-12 subunit p40" EXACT []
synonym: "IL-12b" EXACT []
synonym: "Interleukin-12, subunit beta" EXACT []
synonym: "NK cell stimulatory factor chain 2" EXACT []
synonym: "NKSF2" EXACT []
xref: PANTHER:PTHR11321\:SF1
xref: PIRSF:PIRSF038007
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001370
name: interleukin-13
def: "A protein that is a translation product of the IL13 gene. Interleukin-13 is a pleiotropic cytokine which may be important in the regulation of the inflammatory and immune responses. It inhibits inflammatory cytokine production and synergises with IL-2 in regulating interferon-gamma synthesis. The sequences of IL-4 and IL-13 are distantly related." [PANTHER:PTHR11322, PRO:CNA]
comment: Category=gene.
synonym: "IL-13" EXACT []
synonym: "Interleukin-13" EXACT []
xref: PANTHER:PTHR11322
xref: PIRSF:PIRSF001945
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001371
name: interleukin-13 receptor alpha-1 chain
def: "A protein that is a translation product of the IL13RA1 gene." [PRO:CNA]
comment: Category=gene.
synonym: "Cancer/testis antigen 19" RELATED []
synonym: "CD213a1" EXACT []
synonym: "CT19" EXACT []
synonym: "IL-13R-alpha-1" EXACT []
synonym: "IL-13RA-1" EXACT []
synonym: "Interleukin-13-binding protein" EXACT []
xref: PANTHER:PTHR23036\:SF15
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001372
name: interleukin-13 receptor alpha-2 chain
def: "A protein that is a translation product of the IL13RA2 gene." [PRO:CNA]
comment: Category=gene.
synonym: "CD213a2" EXACT []
synonym: "IL-13R alpha2" EXACT []
synonym: "interleukin-13 receptor, alpha 2, full insert sequence" EXACT []
synonym: "Interleukin-13-binding protein" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001373
name: interleukin-15
def: "A protein that is a translation product of the IL15 gene." [PRO:CNA]
comment: Category=gene.
synonym: "IL-15" EXACT []
xref: PIRSF:PIRSF001946
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001374
name: interleukin-16
def: "A protein that is a translation product of the IL16 gene." [PRO:CNA]
comment: Category=gene.
synonym: "IL-16" EXACT []
synonym: "LCF" EXACT []
synonym: "Lymphocyte chemoattractant factor" EXACT []
xref: PIRSF:PIRSF038750
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001375
name: interleukin-17 receptor A
def: "A protein that is a translation product of the IL17RA gene." [PRO:CNA]
comment: Category=gene.
synonym: "CD217" EXACT []
synonym: "CDw217" EXACT []
synonym: "IL-17 receptor" EXACT []
synonym: "IL-17RA" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001376
name: interleukin-18
def: "A protein that is a translation product of the IL18 gene." [PRO:CNA]
comment: Category=gene.
synonym: "IFN-gamma-inducing factor" EXACT []
synonym: "IL-1 gamma" EXACT []
synonym: "Interferon-gamma-inducing factor" EXACT []
synonym: "Interleukin-1 gamma" EXACT []
xref: PIRSF:PIRSF015162
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001377
name: interleukin-18 receptor 1
def: "A protein that is a translation product of the IL18R1 gene." [PRO:CNA]
comment: Category=gene.
synonym: "CD218 antigen-like family member A" EXACT []
synonym: "CD218a" EXACT []
synonym: "CDw218a" EXACT []
synonym: "IL-18Ralpha" EXACT []
synonym: "IL1 receptor-related protein" EXACT []
xref: PANTHER:PTHR11890\:SF6
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001378
name: interleukin-18 receptor accessory protein
def: "A protein that is a translation product of the IL18RAP gene." [PRO:CNA]
comment: Category=gene.
synonym: "CDw218b" EXACT []
synonym: "Il-18R beta" EXACT []
xref: PANTHER:PTHR11890\:SF4
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001379
name: interleukin-2
def: "A protein that is a translation product of the IL2 gene. Interleukin-2 has a dual role in maintaining tolerance and contributing to immunity." [PMID:18062768, PRO:CNA]
comment: Category=gene.
synonym: "IL-2" EXACT []
synonym: "T-cell growth factor" EXACT []
synonym: "TCGF" EXACT []
xref: PIRSF:PIRSF001938
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001380
name: interleukin-2 receptor subunit alpha
def: "A protein that is a translation product of the IL2RA gene." [PRO:CNA]
comment: Category=gene.
synonym: "Interleukin-2 receptor alpha chain" EXACT []
xref: PIRSF:PIRSF001954
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001381
name: interleukin-2 receptor subunit beta
def: "A protein that is a translation product of the IL2RB gene." [PRO:CNA]
comment: Category=gene.
synonym: "CD122" EXACT []
synonym: "High affinity IL-2 receptor subunit beta" EXACT []
synonym: "IL-2 receptor" RELATED []
synonym: "interleukin-2 receptor beta chain" EXACT []
synonym: "P70-75" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001382
name: interleukin-21
def: "A protein that is a translation product of the IL21 gene." [PRO:CNA]
comment: Category=gene.
synonym: "IL-21" EXACT []
synonym: "IL21" RELATED []
synonym: "Za11" EXACT []
xref: PIRSF:PIRSF038753
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001383
name: interleukin-22
def: "A protein that is a translation product of the IL22 gene." [PRO:CNA]
comment: Category=gene.
synonym: "class 2 cytokine" RELATED []
synonym: "IL-10-related T-cell-derived- inducible factor" EXACT []
synonym: "IL-22" EXACT []
synonym: "IL-TIF" EXACT []
synonym: "IL22" RELATED []
xref: PIRSF:PIRSF037726
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001384
name: interleukin-23 subunit alpha
def: "A protein that is a translation product of the IL23A gene. Interleukin-23 subunit alpha associates with interleukin-12 subunit beta to form the interleukin-23, an heterodimeric cytokine which functions in innate and adaptive immunity." [PRO:CNA, UniProtKB:Q9NPF7]
comment: Category=gene.
synonym: "IL-23 subunit alpha" EXACT []
synonym: "IL-23p19" EXACT []
synonym: "IL23A" RELATED []
synonym: "Interleukin-23 subunit p19" EXACT []
xref: PIRSF:PIRSF038754
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001385
name: interleukin-27 subunit alpha
def: "A protein that is a translation product of the IL27 gene. Interleukin-27 subunit alpha associates with interleukin-27 subunit beta to form interleukin-27. Interleukin-27 is a cytokine with pro- and anti-inflammatory properties." [PMID:17015723, PRO:CNA]
comment: Category=gene.
synonym: "IL-27 subunit alpha " EXACT []
synonym: "IL27" RELATED []
synonym: "IL27-A " EXACT []
synonym: "Il27a" RELATED []
xref: PIRSF:PIRSF038755
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001386
name: interleukin-27 subunit beta
def: "A protein that is a translation product of the EBI3 gene. Interleukin-27 subunit beta associates with interleukin-27 subunit alpha to form interleukin-27. Interleukin-27 is a cytokine with pro- and anti-inflammatory properties. Interleukin-27 subunit beta associates with interleukin-12 subunit alpha to form the interleukin-35." [PMID:17015723, PRO:CNA]
comment: Category=gene.
synonym: "EBI3" RELATED []
synonym: "EBV-induced gene 3 protein" EXACT []
synonym: "Epstein-Barr virus-induced gene 3 protein" EXACT []
synonym: "Epstein-Barr virus-induced gene 3 protein homolog" EXACT []
synonym: "IL-27 subunit beta" EXACT []
synonym: "IL-27B " EXACT []
synonym: "IL27B" RELATED []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001387
name: interleukin-3
def: "A protein that is a translation product of the IL3 gene." [PRO:CNA]
comment: Category=gene.
synonym: "Hematopoietic growth factor" EXACT []
synonym: "IL-3" EXACT []
synonym: "Mast cell growth factor" EXACT []
synonym: "MCGF" EXACT []
synonym: "Multipotential colony-stimulating factor" EXACT []
synonym: "P-cell-stimulating factor" EXACT []
xref: PIRSF:PIRSF001939
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001388
name: interleukin-32
def: "A protein that is a translation product of the IL32 gene." [PRO:JAN]
comment: Category=gene.
synonym: "Interleukin-32 " EXACT []
xref: PIRSF:PIRSF038479
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001389
name: interleukin-33
def: "A protein that is a translation product of the IL33 gene." [PRO:JAN]
comment: Category=gene.
synonym: "Interleukin-33 " EXACT []
xref: PIRSF:PIRSF038478
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001390
name: interleukin-34
comment: Category=family.
synonym: "IL-34" EXACT []
synonym: "IL34" RELATED []
xref: PIRSF:PIRSF038757
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001391
name: interleukin-4
def: "A protein that is a translation product of the IL4 gene." [PRO:JAN]
comment: Category=gene.
synonym: "Interleukin-4 " EXACT []
xref: PIRSF:PIRSF001941
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001392
name: interleukin-5
def: "A protein that is a translation product of the IL5 gene." [PRO:CNA]
comment: Category=gene.
synonym: "EDF" EXACT []
synonym: "eosinophil differentiation factor" EXACT []
synonym: "IL-5" EXACT []
synonym: "IL5" RELATED []
synonym: "T-cell replacing factor" EXACT []
synonym: "TRF" EXACT []
xref: PIRSF:PIRSF001940
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001393
name: interleukin-6
def: "A protein that is a translation product of the IL6 gene." [PRO:JAN]
comment: Category=gene.
synonym: "Interleukin-6 " EXACT []
xref: PIRSF:PIRSF001935
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001394
name: interleukin-6 receptor subunit alpha
def: "A protein that is a translation product of the IL6RA gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD126 antigen" EXACT []
synonym: "gp80" EXACT []
synonym: "IL-6R 1" EXACT []
synonym: "IL-6R-alpha" EXACT []
synonym: "IL6R" RELATED []
synonym: "Il6ra" RELATED []
synonym: "Interleukin-6 receptor subunit alpha " EXACT []
synonym: "Membrane glycoprotein 80" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001395
name: interleukin-8
def: "A protein that is a translation product of the IL8 gene." [PRO:WCB]
comment: Category=gene.
synonym: "C-X-C motif chemokine 8" EXACT []
synonym: "CXCL8" RELATED []
synonym: "Emoctakin" EXACT []
synonym: "GCP-1" EXACT []
synonym: "Granulocyte chemotactic protein 1" EXACT []
synonym: "IL-8" EXACT []
synonym: "IL8" RELATED []
synonym: "Interleukin-8 " EXACT []
synonym: "MDNCF" EXACT []
synonym: "MONAP" EXACT []
synonym: "Monocyte-derived neutrophil chemotactic factor" EXACT []
synonym: "Monocyte-derived neutrophil-activating peptide " EXACT []
synonym: "NAP-1" EXACT []
synonym: "Neutrophil-activating protein 1" EXACT []
synonym: "Protein 3-10C" EXACT []
synonym: "T-cell chemotactic factor" EXACT []
xref: PIRSF:PIRSF500564
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001396
name: interleukin-9
def: "A protein that is a translation product of the IL9 gene." [PRO:JAN]
comment: Category=gene.
synonym: "IL-9" EXACT []
synonym: "IL9" RELATED []
synonym: "P40 cytokine" EXACT []
synonym: "T-cell growth factor P40" EXACT []
xref: PIRSF:PIRSF001943
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001397
name: interleukin-9 receptor
def: "A protein that is a translation product of the IL9R gene." [PRO:JAN]
comment: Category=gene.
synonym: "CD129" EXACT []
synonym: "IL-9R " EXACT []
synonym: "IL9R" RELATED []
xref: PIRSF:PIRSF018548
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001398
name: leukocyte immunoglobulin-like receptor subfamily A member 4
def: "A protein that is a translation product of the LILRA4 gene. This gene is a member of a lineage-specific gene expansion in primates." [PRO:WCB]
comment: Category=gene.
synonym: "CD85 antigen-like family member G" EXACT []
synonym: "CD85g antigen" EXACT []
synonym: "ILT-7" EXACT []
synonym: "ILT7" RELATED []
synonym: "Immunoglobulin-like transcript 7" EXACT []
synonym: "Leukocyte immunoglobulin-like receptor subfamily A member 4 " EXACT []
synonym: "LILRA4 " RELATED []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001399
name: leukocyte surface antigen CD47
def: "A protein that is a translation product of the CD47 gene." [PRO:JAN]
comment: Category=gene.
synonym: "Antigenic surface determinant protein OA3" EXACT []
synonym: "CD47" EXACT []
synonym: "IAP" EXACT []
synonym: "Integrin-associated protein" EXACT []
synonym: "MER6" RELATED []
synonym: "Protein MER6" EXACT []
xref: PIRSF:PIRSF015846
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001400
name: mannose receptor
comment: Please consider PRO:000001025.
xref: PIRSF:PIRSF002427
is_obsolete: true

[Term]
id: PRO:000001401
name: membrane cofactor protein
def: "A protein that is a translation product of the CD46 gene. This protein act as a cofactor for complement factor I, a serine protease which protects autologous cells against complement-mediated injury by cleaving C3b and C4b deposited on host tissue." [PRO:JAN, UniProtKB:P15529]
comment: Category=gene.
synonym: "CD46" EXACT []
synonym: "MCP" RELATED []
synonym: "TLX" RELATED []
synonym: "Trophoblast leukocyte common antigen" EXACT []
xref: PIRSF:PIRSF037971
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001402
name: natural killer cells antigen CD94
def: "A protein that is a translation product of the KLRD1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD94" RELATED []
synonym: "CD94 antigen" EXACT []
synonym: "Killer cell lectin-like receptor subfamily D member 1" EXACT []
synonym: "KLRD1" RELATED []
synonym: "KP43" EXACT []
synonym: "NK cell receptor" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001403
name: tetraspanin
def: "A protein with four transmembrane domains, small intracellular amino- and carboxyl-terminal regions, and two extracellular loops, a small one (EC1) and a larger one (EC2) of about 100 residues. The EC2 loop contains at least 4 cysteine residues, including a highly conserved \"CCG\" motif." [PRO:WCB, Wikipedia:Tetraspanin]
comment: Category=family.
xref: PIRSF:PIRSF002419
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001404
name: tumor necrosis factor ligand superfamily member 8
def: "A protein that is a translation product of the TNFSF8 gene." [PRO:CNA]
comment: Category=gene.
synonym: "tumour necrosis factor family protein, CD30 ligand type" EXACT []
xref: PIRSF:PIRSF019548
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001405
name: tumor necrosis factor receptor superfamily member 16
def: "A protein that is a translation product of the NGFR gene. This receptor contains an extracellular domain containing four repeats (about 40 residues long) with 6 cysteine residues at conserved positions followed by a serine/threonine-rich region, a single transmembrane domain, and a cytoplasmic domain. The cysteine-rich region contains the nerve growth factor binding domain." [PRO:JAN, Refseq:NP_002498]
comment: Category=gene.
synonym: "CD271" EXACT []
synonym: "Gp80-LNGFR" EXACT []
synonym: "Low affinity neurotrophin receptor p75NTR" EXACT []
synonym: "Low-affinity nerve growth factor receptor" EXACT []
synonym: "NGF receptor" EXACT []
synonym: "NGFR" RELATED []
synonym: "p75 ICD" EXACT []
synonym: "TNFRSF16" RELATED []
xref: PIRSF:PIRSF001964
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001406
name: tumor necrosis factor receptor superfamily member 17
def: "A protein that is a translation product of the TNFRSF17 gene. Promotes B-cell survival and plays a role in the regulation of humoral immunity." [PMID:10973284, PRO:JAN]
comment: Category=gene.
synonym: "B-cell maturation protein" EXACT []
synonym: "BCM" RELATED []
synonym: "BCMA" RELATED []
synonym: "CD269" EXACT []
synonym: "TNFRSF17" RELATED []
xref: PIRSF:PIRSF011859
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001407
name: tumor-associated calcium signal transducer
def: "A protein with a core domain architecture consisting of a large N-terminal extracellular region, a single-pass transmembrane region and a very small cytoplasmic region. The extracellular region is composed of three distinct domains: a novel cysteine-rich N-terminal domain (GA733 type 1 motif), a cysteine-rich thyroglobulin type 1A domain (Thyroglobulin type-1 repeat (PF00086)), and a unique nonglycosylated domain without cysteines (GA733 type 3 motif). It is an unusual cell-cell adhesion protein that does not exhibit any obvious relationship to the four known classes of adhesion molecules." [PMID:11080501]
comment: Category=family.
synonym: "carcinoma antigen GA733" RELATED []
synonym: "GA733" RELATED []
xref: PIRSF:PIRSF002018
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001408
name: ADP-ribosyl cyclase 1
def: "An ADP-ribosyl cyclase that is a translation product of the CD38 gene." [PRO:WCB]
comment: Category=gene.
synonym: "cADPr hydrolase 1" EXACT []
synonym: "CD38" RELATED []
synonym: "CD38 antigen" EXACT []
synonym: "Cyclic ADP-ribose hydrolase 1" EXACT []
synonym: "T10" EXACT []
is_a: PRO:000001281 ! ADP-ribosyl cyclase

[Term]
id: PRO:000001409
name: ADP-ribosyl cyclase 2
def: "An ADP-ribosyl cyclase that is a translation product of the BST1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Bone marrow stromal antigen 1" EXACT []
synonym: "BST-1" EXACT []
synonym: "BST1" RELATED []
synonym: "cADPr hydrolase 2" EXACT []
synonym: "CD157 antigen" EXACT []
synonym: "Cyclic ADP-ribose hydrolase2" EXACT []
is_a: PRO:000001281 ! ADP-ribosyl cyclase

[Term]
id: PRO:000001410
name: C-type lectin domain family 10 member A
def: "A C-type asialoglycoprotein receptor that is a translation product of the CLEC10A gene." [PRO:CNA]
comment: Category=gene.
synonym: "CD301" EXACT []
is_a: PRO:000001291 ! C-type asialoglycoprotein receptor

[Term]
id: PRO:000001411
name: CD276 antigen
def: "A B7-related protein that is a translation product of the CD276 gene. In the primate lineage, this gene has recently duplicated and the major isoforms expressed have tandemly repeated immunoglobulin-like V and C domains." [PRO:WCB]
comment: Category=gene.
synonym: "4Ig-B7-H3" EXACT []
synonym: "B7 homolog 3" EXACT []
synonym: "B7-H3" EXACT []
synonym: "B7H3" RELATED []
synonym: "CD276" RELATED []
synonym: "Costimulatory molecule" EXACT []
is_a: PRO:000001290 ! B7-related protein

[Term]
id: PRO:000001412
name: CD86 antigen
def: "A B7-related protein that is a translation product of the CD86 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Activation B7-2 antigen" EXACT []
synonym: "B70" EXACT []
synonym: "BU63" EXACT []
synonym: "CD28LG2" RELATED []
synonym: "CD86" RELATED []
synonym: "CTLA-4 counter-receptor B7.2" EXACT []
synonym: "Early T-cell costimulatory molecule 1" EXACT []
synonym: "FUN-1" EXACT []
synonym: "T-lymphocyte activation antigen CD86 " EXACT []
xref: PANTHER:PTHR13712\:SF45
is_a: PRO:000001290 ! B7-related protein

[Term]
id: PRO:000001413
name: CMRF35-like molecule 2
def: "A CD300 antigen-like protein that is a translation product of the CD300E gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD300 antigen- like family member E" EXACT []
synonym: "CD300E" RELATED []
synonym: "CD300e antigen" EXACT []
synonym: "CD300LE" RELATED []
synonym: "CLM-2" EXACT []
synonym: "CLM2" RELATED []
synonym: "CMRF35-A5" EXACT []
synonym: "CMRF35-like molecule 2 " EXACT []
synonym: "CMRF35A5" RELATED []
synonym: "Immune receptor expressed on myeloid cells 2" EXACT []
synonym: "IREM-2" EXACT []
synonym: "IREM2" RELATED []
is_a: PRO:000001304 ! CD300 antigen-like protein

[Term]
id: PRO:000001414
name: CMRF35-like molecule 8
def: "A CD300 antigen-like protein that is a translation product of the mouse CD300A gene and its orthologs. The rat gene of the same name is orthologous but the human gene apparently is not." [PRO:WCB]
comment: Category=gene.
synonym: "CD300A" RELATED []
synonym: "CD300a antigen" EXACT []
synonym: "CLM-8" EXACT []
synonym: "Clm8" RELATED []
synonym: "CMRF35-like molecule 8 " EXACT []
synonym: "Leukocyte mono-Ig-like receptor 1" EXACT []
synonym: "Lmir1" RELATED []
synonym: "MAIR-I" EXACT []
synonym: "Mast cell-derived paired immunoglobulin-like receptor 1" EXACT []
synonym: "Mcpir1" RELATED []
synonym: "Myeloid-associated immunoglobulin- like receptor 1" EXACT []
is_a: PRO:000001304 ! CD300 antigen-like protein

[Term]
id: PRO:000001415
name: E-selectin
def: "An E/P-selectin that is a translation product of the SELE gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD62E antigen" EXACT []
synonym: "E-selectin " EXACT []
synonym: "ELAM-1" EXACT []
synonym: "ELAM1" RELATED []
synonym: "Endothelial leukocyte adhesion molecule 1" EXACT []
synonym: "LECAM2" EXACT []
synonym: "Leukocyte-endothelial cell adhesion molecule 2" EXACT []
synonym: "SELE" RELATED []
xref: PIRSF:PIRSF500802
is_a: PRO:000001313 ! E/P-selectin

[Term]
id: PRO:000001416
name: G protein-coupled neurotensin receptor
def: "A rhodopsin-like G protein-coupled receptor whose active form binds the neuropeptide neurotensin." [PRO:WCB, PubMed:10390649]
comment: Category=family.
xref: PIRSF:PIRSF038642
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001417
name: G protein-coupled receptor 120
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the GPR120 gene. This receptor is abundantly expressed in intestine and is reported to bind free fatty acids. It is currently classed as an orphan receptor." [PRO:WCB, PubMed:15619630]
comment: Category=gene.
synonym: "G-protein coupled receptor 120" EXACT []
synonym: "G-protein coupled receptor 129" EXACT []
synonym: "G-protein coupled receptor GT01" EXACT []
synonym: "G-protein coupled receptor PGR4" EXACT []
synonym: "Gpr120" RELATED []
synonym: "GPR120" RELATED []
synonym: "GPR129" RELATED []
synonym: "PGR4" RELATED []
xref: PIRSF:PIRSF038589
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001418
name: G protein-coupled receptor 15
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the GPR15 gene. It is currently classed as an orphan receptor." [PRO:WCB]
comment: Category=gene.
synonym: "BOB" EXACT []
synonym: "G-protein coupled receptor 15" EXACT []
synonym: "Gpr15" RELATED []
synonym: "GPR15" RELATED []
xref: PIRSF:PIRSF038560
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001419
name: G protein-coupled receptor 182
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the GPR182 gene. It is currently classed as an orphan receptor." [PRO:WCB]
comment: Category=gene.
synonym: "ADMR" RELATED []
synonym: "Admr" RELATED []
synonym: "G-protein coupled receptor 182" EXACT []
synonym: "G10D" EXACT []
synonym: "Gpcr22" RELATED []
synonym: "Gpr182" RELATED []
synonym: "GPR182" RELATED []
synonym: "NOW" EXACT []
xref: PIRSF:PIRSF038647
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001420
name: GPR4-like G protein-coupled receptor
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the GPR4, GPR65, or GPR68 gene." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF005853
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001421
name: GPR6-like G protein-coupled receptor
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the GPR3, GPR6 or GPR12 gene." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF038626
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001422
name: H1 histamine receptor
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the HRH1 gene. The preferred ligand is histamine. This receptor mediates smooth muscle contraction, NO formation, increased vascular permeability, and other diverse effects." [PRO:WCB, PubMed:9311023]
comment: Category=gene.
synonym: "Bphs" RELATED []
synonym: "Histamine H1 receptor" EXACT []
synonym: "HRH1" RELATED []
synonym: "Hrh1" RELATED []
xref: PIRSF:PIRSF038644
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001423
name: H2 histamine receptor
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the HRH2 gene. The preferred ligand is histamine. This receptor mediates smooth muscle relaxation, gastric acid secretion, and other diverse effects." [PRO:WCB, PubMed:9311023]
comment: Category=gene.
synonym: "Gastric receptor I" EXACT []
synonym: "H2R" EXACT []
synonym: "Histamine H2 receptor" EXACT []
synonym: "HRH2" RELATED []
synonym: "Hrh2" RELATED []
xref: PIRSF:PIRSF038634
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001424
name: H3/H4 histamine receptor
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the HRH3 or HRH4 gene." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF038646
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001425
name: ICOS ligand
def: "A B7-related protein that is a translation product of the ICOSL gene." [PRO:WCB]
comment: Category=gene.
synonym: "B7 homolog 2" EXACT []
synonym: "B7-H2" EXACT []
synonym: "B7-like protein Gl50" EXACT []
synonym: "B7-related protein 1" EXACT []
synonym: "B7H2" RELATED []
synonym: "B7RP-1" EXACT []
synonym: "B7RP1" RELATED []
synonym: "CD275 antigen" EXACT []
synonym: "GL50" EXACT []
synonym: "ICOS ligand " EXACT []
synonym: "ICOSL" RELATED []
synonym: "ICOSLG" RELATED []
is_a: PRO:000001290 ! B7-related protein

[Term]
id: PRO:000001426
name: KiSS-1 receptor
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the KISS1R gene. The preferred ligands are peptides of 10-54 residues derived from the metastasis-suppressor KiSS-1 protein." [PRO:WCB, UniProtKB:Q15726]
comment: Category=gene.
synonym: "AXOR12" RELATED []
synonym: "G-protein coupled receptor 54" EXACT []
synonym: "Gpr54" RELATED []
synonym: "GPR54" RELATED []
synonym: "Hypogonadotropin-1" EXACT []
synonym: "KiSS-1 receptor" EXACT []
synonym: "KiSS-1R" EXACT []
synonym: "KISS1R" RELATED []
synonym: "Kiss1r" RELATED []
synonym: "Kisspeptins receptor" EXACT []
synonym: "Metastin receptor" EXACT []
synonym: "Ot7t175" RELATED []
synonym: "OT7T175" RELATED []
xref: PIRSF:PIRSF038571
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001427
name: LPAR1/S1PR1-like lysophospholipid receptor
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the LPAR1, S1PR1, or closely related gene and whose active form binds lysophosphatidic acid or sphingosine 1-phosphate." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF005435
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001428
name: LPAR4-like receptor
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the LPAR4 or P2RY5 gene." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF038616
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001429
name: MT1-like melatonin receptor
def: "A rhodopsin-like G protein-coupled that is a translation product of the MTNR1A, MTNR1B or GPR50 gene." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF038580
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001430
name: N-arachidonyl glycine receptor
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the GPR18 gene. The preferred ligand is reported to be N-arachidonyl glycine. It is currently classed as an orphan receptor." [PRO:WCB, PubMed:16844083]
comment: Category=gene.
synonym: "G-protein coupled receptor 18" EXACT []
synonym: "GPCRW" RELATED []
synonym: "Gpr18" RELATED []
synonym: "GPR18" RELATED []
synonym: "N-arachidonyl glycine receptor" EXACT []
synonym: "NAGly receptor" EXACT []
xref: PIRSF:PIRSF038577
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001431
name: N-formyl peptide receptor
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the FPR1, FPR2, or FPR3 gene and whose active form binds N-formyl methionyl peptides." [InterPro:IPR000826, PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF038561
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001432
name: P-selectin
def: "An E/P-selectin that is a translation product of the SELP gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD62P antigen" RELATED []
synonym: "GMP-140" EXACT []
synonym: "GMRP" RELATED []
synonym: "Granule membrane protein 140" EXACT []
synonym: "GRMP" RELATED []
synonym: "LECAM3" EXACT []
synonym: "Leukocyte-endothelial cell adhesion molecule 3" EXACT []
synonym: "P-selectin " EXACT []
synonym: "PADGEM" EXACT []
synonym: "SELP" RELATED []
xref: PIRSF:PIRSF500801
is_a: PRO:000001313 ! E/P-selectin

[Term]
id: PRO:000001433
name: P2RY10-like receptor
def: "A rhodopsin-like G protein-coupled receptor that is a product of the P2RY10 or closely related GPR174 gene. Purines are thought to be the preferred ligands." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF038617
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001434
name: P2RY12-like receptor
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the P2RY12, P2RY13, P2RY14, or GPR87 gene." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF038637
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001435
name: P2Y purinoceptor 1/2/3/4/6
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the P2RY1, P2RY2, P2RY3, P2RY4, or P2RY6 gene." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF005445
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001436
name: P2Y purinoceptor 11
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the P2RY11 gene. The preferred ligands are ATP and ADP." [PRO:WCB, UniProtKB:Q96G91]
comment: Category=gene.
synonym: "P2RY11" RELATED []
synonym: "P2Y purinoceptor 11" EXACT []
synonym: "P2Y11" EXACT []
xref: PIRSF:PIRSF038632
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001437
name: RPE-retinal G protein-coupled receptor
def: "A rhodopsin-likel G protein-coupled receptor that is a translation product of the RGR gene." [PRO:WCB]
comment: Category=gene.
synonym: "Rgr" RELATED []
synonym: "RGR" RELATED []
synonym: "RPE-retinal G protein-coupled receptor" EXACT []
xref: PIRSF:PIRSF038588
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001438
name: T-lymphocyte activation antigen CD80
def: "A B7-related protein that is a translation product of the CD80 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Activation B7-1 antigen" EXACT []
synonym: "B7" EXACT []
synonym: "BB1" EXACT []
synonym: "CD28LG" RELATED []
synonym: "CD28LG1" RELATED []
synonym: "CD80" RELATED []
synonym: "CTLA-4 counter-receptor B7.1" EXACT []
synonym: "LAB7" RELATED []
is_a: PRO:000001290 ! B7-related protein

[Term]
id: PRO:000001439
name: adenosine receptor
def: "A rhodopsin-like G protein-coupled receptor whose active form binds adenosine." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF005692
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001440
name: beta-1,3-glucuronyltransferase 1
def: "A beta-1,3-glucuronyltransferase that is a translation product of the B3GAT1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "B3GAT1" RELATED []
synonym: "Beta-1,3-glucuronyltransferase 1" EXACT []
synonym: "CD57" EXACT []
synonym: "Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1" EXACT []
synonym: "GlcAT-P" RELATED []
synonym: "GLCATP" RELATED []
synonym: "GlcUA:glycoprotein beta-1,3-glucuronyltransferase" EXACT []
synonym: "GlcUAT-P" EXACT []
synonym: "Glucuronosyltransferase-P" EXACT []
is_a: PRO:000001325 ! beta-1,3-glucuronyltransferase

[Term]
id: PRO:000001441
name: blood group Rh(CE) polypeptide
def: "An erythrocyte membrane protein Rh that is a translation product of the RHCE gene." [PRO:CNA]
comment: Category=gene.
synonym: "CD240CE" EXACT []
synonym: "Rh polypeptide 1" EXACT []
synonym: "Rh30A" EXACT []
synonym: "RHC" RELATED []
synonym: "RHE" RELATED []
synonym: "Rhesus C/E antigens" EXACT []
synonym: "RhIXB" EXACT []
is_a: PRO:000001348 ! erythrocyte membrane protein Rh

[Term]
id: PRO:000001442
name: blood group RhD polypeptide
def: "An erythrocyte membrane protein Rh that is a translation product of the RHD gene." [PRO:CNA]
comment: Category=gene.
synonym: "CD240" EXACT []
synonym: "CD240D" EXACT []
synonym: "Membrane protein Rh30" EXACT []
synonym: "Rhce" EXACT []
is_a: PRO:000001348 ! erythrocyte membrane protein Rh

[Term]
id: PRO:000001443
name: cadherin-2
def: "A cadherin that is a translation product of the CDH2 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Cadherin-2 " EXACT []
synonym: "CD325" EXACT []
synonym: "CDH2" RELATED []
synonym: "CDHN" RELATED []
synonym: "CDw325" EXACT []
synonym: "N-cadherin" EXACT []
synonym: "NCAD" RELATED []
synonym: "Neural cadherin" EXACT []
is_a: PRO:000001327 ! cadherin

[Term]
id: PRO:000001444
name: cadherin-5
def: "A cadherin that is a translation product of the CDH5 gene." [PRO:WCB]
comment: Category=gene.
synonym: "7B4 antigen" EXACT []
synonym: "Cadherin-5 " EXACT []
synonym: "CD144 antigen" EXACT []
synonym: "CDH5" RELATED []
synonym: "Vascular endothelial cadherin" EXACT []
synonym: "VE-cadherin" EXACT []
is_a: PRO:000001327 ! cadherin

[Term]
id: PRO:000001445
name: discoidin domain-containing receptor 1
def: "A discoidin domain-containing receptor that is a translation product of the DDR1 gene." [PMID:15888913, PRO:CNA]
comment: Category=gene.
synonym: "CD167 antigen-like family member A" EXACT []
synonym: "CD167a" EXACT [MGI:99216]
synonym: "DDR1" EXACT []
synonym: "discoidin domain receptor family, member 1 " EXACT []
synonym: "Eddr1" EXACT []
synonym: "epithelial discoidin domain-containing receptor 1" EXACT []
synonym: "Protein-tyrosine kinase MPK-6 " EXACT []
synonym: "Tyrosine kinase DDR" RELATED []
synonym: "Tyrosine-protein kinase CAK" EXACT []
is_a: PRO:000001342 ! discoidin domain-containing receptor

[Term]
id: PRO:000001446
name: discoidin domain-containing receptor 2
def: "A discoidin domain-containing receptor that is a translation product of the DDR2 gene." [PRO:CNA]
comment: Category=gene.
synonym: "CD167 antigen-like family member B" EXACT []
synonym: "CD167b" RELATED []
synonym: "EC:2.7.10.1" EXACT []
synonym: "Neurotrophic tyrosine kinase, receptor-related 3" EXACT []
synonym: "NTRKR3" RELATED []
synonym: "Receptor protein-tyrosine kinase TKT" EXACT []
synonym: "TYRO10" RELATED []
synonym: "Tyrosine-protein kinase TYRO10" EXACT []
is_a: PRO:000001342 ! discoidin domain-containing receptor

[Term]
id: PRO:000001447
name: epithelial cadherin
def: "A cadherin that is a translation product of the CDH1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Cadherin-1" EXACT []
synonym: "CAM 120/80" EXACT []
synonym: "CD324" EXACT []
synonym: "CD324 antigen" EXACT []
synonym: "CDH1" RELATED []
synonym: "CDHE" RELATED []
synonym: "E-cadherin" EXACT []
synonym: "Epithelial cadherin " EXACT []
synonym: "UVO" RELATED []
synonym: "Uvomorulin" EXACT []
is_a: PRO:000001327 ! cadherin

[Term]
id: PRO:000001448
name: fibroblast growth factor receptor 1
def: "A fibroblast growth factor receptor that is a translation product of the FGFR1 gene." [PRO:CNA]
comment: Category=gene.
synonym: "basic fibroblast growth factor receptor 1" EXACT []
synonym: "CD331" EXACT []
synonym: "EC:2.7.10.1" RELATED []
synonym: "FGFR-1" EXACT []
synonym: "FLT2" EXACT [MGI:TM]
synonym: "Fms-like tyrosine kinase 2" EXACT []
synonym: "N-SAM" RELATED [MGI:TM]
is_a: PRO:000001349 ! fibroblast growth factor receptor

[Term]
id: PRO:000001449
name: fibroblast growth factor receptor 2
def: "A fibroblast growth factor receptor that is a translation product of the FGFR2 gene." [PRO:CNA]
comment: Category=gene.
synonym: "CD332" EXACT []
synonym: "EC:2.7.10.1" RELATED []
synonym: "FGFR2" EXACT []
synonym: "Keratinocyte growth factor receptor" EXACT []
synonym: "KFGR" EXACT []
is_a: PRO:000001349 ! fibroblast growth factor receptor

[Term]
id: PRO:000001450
name: fibroblast growth factor receptor 3
def: "A fibroblast growth factor receptor that is a translation product of the FGFR3 gene." [PRO:CNA]
comment: Category=gene.
synonym: "ACH" EXACT [MGI:TM]
synonym: "CEK2" EXACT [MGI:TM]
synonym: "EC:2.7.10.1" RELATED []
synonym: "FGFR-3" EXACT []
is_a: PRO:000001349 ! fibroblast growth factor receptor

[Term]
id: PRO:000001451
name: fibroblast growth factor receptor 4
def: "A fibroblast growth factor receptor that is a translation product of the FGFR4 gene." [PRO:CNA]
comment: Category=gene.
synonym: "CD334" EXACT []
synonym: "EC:2.7.10.1" RELATED []
synonym: "FGFR-4" EXACT []
synonym: "TKF" EXACT []
is_a: PRO:000001349 ! fibroblast growth factor receptor

[Term]
id: PRO:000001452
name: free fatty acid receptor
def: "A rhodopsin-like G protein-coupled receptor whose active form binds free fatty acid. In humans there are four tandem genes located downstream of CD22 on chromosome 19. One of these, GPR42P, is a pseudogene formed by recent duplication of FFAR3." [PRO:WCB, PubMed:15684720, PubMed:17052194]
comment: Category=family.
xref: PIRSF:PIRSF006358
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001453
name: frizzled-10
def: "A G protein-coupled receptor frizzled that is a translation product of the FZD10 gene." [PRO:CNA]
comment: Category=gene.
synonym: "CD350" EXACT []
is_a: PRO:000001315 ! G protein-coupled receptor frizzled

[Term]
id: PRO:000001454
name: frizzled-4
def: "A G protein-coupled receptor frizzled that is a translation product of the FZD4 gene." [PRO:CNA]
comment: Category=gene.
synonym: "CD344" EXACT []
synonym: "FZD4" RELATED []
is_a: PRO:000001315 ! G protein-coupled receptor frizzled

[Term]
id: PRO:000001455
name: frizzled-9
def: "A G protein-coupled receptor frizzled that is a translation product of the FZD9 gene." [PRO:CNA]
comment: Category=gene.
synonym: "CD349" EXACT []
synonym: "FZD9" RELATED []
is_a: PRO:000001315 ! G protein-coupled receptor frizzled

[Term]
id: PRO:000001456
name: fucosyltransferase FUT4
def: "A fucosyltransferase that is a translation product of the FUT4 gene." [PRO:CNA]
comment: Category=gene.
synonym: "alpha-(1,3)-fucosyltransferase" RELATED []
synonym: "CD15" EXACT []
synonym: "ELAM-1 ligand fucosyltransferase" EXACT []
synonym: "FCT3A" EXACT []
synonym: "FucT-IV" EXACT []
synonym: "Galactoside 3-L-fucosyltransferase " EXACT []
is_a: PRO:000001320 ! alpha-(1,3)-fucosyltransferase

[Term]
id: PRO:000001457
name: galanin receptor
def: "A rhodopsin-like G protein-coupled receptor whose active form binds the neuropeptide galanin." [PRO:WCB, PubMed:10689365]
comment: Category=family.
xref: PIRSF:PIRSF038570
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001458
name: gamma-glutamyltranspeptidase 1
def: "A gamma-glutamyltransferase that is a translation product of the GGT1 gene." [PRO:CNA]
comment: Category=gene.
synonym: "CD224" EXACT []
synonym: "GGT" EXACT []
is_a: PRO:000001351 ! gamma-glutamyltranspeptidase

[Term]
id: PRO:000001459
name: glucose-dependent insulinotropic receptor
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the GPR119 gene. It is reported to bind oleoylethanolamide. It is currently classed as an orphan receptor." [PRO:WCB, PubMed:16517404]
comment: Category=gene.
synonym: "G-protein coupled receptor 119" EXACT []
synonym: "Glucose-dependent insulinotropic receptor" EXACT []
synonym: "Gpr119" RELATED []
synonym: "GPR119" RELATED []
xref: PIRSF:PIRSF038584
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001460
name: glycophorin-A
def: "A glycophorin that is a translation product of the GYPA gene. It is the major sialoglycoprotein of the erythrocyte membrane. Structurally, glycophorin A consists of an N-terminal extracellular domain, heavily glycosylated on Ser and threonine residues, followed by a transmembrane region and a C-terminal cytoplasmic domain." [Interpro:IPR001195, PRO:CNA]
comment: Category=gene.
synonym: "CD235a" RELATED []
synonym: "MN sialoglycoprotein" RELATED []
synonym: "PAS-2" EXACT []
synonym: "Sialoglycoprotein alpha" EXACT []
is_a: PRO:000001352 ! glycophorin

[Term]
id: PRO:000001461
name: glycophorin-B
def: "A glycophorin that is a translation product of the GYPB gene." [PRO:CNA]
comment: Category=gene.
synonym: "CD235b" EXACT []
is_a: PRO:000001352 ! glycophorin

[Term]
id: PRO:000001462
name: glycophorin-C
def: "A glycophorin that is a translation product of the GYPC gene." [PRO:CNA]
comment: Category=gene.
synonym: "CD236" EXACT []
is_a: PRO:000001352 ! glycophorin

[Term]
id: PRO:000001463
name: glycoprotein hormone receptor
def: "A rhodopsin-like G protein-coupled receptor whose active form binds glycoprotein hormones (thyrotropin, follitropin, lutropin, choriogonadotropin)." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF002408
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001464
name: gonadotropin-releasing hormone receptor
def: "A rhodopsin-like G protein-coupled receptor whose active form binds gonadotropin-releasing hormone I or II." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF038576
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001465
name: high affinity immunoglobulin gamma Fc receptor I
def: "An immunoglobulin gamma Fc receptor I that is a translation product of the FCGR1 or FCGR1A gene." [PRO:CNA]
comment: Category=gene.
synonym: "CD64" EXACT []
synonym: "Fc-gamma RI" EXACT []
synonym: "Fcg1" RELATED []
synonym: "FCGR1A" EXACT [MGI:TM]
is_a: PRO:000001356 ! immunoglobulin gamma Fc receptor I

[Term]
id: PRO:000001466
name: high affinity immunoglobulin gamma Fc receptor IB
def: "An immunoglobulin gamma Fc receptor I that is a translation product of the FCGR1B gene." [PRO:CNA]
comment: Category=gene.
synonym: "CD64" RELATED [MGI:TM]
synonym: "Fc-gamma RIB" RELATED []
synonym: "FcRIB" EXACT []
synonym: "IGFRB" RELATED []
is_a: PRO:000001356 ! immunoglobulin gamma Fc receptor I

[Term]
id: PRO:000001467
name: intercellular adhesion molecule 1
def: "An intercellular adhesion molecule 1/3 that is a translation product of the ICAM1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD54 antigen" EXACT []
synonym: "ICAM-1" EXACT []
synonym: "ICAM1" RELATED []
synonym: "Major group rhinovirus receptor" EXACT []
synonym: "MALA-2" EXACT []
synonym: "MyD10" EXACT []
is_a: PRO:000001357 ! intercellular adhesion molecule 1/3

[Term]
id: PRO:000001468
name: intercellular adhesion molecule 3
def: "An intercellular adhesion molecule 1/3 that is a translation product of the ICAM3 gene. This gene has been found in primates and Bos taurus, but not in mouse and rat." [PRO:WCB]
comment: Category=gene.
synonym: "CD50 antigen" EXACT []
synonym: "CDw50" EXACT []
synonym: "ICAM-3" EXACT []
synonym: "ICAM-R" EXACT []
synonym: "ICAM3" RELATED []
is_a: PRO:000001357 ! intercellular adhesion molecule 1/3

[Term]
id: PRO:000001469
name: interleukin-28A
def: "An interferon lambda that is a translation product of the IL28A gene." [PRO:CNA]
comment: Category=gene.
synonym: "Cytokine ZCYTO20" EXACT []
synonym: "IFN-lambda-2" EXACT []
synonym: "Ifnl2" RELATED []
synonym: "IL-28A" EXACT []
synonym: "IL28A" RELATED []
synonym: "Interferon lambda-2" EXACT []
is_a: PRO:000001362 ! interferon lambda

[Term]
id: PRO:000001470
name: interleukin-28B
def: "An interferon lambda that is a translation product of the IL28B gene." [PRO:CNA]
comment: Category=gene.
synonym: "Cytokine ZCYTO22" EXACT []
synonym: "IFN-lambda-3" EXACT []
synonym: "IFN-lambda-4" EXACT []
synonym: "IFNL3" RELATED []
synonym: "IFNL4" RELATED []
synonym: "IL-28B" EXACT []
synonym: "IL-28C" EXACT []
synonym: "IL28B" RELATED []
synonym: "IL28C" RELATED []
synonym: "Interferon lambda-3" EXACT []
synonym: "Interferon lambda-4" EXACT []
is_a: PRO:000001362 ! interferon lambda

[Term]
id: PRO:000001471
name: interleukin-10
def: "A class 2 cytokine, IL-10 type that is a translation product of the IL10 gene. Active interleukin-10 inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T cells. Structurally, IL-10 is a protein of about 160 amino acids that contains four conserved cysteines involved in disulfide bonds." [PANTHER:PTHR11585\:SF1, PRO:JAN]
comment: Category=gene.
synonym: "CSIF" EXACT []
synonym: "Cytokine synthesis inhibitory factor" EXACT []
synonym: "IL-10" EXACT []
xref: PANTHER:PTHR11585\:SF1
is_a: PRO:000001335 ! class 2 cytokine, IL-10 type

[Term]
id: PRO:000001472
name: interleukin-19
def: "A class 2 cytokine, IL-10 type that is a translation product of the IL19 gene." [PRO:CNA]
comment: Category=gene.
synonym: "IL-19" EXACT []
synonym: "Melanoma differentiation-associated protein-like protein" EXACT []
synonym: "ZMDA1" EXACT []
is_a: PRO:000001335 ! class 2 cytokine, IL-10 type

[Term]
id: PRO:000001473
name: interleukin-20
def: "A class 2 cytokine, IL-10 type that is a translation product of the IL20 gene." [PRO:CNA]
comment: Category=gene.
synonym: "Four alpha helix cytokine Zcyto10" EXACT []
synonym: "IL-20" EXACT []
synonym: "Il20" RELATED []
synonym: "Zcyto10" RELATED []
is_a: PRO:000001335 ! class 2 cytokine, IL-10 type

[Term]
id: PRO:000001474
name: interleukin-24
def: "A class 2 cytokine, IL-10 type that is a translation product of the IL24 gene." [PRO:CNA]
comment: Category=gene.
synonym: "IL-4-induced secreted protein" EXACT []
synonym: "IL24" RELATED []
synonym: "MDA-7" EXACT []
synonym: "Mda7" RELATED []
synonym: "Melanoma differentiation-associated gene 7 protein" EXACT []
synonym: "ST16" RELATED []
synonym: "Suppression of tumorigenicity 16 protein" EXACT []
synonym: "Th2-specific cytokine FISP" EXACT []
is_a: PRO:000001335 ! class 2 cytokine, IL-10 type

[Term]
id: PRO:000001475
name: interleukin-26
def: "A class 2 cytokine, IL-10 type that is a translation product of the IL26 gene." [PRO:CNA]
comment: Category=gene.
synonym: "AK155 protein" EXACT []
synonym: "IL26" RELATED []
is_a: PRO:000001335 ! class 2 cytokine, IL-10 type

[Term]
id: PRO:000001476
name: interleukin-29
def: "An interferon lambda that is a translation product of the IL29 gene." [PRO:CNA]
comment: Category=gene.
synonym: "Cytokine ZCYTO21" EXACT []
synonym: "IFN-lambda-1" EXACT []
synonym: "IFNL1" RELATED []
synonym: "IL-29" EXACT []
synonym: "IL29" RELATED []
synonym: "Interferon lambda-1" EXACT []
is_a: PRO:000001362 ! interferon lambda

[Term]
id: PRO:000001477
name: leucine-rich repeat-containing G protein-coupled receptor 4/5/6
def: "A rhodopsin-like G protein-coupled receptor with a core domain composition consisting of a leucine-rich repeat N-terminal domain (PF01462), up to 17 Leucine-rich repeats (PF00560), and a 7 transmembrane receptor (rhodopsin family) (PF00001) domain." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF038668
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001478
name: leukotriene B4 receptor
def: "A rhodopsin-like G protein-coupled receptor whose active form binds leukotriene B4." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF038573
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001479
name: low affinity immunoglobulin gamma Fc region receptor II
def: "An immunoglobulin gamma Fc receptor II/III/IV that is a translation product of the FCGR2 gene." [PRO:CNA]
comment: Category=gene.
synonym: "CD32" RELATED []
synonym: "Fc gamma receptor IIB" EXACT []
synonym: "Fcgr2b" RELATED []
synonym: "IgG Fc receptor II beta" EXACT []
synonym: "Lymphocyte antigen 17" EXACT []
is_a: PRO:000001355 ! immunoglobulin gamma Fc receptor II/III/IV

[Term]
id: PRO:000001480
name: low affinity immunoglobulin gamma Fc region receptor II-a
def: "An immunoglobulin gamma Fc receptor II/III/IV that is a translation product of the FCGR2A gene." [PRO:CNA]
comment: Category=gene.
synonym: "CD32" RELATED []
synonym: "CDw32" RELATED []
synonym: "Fc-gamma RII-a" EXACT []
synonym: "Fc-gamma-RIIa" EXACT []
synonym: "FcGR" RELATED []
synonym: "FCGR2A1" EXACT []
synonym: "IGFR2" RELATED []
is_a: PRO:000001355 ! immunoglobulin gamma Fc receptor II/III/IV

[Term]
id: PRO:000001481
name: low affinity immunoglobulin gamma Fc region receptor II-b
def: "An immunoglobulin gamma Fc receptor II/III/IV that is a translation product of the FCGR2B gene." [PRO:CNA]
comment: Category=gene.
synonym: "CD32" RELATED []
synonym: "CDw32" RELATED []
synonym: "Fc-gamma RII-b" EXACT []
synonym: "Fc-gamma-RIIb" EXACT []
is_a: PRO:000001355 ! immunoglobulin gamma Fc receptor II/III/IV

[Term]
id: PRO:000001482
name: low affinity immunoglobulin gamma Fc region receptor II-c
def: "An immunoglobulin gamma Fc receptor II/III/IV that is a translation product of the FCGR2C gene." [PRO:CNA]
comment: Category=gene.
synonym: "CD32" RELATED []
synonym: "CDw32" RELATED []
synonym: "Fc-gamma RII-c" EXACT []
synonym: "Fc-gamma-RIIc" EXACT []
is_a: PRO:000001355 ! immunoglobulin gamma Fc receptor II/III/IV

[Term]
id: PRO:000001483
name: low affinity immunoglobulin gamma Fc region receptor III
def: "An immunoglobulin gamma Fc receptor II/III/IV that is a translation product of the FCGR3 gene." [PRO:CNA]
comment: Category=gene.
synonym: "CD16" EXACT []
synonym: "Fc-gamma RIII" EXACT []
synonym: "FcgammaR3" EXACT [MGI:TM]
synonym: "IgG Fc receptor III" EXACT []
synonym: "Ly-17" EXACT [MGI:TM]
is_a: PRO:000001355 ! immunoglobulin gamma Fc receptor II/III/IV

[Term]
id: PRO:000001484
name: low affinity immunoglobulin gamma Fc region receptor III-A
def: "An immunoglobulin gamma Fc receptor II/III/IV that is a translation product of the FCGR3A gene." [PRO:CNA]
comment: Category=gene.
synonym: "CD16a" EXACT []
synonym: "CD16a antigen" EXACT []
synonym: "Fc-gamma RIII-alpha" EXACT []
synonym: "FcR-10" EXACT []
synonym: "FR3" RELATED []
synonym: "IgG Fc receptor III-2" EXACT []
is_a: PRO:000001355 ! immunoglobulin gamma Fc receptor II/III/IV

[Term]
id: PRO:000001485
name: low affinity immunoglobulin gamma Fc region receptor III-B
def: "An immunoglobulin gamma Fc receptor II/III/IV that is a translation product of the FCGR3B gene." [PRO:CNA]
comment: Category=gene.
synonym: "CD16b" EXACT []
synonym: "Fc-gamma RIII" EXACT []
synonym: "FCGR3" EXACT []
synonym: "IGFR3" RELATED []
synonym: "IgG Fc receptor III-1" EXACT []
is_a: PRO:000001355 ! immunoglobulin gamma Fc receptor II/III/IV

[Term]
id: PRO:000001486
name: lysophosphatidic acid receptor 5
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the LPAR5 gene. The reported ligand is lysophaphatidic acid. It is currently classed as an orphan receptor. This receptor is not closely related to other lysophosphatidic acid receptors." [PRO:WCB, PubMed:16651401]
comment: Category=gene.
synonym: "G-protein coupled receptor 92" EXACT []
synonym: "G-protein coupled receptor 93" EXACT []
synonym: "Gm1072" RELATED []
synonym: "Gpr92" RELATED []
synonym: "GPR92" RELATED []
synonym: "GPR93" RELATED []
synonym: "LPA receptor 5" EXACT []
synonym: "LPA-5" EXACT []
synonym: "LPAR5" RELATED []
synonym: "Lpar5" RELATED []
synonym: "Lysophosphatidic acid receptor 5" EXACT []
xref: PIRSF:PIRSF038630
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001487
name: mas-related G protein-coupled receptor
def: "A rhodopsin-like G protein-coupled receptor related to the proto-oncogene MAS. The protein has a very short extracellular amino-terminal segment that is not a signal sequence. These receptors may bind neuropeptides and may regulate nociceptor function and/or development, including the sensation or modulation of pain. Because genes for these receptors have undergone duplication, including lineage-specific expansions, and pseudogenization, it is sometimes difficult to distinguish orthologs and paralogs." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF001712
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001488
name: muscarinic acetylcholine receptor
def: "A rhodopsin-like G protein-coupled receptor whose active forms binds the neurotransmitter acetylcholine. They are more sensitive to muscarine than to nicotine." [PRO:WCB, Wikipedia:Muscarinic_acetylcholine_receptor]
comment: Category=family.
xref: PIRSF:PIRSF038548
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001489
name: neuromedin U receptor
def: "A rhodopsin-like G protein-coupled receptor whose active form binds the neuropeptide neuromedin U." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF038640
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001490
name: neuropeptide FF receptor
def: "A rhodopsin-like G protein-coupled receptor whose active form binds neuropeptide FF." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF038613
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001491
name: neuropeptide S receptor
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the NPSR1 gene. The preferred ligand is neuropeptide S." [PRO:WCB]
comment: Category=gene.
synonym: "G-protein coupled receptor 154" EXACT []
synonym: "G-protein coupled receptor for asthma susceptibility" EXACT []
synonym: "G-protein coupled receptor PGR14" EXACT []
synonym: "Gpr154" RELATED []
synonym: "GPR154" RELATED []
synonym: "GPRA" RELATED []
synonym: "Neuropeptide S receptor" EXACT []
synonym: "NPSR1" RELATED []
synonym: "Npsr1" RELATED []
synonym: "PGR14" RELATED []
synonym: "Pgr14" RELATED []
xref: PIRSF:PIRSF038664
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001492
name: neuropeptide Y receptor 1/4/6
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the NPY1R, PPYR1, or NPY6R gene." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF038609
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001493
name: neuropeptide Y receptor 2
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the NPY2R gene. The preferred ligands are neuropeptides YY and Y.  This receptor is prominent in the brain and is involved in regulation of food intake, of gastrointestinal motility, of the cardiovascular system, and of neuronal excitability." [PRO:WCB, PubMed:11287107]
comment: Category=gene.
synonym: "Neuropeptide Y receptor type 2" EXACT []
synonym: "NPY-Y2 receptor" EXACT []
synonym: "NPY2-R" EXACT []
synonym: "NPY2R" RELATED []
synonym: "Npy2r" RELATED []
xref: PIRSF:PIRSF038610
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001494
name: neuropeptide Y receptor 5
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the NPY5R gene. The preferred ligands is neuropeptides Y and YY." [PRO:WCB]
comment: Category=gene.
synonym: "Neuropeptide Y receptor type 5" EXACT []
synonym: "NPY-Y5 receptor" EXACT []
synonym: "Npy5" RELATED []
synonym: "NPY5-R" EXACT []
synonym: "NPY5R" RELATED []
synonym: "Npy5r" RELATED []
synonym: "NPYR5" RELATED []
synonym: "NPYY5" EXACT []
synonym: "Y5 receptor" EXACT []
xref: PIRSF:PIRSF038600
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001495
name: neuropeptides B/W receptor
def: "A rhodopsin-like G protein-coupled receptor whose active form binds neuropeptides B and W." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF038569
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001496
name: nicotinic acid receptor
def: "A rhodopsin-like G protein-coupled receptor whose active form binds nicotinic acid." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF038604
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001497
name: opioid receptor
def: "A rhodopsin-like G protein-coupled receptor whose active form binds opioids." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF038567
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001498
name: orexigenic neuropeptide QRFP receptor
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the GPR103 gene. This receptor is expressed at high levels in brain and retina and at moderate levels in the heart, kidney, testis and thyroid." [PRO:WCB, UniProtKB:Q96P65]
comment: Category=gene.
synonym: "AQ27" EXACT []
synonym: "G-protein coupled receptor 103" EXACT []
synonym: "Gpr103" RELATED []
synonym: "GPR103" RELATED []
synonym: "Orexigenic neuropeptide QRFP receptor" EXACT []
synonym: "SP9155" EXACT []
xref: PIRSF:PIRSF038648
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001499
name: orexin receptor
def: "A rhodopsin-like G protein-coupled receptor whose active form binds the neuropeptide hormone orexin (hypocretin)." [PRO:WCB]
comment: Category=family.
synonym: "hypocretin receptor" EXACT []
xref: PIRSF:PIRSF038624
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001500
name: oxoeicosanoid receptor 1
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the OXER1 gene. The preferred ligands are eicosanoids and polyunsaturated fatty acids. This receptor has been found in humans and not in other mammals." [PRO:WCB, UniProtKB:Q8TDS5]
comment: Category=gene.
synonym: "5-oxo-ETE G-protein coupled receptor" EXACT []
synonym: "G-protein coupled receptor 170" EXACT []
synonym: "G-protein coupled receptor R527" EXACT []
synonym: "G-protein coupled receptor TG1019" EXACT []
synonym: "GPR170" RELATED []
synonym: "OXER1" RELATED []
synonym: "Oxoeicosanoid receptor 1" EXACT []
xref: PIRSF:PIRSF038585
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001501
name: platelet-activating factor receptor
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the PTAFR gene." [PRO:WCB]
comment: Category=gene.
synonym: "PAF-R" EXACT []
synonym: "PAFR" RELATED []
synonym: "Platelet-activating factor receptor" EXACT []
synonym: "Ptafr" RELATED []
synonym: "PTAFR" RELATED []
xref: PIRSF:PIRSF038631
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001502
name: probable G protein-coupled receptor 1
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the GPR1 gene. It is currently classed as an orphan receptor." [PRO:WCB, PubMed:15914470]
comment: Category=gene.
synonym: "GPR1" RELATED []
synonym: "Gpr1" RELATED []
synonym: "Probable G-protein coupled receptor 1" EXACT []
xref: PIRSF:PIRSF038562
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001503
name: probable G protein-coupled receptor 101
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the GPR101 gene. It is currently classed as an orphan receptor." [PRO:WCB]
comment: Category=gene.
synonym: "Gpr101" RELATED []
synonym: "GPR101" RELATED []
synonym: "Probable G-protein coupled receptor 101" EXACT []
xref: PIRSF:PIRSF038660
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001504
name: probable G protein-coupled receptor 132
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the GPR132 gene. It is currrently classed as an orphan receptor." [PRO:WCB]
comment: Category=gene.
synonym: "G2 accumulation protein" EXACT []
synonym: "G2a" RELATED []
synonym: "G2A" RELATED []
synonym: "GPR132" RELATED []
synonym: "Gpr132" RELATED []
synonym: "Probable G-protein coupled receptor 132" EXACT []
xref: PIRSF:PIRSF038627
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001505
name: probable G protein-coupled receptor 135
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the GPR135 gene. It is currently classed as an orphan receptor." [PRO:WCB]
comment: Category=gene.
synonym: "Gpr135" RELATED []
synonym: "GPR135" RELATED []
synonym: "Probable G-protein coupled receptor 135" EXACT []
xref: PIRSF:PIRSF038590
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001506
name: probable G protein-coupled receptor 139
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the GPR139 gene. It is currently classed as an orphan receptor." [PRO:WCB]
comment: Category=gene.
synonym: "G(q)-coupled orphan receptor GPRg1" EXACT []
synonym: "G-protein-coupled receptor PGR3" EXACT []
synonym: "Gm495" RELATED []
synonym: "Gpr139" RELATED []
synonym: "GPR139" RELATED []
synonym: "GPRG1" RELATED []
synonym: "Gprg1" RELATED []
synonym: "PGR3" RELATED []
synonym: "Pgr3" RELATED []
synonym: "Probable G-protein coupled receptor 139" EXACT []
xref: PIRSF:PIRSF038652
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001507
name: probable G protein-coupled receptor 141
def: "A rhodopsin-like G protein-coupled receptor 141 that is a translation product of the GPR141 gene. It is currently classed as an orphan receptor." [PRO:WCB]
comment: Category=gene.
synonym: "G-protein coupled receptor PGR13" EXACT []
synonym: "GPR141" RELATED []
synonym: "Gpr141" RELATED []
synonym: "Pgr13" RELATED []
synonym: "PGR13" RELATED []
synonym: "Probable G-protein coupled receptor 141" EXACT []
xref: PIRSF:PIRSF038599
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001508
name: probable G protein-coupled receptor 142
def: "A rhodopsin-like G protein-coupled receptor 142 that is a translation product of the GPR142 gene. It is currently classed as an orphan receptor." [PRO:WCB]
comment: Category=gene.
synonym: "G-protein coupled receptor PGR2" EXACT []
synonym: "Gpr142" RELATED []
synonym: "GPR142" RELATED []
synonym: "PGR2" RELATED []
synonym: "Probable G-protein coupled receptor 142" EXACT []
xref: PIRSF:PIRSF038658
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001509
name: probable G protein-coupled receptor 146
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the GPR146 gene. It is currently classed as an orphan receptor." [PRO:WCB]
comment: Category=gene.
synonym: "G-protein coupled receptor PGR8" EXACT []
synonym: "Gpr146" RELATED []
synonym: "GPR146" RELATED []
synonym: "PGR8" RELATED []
synonym: "Probable G-protein coupled receptor 146" EXACT []
xref: PIRSF:PIRSF038598
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001510
name: probable G protein-coupled receptor 148
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the GPR148 gene. This receptor has been found in humans and not in other mammals. It is currently classified as an orphan receptor." [PRO:WCB]
comment: Category=gene.
synonym: "Brain and testis restricted GPCR" EXACT []
synonym: "BTR" RELATED []
synonym: "G-protein coupled receptor PGR6" EXACT []
synonym: "GPR148" RELATED []
synonym: "PGR6" RELATED []
synonym: "Probable G-protein coupled receptor 148" EXACT []
xref: PIRSF:PIRSF038669
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001511
name: probable G protein-coupled receptor 149
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the GPR149 gene." [PRO:WCB]
comment: Category=gene.
synonym: "G-protein coupled receptor PGR10" EXACT []
synonym: "Ieda" RELATED []
synonym: "Induced early in differentiating astrocytes gene protein" EXACT []
synonym: "PGR10" RELATED []
synonym: "Probable G-protein coupled receptor 149" EXACT []
xref: PIRSF:PIRSF038717
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001512
name: probable G protein-coupled receptor 150
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the GPR150 gene. It is currently classed as an orphan receptor." [PRO:WCB]
comment: Category=gene.
synonym: "G-protein coupled receptor PGR11" EXACT []
synonym: "GPR150" RELATED []
synonym: "Gpr150" RELATED []
synonym: "Pgr11" RELATED []
synonym: "Probable G-protein coupled receptor 150" EXACT []
xref: PIRSF:PIRSF038594
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001513
name: probable G protein-coupled receptor 151
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the GPR151 gene. It is currently classed as an orphan receptor." [PRO:WCB]
comment: Category=gene.
synonym: "G-protein coupled receptor PGR7" EXACT []
synonym: "GPCR-2037" EXACT []
synonym: "Gpr151" RELATED []
synonym: "GPR151" RELATED []
synonym: "Pgr7" RELATED []
synonym: "PGR7" RELATED []
synonym: "Probable G-protein coupled receptor 151" EXACT []
synonym: "Probable G-protein coupled receptor 151 protein" EXACT []
xref: PIRSF:PIRSF038655
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001514
name: probable G protein-coupled receptor 152
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the GPR152 gene. It is currently classed as an orphan receptor." [PRO:WCB]
comment: Category=gene.
synonym: "G-protein coupled receptor PGR5" EXACT []
synonym: "Gpr152" RELATED []
synonym: "GPR152" RELATED []
synonym: "PGR5" RELATED []
synonym: "Probable G-protein coupled receptor 152" EXACT []
xref: PIRSF:PIRSF038661
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001515
name: probable G protein-coupled receptor 153/162
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the GPR153 or GPR162 gene." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF038665
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001516
name: probable G protein-coupled receptor 160
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the GPR160 gene." [PRO:WCB]
comment: Category=gene.
synonym: "GPCR150" RELATED []
synonym: "GPR160" RELATED []
synonym: "Probable G-protein coupled receptor 160" EXACT []
xref: PIRSF:PIRSF038716
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001517
name: probable G protein-coupled receptor 161
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the GPR161 gene. It is currently classed as an orphan receptor." [PRO:WCB]
comment: Category=gene.
synonym: "G-protein coupled receptor RE2" EXACT []
synonym: "GPR161" RELATED []
synonym: "Gpr161" RELATED []
synonym: "Probable G-protein coupled receptor 161" EXACT []
xref: PIRSF:PIRSF038657
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001518
name: probable G protein-coupled receptor 171
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the GPR171 gene. It is currently classed as an orphan receptor." [PRO:WCB]
comment: Category=gene.
synonym: "G-protein coupled receptor H963" EXACT []
synonym: "GPR171" RELATED []
synonym: "Gpr171" RELATED []
synonym: "H963" RELATED []
synonym: "Probable G-protein coupled receptor 171" EXACT []
synonym: "probable G-protein coupled receptor 171" EXACT []
xref: PIRSF:PIRSF038638
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001519
name: probable G protein-coupled receptor 176
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the GPR176 gene. This gene is expressed in human brain and in rat brain and spleen. The protein sequence has a predicted carboxyl-terminal cytoplasmic domain of about 195 residues." [PRO:WCB, PubMed:7893747]
comment: Category=gene.
synonym: "Agr9" RELATED []
synonym: "G-protein coupled receptor AGR9" EXACT []
synonym: "GPR176" RELATED []
synonym: "Gpr176" RELATED []
synonym: "HB-954" EXACT []
synonym: "Probable G-protein coupled receptor 176" EXACT []
xref: PIRSF:PIRSF038659
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001520
name: probable G protein-coupled receptor 19
def: "A rhodopsin-like G protein-coupled receptor 19 that is a translation product of the GPR19 gene. It is currently classed as an orphan receptor." [PRO:WCB]
comment: Category=gene.
synonym: "GPR-NGA" EXACT []
synonym: "Gpr19" RELATED []
synonym: "GPR19" RELATED []
synonym: "Probable G-protein coupled receptor 19" EXACT []
xref: PIRSF:PIRSF038597
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001521
name: probable G protein-coupled receptor 20
def: "A rhhodopsin-like G protein-coupled receptor that is a translation product of the GPR20 gene. It is currently classed as an orphan receptor." [PRO:WCB]
comment: Category=gene.
synonym: "Gpr20" RELATED []
synonym: "GPR20" RELATED []
synonym: "Probable G-protein coupled receptor 20" EXACT []
xref: PIRSF:PIRSF038649
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001522
name: probable G protein-coupled receptor 21/52
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the GPR21 or GPR52 gene." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF038583
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001523
name: probable G protein-coupled receptor 22
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the GPR22 gene. It is currently classed as an orphan receptor." [PRO:WCB]
comment: Category=gene.
synonym: "GPR22" RELATED []
synonym: "Gpr22" RELATED []
synonym: "Probable G-protein coupled receptor 22" EXACT []
xref: PIRSF:PIRSF038656
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001524
name: probable G protein-coupled receptor 25
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the GPR25 gene. It is currently classed as an orphan receptor." [PRO:WCB]
comment: Category=gene.
synonym: "Gm1300" RELATED []
synonym: "GPR25" RELATED []
synonym: "Gpr25" RELATED []
synonym: "Probable G-protein coupled receptor 25" EXACT []
xref: PIRSF:PIRSF038574
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001525
name: probable G protein-coupled receptor 26/78
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the GPR26 or GPR78 gene." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF038593
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001526
name: probable G protein-coupled receptor 27/85/173
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the GPR27, GPR85, or GPR173 gene." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF038595
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001527
name: probable G protein-coupled receptor 31
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the GPR31 gene. It is currently classed as an orphan receptor." [PRO:WCB]
comment: Category=gene.
synonym: "GPR31" RELATED []
synonym: "Probable G-protein coupled receptor 31" EXACT []
xref: PIRSF:PIRSF038605
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001528
name: probable G protein-coupled receptor 32
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the GPR32 gene. It is currently classed as an orphan receptor." [PRO:WCB]
comment: Category=gene.
synonym: "GPR32" RELATED []
synonym: "Probable G-protein coupled receptor 32" EXACT []
xref: PIRSF:PIRSF038563
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001529
name: probable G protein-coupled receptor 33
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the GPR33 gene. It is currently classed as an orphan receptor. GPR33 has undergone independent pseudogenization in human, chimpanzee, orangutan, siamang and rat." [PRO:WCB, UniProtKB:Q49SQ1]
comment: Category=gene.
synonym: "GPR33" RELATED []
synonym: "Gpr33" RELATED []
synonym: "Probable G-protein coupled receptor 33" EXACT []
xref: PIRSF:PIRSF038565
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001530
name: probable G protein-coupled receptor 34
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the GPR34 gene. It is currently classed as an orphan receptor." [PRO:WCB]
comment: Category=gene.
synonym: "GPR34" RELATED []
synonym: "Gpr34" RELATED []
synonym: "Probable G-protein coupled receptor 34" EXACT []
xref: PIRSF:PIRSF038639
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001531
name: probable G protein-coupled receptor 35
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the GPR35 gene. It is currently classed as an orphan receptor. This receptor is widely expressed in adult and fetal tissues." [PRO:WCB, UniProtKB:Q9HC97]
comment: Category=gene.
synonym: "GPR35" RELATED []
synonym: "Gpr35" RELATED []
synonym: "Probable G-protein coupled receptor 35" EXACT []
xref: PIRSF:PIRSF038622
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001532
name: probable G protein-coupled receptor 39
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the GPR39 gene. It is currently classed as an orphan receptor." [PRO:WCB]
comment: Category=gene.
synonym: "GPR39" RELATED []
synonym: "Gpr39" RELATED []
synonym: "Probable G-protein coupled receptor 39" EXACT []
xref: PIRSF:PIRSF038643
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001533
name: probable G protein-coupled receptor 45/63
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the GPR45 or GPR63 gene." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF038587
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001534
name: probable G protein-coupled receptor 55
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the GPR55 gene. It is currently classed as an orphan receptor." [PRO:WCB]
comment: Category=gene.
synonym: "Gm218" RELATED []
synonym: "Gpr55" RELATED []
synonym: "GPR55" RELATED []
synonym: "Probable G-protein coupled receptor 55" EXACT []
xref: PIRSF:PIRSF038621
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001535
name: probable G protein-coupled receptor 61
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the GPR61 gene. It is currently classed as an orphan receptor." [PRO:WCB]
comment: Category=gene.
synonym: "BALGR" RELATED []
synonym: "Biogenic amine receptor-like G-protein coupled receptor" EXACT []
synonym: "GPR61" RELATED []
synonym: "Gpr61" RELATED []
synonym: "Probable G-protein coupled receptor 61" EXACT []
xref: PIRSF:PIRSF038578
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001536
name: probable G protein-coupled receptor 62
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the GPR62 gene. It is currently classed as an orphan receptor." [PRO:WCB]
comment: Category=gene.
synonym: "Gpr62" RELATED []
synonym: "GPR62" RELATED []
synonym: "hGPCR8" EXACT []
synonym: "Probable G-protein coupled receptor 62" EXACT []
xref: PIRSF:PIRSF038650
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001537
name: probable G protein-coupled receptor 75
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the GPR75 gene. Although currently classified as an orphan receptor, it has been reported to be activated by the chemokine CCL5 (RANTES)." [PRO:WCB, PubMed:17001303]
comment: Category=gene.
synonym: "Gpr75" RELATED []
synonym: "GPR75" RELATED []
synonym: "Probable G-protein coupled receptor 75" EXACT []
xref: PIRSF:PIRSF038666
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001538
name: probable G protein-coupled receptor 82
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the GPR82 gene. It is currently classed as an orphan receptor." [PRO:WCB]
comment: Category=gene.
synonym: "Gpr82" RELATED []
synonym: "GPR82" RELATED []
synonym: "Probable G-protein coupled receptor 82" EXACT []
xref: PIRSF:PIRSF038654
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001539
name: probable G protein-coupled receptor 83
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the GPR83 gene. It is currrently classed as an orphan receptor. This receptor is specifically expressed in brain." [PRO:WCB, UniProtKB:Q9NYM4]
comment: Category=gene.
synonym: "G-protein coupled receptor 72" EXACT []
synonym: "GIR" RELATED []
synonym: "Gir" RELATED []
synonym: "Glucocorticoid-induced receptor" EXACT []
synonym: "GPR72" RELATED []
synonym: "Gpr72" RELATED []
synonym: "Gpr83" RELATED []
synonym: "GPR83" RELATED []
synonym: "KIAA1540" RELATED []
synonym: "Probable G-protein coupled receptor 83" EXACT []
synonym: "Probable G-protein coupled receptor 83 precursor" EXACT []
xref: PIRSF:PIRSF038612
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001540
name: probable G protein-coupled receptor 84
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the GPR84 gene. It is currently classed as an orphan receptor. This receptor is eEpressed in brain, heart, muscle, colon, thymus, spleen, kidney, liver, placenta, intestine, bone marrow, lung and peripheral blood leukocytes." [PRO:WCB, UniProtKB:Q9NQS5]
comment: Category=gene.
synonym: "EX33" RELATED []
synonym: "Gpr84" RELATED []
synonym: "GPR84" RELATED []
synonym: "Inflammation-related G-protein coupled receptor EX33" EXACT []
synonym: "Probable G-protein coupled receptor 84" EXACT []
xref: PIRSF:PIRSF038653
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001541
name: probable G protein-coupled receptor 88
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the GPR88 gene. It is currently classed as an orphan receptor. This receptor is expressed in the striatum almost exclusively." [PRO:WCB, PubMed:11056049]
comment: Category=gene.
synonym: "Gpr88" RELATED []
synonym: "GPR88" RELATED []
synonym: "Probable G-protein coupled receptor 88" EXACT []
synonym: "Strg" RELATED []
synonym: "STRG" RELATED []
synonym: "Striatum-specific G-protein coupled receptor" EXACT []
xref: PIRSF:PIRSF038591
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001542
name: probable P2Y purinoceptor 8
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the P2RY8 gene. It is currently classed as an orphan receptor." [PRO:WCB, UniProtKB:Q86VZ1]
comment: Category=gene.
synonym: "P2RY8" RELATED []
synonym: "P2Y purinoceptor 8" EXACT []
synonym: "P2Y8" EXACT []
xref: PIRSF:PIRSF038620
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001543
name: programmed cell death 1 ligand 1
def: "A B7-related protein that is a translation product of the CD274 gene." [PRO:WCB]
comment: Category=gene.
synonym: "B7 homolog 1" EXACT []
synonym: "B7-H1" EXACT []
synonym: "B7H1" RELATED []
synonym: "CD274" RELATED []
synonym: "CD274 antigen" EXACT []
synonym: "PD-L1" EXACT []
synonym: "PDCD1 ligand 1" EXACT []
synonym: "PDCD1L1" RELATED []
synonym: "PDCD1LG1" RELATED []
synonym: "PDL1" RELATED []
synonym: "Programmed death ligand 1" EXACT []
is_a: PRO:000001290 ! B7-related protein

[Term]
id: PRO:000001544
name: programmed cell death 1 ligand 2
def: "A B7-related protein that is a translation product of the PDCD1LG2 gene." [PRO:WCB]
comment: Category=gene.
synonym: "B7-DC" EXACT []
synonym: "B7DC" RELATED []
synonym: "Butyrophilin B7-DC" EXACT []
synonym: "CD273" RELATED []
synonym: "CD273 antigen" EXACT []
synonym: "PD-1-ligand 2" EXACT []
synonym: "PD-L2" EXACT []
synonym: "PDCD1 ligand 2" EXACT []
synonym: "PDCD1L2" RELATED []
synonym: "PDCD1LG2" RELATED []
synonym: "PDL2" RELATED []
synonym: "Programmed death ligand 2" EXACT []
is_a: PRO:000001290 ! B7-related protein

[Term]
id: PRO:000001545
name: prokineticin receptor
def: "A rhodopsin-like G protein-coupled receptor whose active form binds prokineticin 1 or 2." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF038582
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001546
name: prolactin-releasing peptide receptor
def: "A rhopdopsin-like G protein-coupled receptor that is a translation product of the PRLHR gene." [PRO:WCB]
comment: Category=gene.
synonym: "G-protein coupled receptor 10" EXACT []
synonym: "Gpr10" RELATED []
synonym: "GPR10" RELATED []
synonym: "GR3" RELATED []
synonym: "hGR3" EXACT []
synonym: "PRLHR" RELATED []
synonym: "Prlhr" RELATED []
synonym: "Prolactin-releasing peptide receptor" EXACT []
synonym: "PrRP receptor" EXACT []
synonym: "PrRPR" EXACT []
xref: PIRSF:PIRSF038611
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001547
name: prostaglandin D2 receptor DP2
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the GPR44 gene. The preferred ligand is 11-dehydro-thromboxane B2. This receptor is not closely related to the prostaglandin D2 receptor encoded by PGD2." [PRO:WCB]
comment: Category=gene.
synonym: "CD294" EXACT []
synonym: "Chemoattractant receptor-homologous molecule expressed on Th2 cells" EXACT []
synonym: "crth2" RELATED []
synonym: "CRTH2" RELATED []
synonym: "Crth2" RELATED []
synonym: "DL1R" RELATED []
synonym: "GPR44" RELATED []
synonym: "Gpr44" RELATED []
synonym: "Putative G-protein coupled receptor 44" EXACT []
xref: PIRSF:PIRSF038608
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001548
name: prostaglandin E2 receptor EP4
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the PTGER4 gene. The preferred ligand is prostaglandin E2. This receptor is not closely related to other prostaglandin E2 receptors." [PRO:WCB]
comment: Category=gene.
synonym: "PGE receptor, EP4 subtype" EXACT []
synonym: "Prostaglandin E2 receptor EP4 subtype" EXACT []
synonym: "Prostanoid EP4 receptor" EXACT []
synonym: "PTGER2" RELATED []
synonym: "Ptger4" RELATED []
synonym: "PTGER4" RELATED []
synonym: "Ptgerep4" RELATED []
xref: PIRSF:PIRSF038586
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001549
name: prostanoid receptor
def: "A rhodopsin-like G protein-coupled receptor whose active form binds prostanoids (prostaglandins and thromboxanes)." [PRO:WCB, PubMed:7938166]
comment: Category=family.
xref: PIRSF:PIRSF001962
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001550
name: proteinase-activated receptor
def: "A rhodopsin-like G protein-coupled receptor whose active form binds trypsin-related proteinases. The proteinase cleaves the mature peptide, exposing a new amino end. The new N-terminal residues act as a tethered ligand that induces activity." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF037996
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001551
name: relaxin receptor
def: "A rhodopsin-like G protein-coupled receptor whose active form binds relaxins." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF038662
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001552
name: relaxin-3 receptor 1
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the RXFP3 gene. The preferred ligands are relaxin-3, bradykinin, and kallidin." [PRO:WCB, UniProtKB:Q8TDU9]
comment: Category=gene.
synonym: "G protein-coupled receptor SALPR" EXACT []
synonym: "G protein-coupled receptor SALPR homolog" EXACT []
synonym: "GPCR135" EXACT []
synonym: "Relaxin family peptide receptor 3" EXACT []
synonym: "Relaxin-3 receptor 1" EXACT []
synonym: "RLN3 receptor 1" EXACT []
synonym: "Rln3r1" RELATED []
synonym: "RLN3R1" RELATED []
synonym: "RXFP3" RELATED []
synonym: "Rxfp3" RELATED []
synonym: "SALPR" RELATED []
synonym: "Salpr" RELATED []
synonym: "Somatostatin- and angiotensin-like peptide receptor" EXACT []
xref: PIRSF:PIRSF038607
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001553
name: relaxin-3 receptor 2
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the RXFP4 gene. The preferred ligands are relaxin-3, bradykinin, and kallidin." [PRO:WCB, UniProtKB:Q8TDU9]
comment: Category=gene.
synonym: "G-protein coupled receptor 100" EXACT []
synonym: "GPCR142" EXACT []
synonym: "Gpr100" RELATED []
synonym: "GPR100" RELATED []
synonym: "Relaxin family peptide receptor 4" EXACT []
synonym: "Relaxin-3 receptor 2" EXACT []
synonym: "RLN3R2" RELATED []
synonym: "Rln3r2" RELATED []
synonym: "RXFP4" RELATED []
synonym: "Rxfp4" RELATED []
xref: PIRSF:PIRSF038606
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001554
name: rhesus blood group-associated glycoprotein
def: "An erythrocyte membrane protein Rh that is a translation product of the RHAG gene." [PRO:CNA]
comment: Category=gene.
synonym: "CD241" EXACT []
synonym: "Erythrocyte membrane glycoprotein Rh50" EXACT []
synonym: "Erythrocyte plasma membrane 50 kDa glycoprotein " EXACT []
synonym: "RH50" EXACT []
synonym: "Rhesus blood group-associated ammonia channel" RELATED []
is_a: PRO:000001348 ! erythrocyte membrane protein Rh

[Term]
id: PRO:000001555
name: somatostatin receptor
def: "A rhodopsin-like G protein-coupled receptor whose active form binds somatostatin." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF038568
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001556
name: succinate receptor 1
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the SUCNR1 gene. It is reported to bind succinate. It is currently classed as an orphan receptor." [PRO:WCB]
comment: Category=gene.
synonym: "G-protein coupled receptor 91" EXACT []
synonym: "Gpr91" RELATED []
synonym: "GPR91" RELATED []
synonym: "P2Y purinoceptor 1-like" EXACT []
synonym: "Succinate receptor 1" EXACT []
synonym: "SUCNR1" RELATED []
synonym: "Sucnr1" RELATED []
xref: PIRSF:PIRSF038615
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001557
name: thyrotropin-releasing hormone receptor
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the TRHR gene. The preferred ligand is thyrotropin-releasing hormone." [PRO:WCB]
comment: Category=gene.
synonym: "Thyroliberin receptor" EXACT []
synonym: "Thyrotropin-releasing hormone receptor" EXACT []
synonym: "TRH-R" EXACT []
synonym: "TRHR" RELATED []
synonym: "Trhr" RELATED []
xref: PIRSF:PIRSF038645
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001558
name: trace amine associated receptor
def: "A rhodopsin-like G protein-coupled receptor related to the trace amine associated receptor 1 (TAAR1) and characterized by the sequence motif NSxxNPxx[YH]xxx[YF]xWF overlapping TM7. Trace amines are biogenic amines present in very low levels in mammalian tissues. Their physiological roles in mammals are poorly understood. Some of them are neurotransmitters in invertebrates. Ligands are currently known for only two TAARs, TAAR1 in human, rat, and mouse, and TAAR4 in rat. All other TAARs are orphan receptors at the present time." [PRO:WCB, PubMed:11459929, PubMed:15718104, PubMed:16584120, PubMed:17088868]
comment: Category=family.
synonym: "TAAR" EXACT []
synonym: "trace amine-associated receptor" EXACT []
synonym: "trace-amine-associated receptor" RELATED []
xref: PIRSF:PIRSF038555
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001559
name: tumor-associated calcium signal transducer 1
def: "A tumor-associated calcium signal transducer that is a translation product of the TACSTD1 gene." [PRO:CNA]
comment: Category=gene.
synonym: "Adenocarcinoma-associated antigen " RELATED []
synonym: "CD326" EXACT []
synonym: "Cell surface glycoprotein Trop-1" EXACT []
synonym: "Epithelial cell surface antigen" RELATED []
synonym: "KS 1/4 antigen" EXACT []
synonym: "KSA" EXACT []
synonym: "Major gastrointestinal tumor-associated protein GA733-2 " EXACT []
is_a: PRO:000001407 ! tumor-associated calcium signal transducer

[Term]
id: PRO:000001560
name: uracil nucleotide/cysteinyl leukotriene receptor
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the GPR17 gene. The preferred ligands are uracil nucleotides and cysteinyl leukotrienes. It is highly expressed in brain, heart and kidney." [PRO:WCB, PubMed:16990797]
comment: Category=gene.
synonym: "G-protein coupled receptor 17" EXACT []
synonym: "Gpr17" EXACT []
synonym: "GPR17" EXACT []
synonym: "P2Y-like receptor" EXACT []
synonym: "R12" RELATED []
synonym: "UDP/CysLT receptor" EXACT []
synonym: "Uracil nucleotide/cysteinyl leukotriene receptor" EXACT []
xref: PANTHER:PTHR19264\:SF133
xref: PIRSF:PIRSF038619
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001561
name: urotensin II receptor
def: "A rhodopsin-like G protein-coupled receptor that is a translation product of the UTS2R gene. The preferred ligand is urotensin II." [PRO:WCB]
comment: Category=gene.
synonym: "G-protein coupled receptor 14" EXACT []
synonym: "Gpr14" EXACT []
synonym: "GPR14" EXACT []
synonym: "UR-II-R" EXACT []
synonym: "Urotensin II receptor" EXACT []
synonym: "Uts2r" RELATED []
synonym: "UTS2R" RELATED []
xref: PANTHER:PTHR19264\:SF258
xref: PIRSF:PIRSF038575
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001562
name: vasopressin/oxytocin receptor
def: "A rhodopsin-like G protein-coupled receptor that binds vasopressin or oxytocin or related nonapeptides." [PRO:WCB, Wikipedia:vasopressin, Wikipedia:vasopressin_receptor]
comment: Category=family.
xref: PIRSF:PIRSF001841
is_a: PRO:000001094 ! rhodopsin-like G protein-coupled receptor

[Term]
id: PRO:000001563
name: G protein-coupled receptor MAS
def: "A mas-related G protein-coupled receptor that is a translation product of the MAS1 gene. It is currently classed as an orphan receptor." [PRO:WCB]
comment: Category=gene.
synonym: "Mas" RELATED []
synonym: "MAS" RELATED []
synonym: "MAS proto-oncogene" EXACT []
synonym: "Mas-1" RELATED []
synonym: "MAS1" RELATED []
synonym: "Mas1" RELATED []
is_a: PRO:000001487 ! mas-related G protein-coupled receptor

[Term]
id: PRO:000001564
name: H3 histamine receptor
def: "An H3/H4 histamine receptor that is a translation product of the HRH3 gene. The preferred ligand is histamine. This receptor mediates inhibition of gastric acid release, inhibition of neurotransmitter release, and other diverse effects." [PRO:WCB, PubMed:9311023]
comment: Category=gene.
synonym: "G-protein coupled receptor 97" EXACT []
synonym: "GPCR97" RELATED []
synonym: "Histamine H3 receptor" EXACT []
synonym: "HRH3" RELATED []
synonym: "Hrh3" RELATED []
is_a: PRO:000001424 ! H3/H4 histamine receptor

[Term]
id: PRO:000001565
name: H4 histamine receptor
def: "An H3/H4 histamine receptor that is a translation product of the HRH4 gene. The preferred ligand is histamine. This receptor is expressed primarily in the bone marrow and eosinophils but also in a wide variety of peripheral tissues, including the heart, kidney, liver, lung, pancreas, skeletal muscle, prostate, small intestine, spleen, testis, colon, fetal liver and lymph node." [PRO:WCB, UniProtKB:Q9H3N8]
comment: Category=gene.
synonym: "AXOR35" EXACT []
synonym: "G-protein coupled receptor 105" EXACT []
synonym: "GPCR105" RELATED []
synonym: "GPRv53" EXACT []
synonym: "HH4R" EXACT []
synonym: "Histamine H4 receptor" EXACT []
synonym: "Hrh4" RELATED []
synonym: "HRH4" RELATED []
synonym: "Pfi-013" EXACT []
synonym: "SP9144" EXACT []
is_a: PRO:000001424 ! H3/H4 histamine receptor

[Term]
id: PRO:000001566
name: N-formyl peptide receptor 2
def: "An N-formyl peptide receptor that is a translation product of the FPR2 gene." [PRO:WCB]
comment: Category=gene.
synonym: "FMLP-R-I" EXACT []
synonym: "FMLP-related receptor I" EXACT []
synonym: "Formyl peptide receptor-like 1" EXACT []
synonym: "FPR2" RELATED []
synonym: "Fpr2" RELATED []
synonym: "FPRH1" RELATED []
synonym: "Fprl1" RELATED []
synonym: "FPRL1" RELATED []
synonym: "HM63" EXACT []
synonym: "Lipoxin A4 receptor" EXACT []
synonym: "LXA4 receptor" EXACT []
synonym: "Lxa4r" RELATED []
synonym: "LXA4R" RELATED []
synonym: "N-formyl peptide receptor 2" EXACT []
synonym: "RFP" EXACT []
is_a: PRO:000001431 ! N-formyl peptide receptor

[Term]
id: PRO:000001567
name: N-formyl peptide receptor 3
def: "An N-formyl peptide receptor that is a translation product of the FPR3 gene." [PRO:WCB]
comment: Category=gene.
synonym: "FMLP-R-II" EXACT []
synonym: "FMLP-related receptor II" EXACT []
synonym: "Formyl peptide receptor-like 2" EXACT []
synonym: "FPR3" RELATED []
synonym: "FPRH1" RELATED []
synonym: "FPRL2" RELATED []
synonym: "N-formyl peptide receptor 3" EXACT []
is_a: PRO:000001431 ! N-formyl peptide receptor

[Term]
id: PRO:000001568
name: P2Y purinoceptor 1
def: "A P2Y purinoceptor 1/2/3/4/6 that is a translation product of the P2RY1 gene. The preferred ligand is ADP." [PRO:WCB]
comment: Category=gene.
synonym: "ATP receptor" EXACT []
synonym: "P2RY1" RELATED []
synonym: "P2ry1" RELATED []
synonym: "P2Y purinoceptor 1" EXACT []
synonym: "P2Y1" EXACT []
synonym: "Purinergic receptor" EXACT []
is_a: PRO:000001435 ! P2Y purinoceptor 1/2/3/4/6

[Term]
id: PRO:000001569
name: P2Y purinoceptor 12
def: "A P2RY12-like receptor that is a translation product of the P2RY12 gene. The preferred ligand is ADP." [PRO:WCB]
comment: Category=gene.
synonym: "ADP-glucose receptor" EXACT []
synonym: "ADPG-R" EXACT []
synonym: "HORK3" RELATED []
synonym: "P2RY12" RELATED []
synonym: "P2ry12" RELATED []
synonym: "P2T(AC" EXACT []
synonym: "P2Y purinoceptor 12" EXACT []
synonym: "P2Y(AC" EXACT []
synonym: "P2Y(ADP" EXACT []
synonym: "P2Y(cyc" EXACT []
synonym: "P2Y12" EXACT []
synonym: "P2Y12 platelet ADP receptor" EXACT []
synonym: "SP1999" EXACT []
is_a: PRO:000001434 ! P2RY12-like receptor

[Term]
id: PRO:000001570
name: P2Y purinoceptor 13
def: "A P2RY12-like receptor that is a translation product of the P2RY13 gene. The preferred ligand is ADP." [PRO:WCB, PubMed:11546776]
comment: Category=gene.
synonym: "FKSG77" RELATED []
synonym: "G-protein coupled receptor 86" EXACT []
synonym: "G-protein coupled receptor 94" EXACT []
synonym: "GPR86" RELATED []
synonym: "Gpr86" RELATED []
synonym: "GPR94" RELATED []
synonym: "P2RY13" RELATED []
synonym: "P2ry13" RELATED []
synonym: "P2Y purinoceptor 13" EXACT []
synonym: "P2yr13" RELATED []
is_a: PRO:000001434 ! P2RY12-like receptor

[Term]
id: PRO:000001571
name: P2Y purinoceptor 14
def: "A P2RY12-like receptor that is a translation product of the P2RY14 gene. The preferred ligand is UDP-glucose." [PRO:WCB]
comment: Category=gene.
synonym: "G-protein coupled receptor 105" EXACT []
synonym: "GPR105" RELATED []
synonym: "Gpr105" RELATED []
synonym: "KIAA0001" RELATED []
synonym: "P2ry14" RELATED []
synonym: "P2RY14" RELATED []
synonym: "P2Y purinoceptor 14" EXACT []
synonym: "UDP-glucose receptor" EXACT []
is_a: PRO:000001434 ! P2RY12-like receptor

[Term]
id: PRO:000001572
name: P2Y purinoceptor 2
def: "A P2Y purinoceptor 1/2/3/4/6 that is a translation product of the P2RY2 gene. The preferred ligands are ATP and UTP." [PRO:WCB]
comment: Category=gene.
synonym: "ATP receptor" EXACT []
synonym: "P2ru1" RELATED []
synonym: "P2RU1" RELATED []
synonym: "P2ry2" RELATED []
synonym: "P2RY2" RELATED []
synonym: "P2U purinoceptor 1" EXACT []
synonym: "P2U1" EXACT []
synonym: "P2Y purinoceptor 2" EXACT []
synonym: "P2Y2" EXACT []
synonym: "Purinergic receptor" EXACT []
is_a: PRO:000001435 ! P2Y purinoceptor 1/2/3/4/6

[Term]
id: PRO:000001573
name: P2Y purinoceptor 4
def: "A P2Y purinoceptor 1/2/3/4/6 that is a translation product of the P2RY4 gene. The preferred ligand is UTP." [PRO:WCB]
comment: Category=gene.
synonym: "NRU" RELATED []
synonym: "P2P" EXACT []
synonym: "P2RY4" RELATED []
synonym: "P2ry4" RELATED []
synonym: "P2Y purinoceptor 4" EXACT []
synonym: "P2Y4" EXACT []
synonym: "P2y4r" RELATED []
synonym: "UNR" EXACT []
synonym: "Uridine nucleotide receptor" EXACT []
is_a: PRO:000001435 ! P2Y purinoceptor 1/2/3/4/6

[Term]
id: PRO:000001574
name: P2Y purinoceptor 6
def: "A P2Y purinoceptor 1/2/3/4/6 that is a translation product of the P2RY6 gene. The preferred ligand is UDP." [PRO:WCB]
comment: Category=gene.
synonym: "P2ry6" RELATED []
synonym: "P2RY6" RELATED []
synonym: "P2Y purinoceptor 6" EXACT []
synonym: "P2Y6" EXACT []
synonym: "PP2891" RELATED []
is_a: PRO:000001435 ! P2Y purinoceptor 1/2/3/4/6

[Term]
id: PRO:000001575
name: adenosine receptor A1
def: "An adenosine receptor that is a translation product of the ADORA1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Adenosine receptor A1" EXACT []
synonym: "Adora1" RELATED []
synonym: "ADORA1" RELATED []
synonym: "Adora1 protein" EXACT []
is_a: PRO:000001439 ! adenosine receptor

[Term]
id: PRO:000001576
name: adenosine receptor A2a
def: "An adenosine receptor that is a translation product of the ADORA2A gene." [PRO:WCB]
comment: Category=gene.
synonym: "Adenosine receptor A2a" EXACT []
synonym: "ADORA2" RELATED []
synonym: "Adora2a" RELATED []
synonym: "ADORA2A" RELATED []
is_a: PRO:000001439 ! adenosine receptor

[Term]
id: PRO:000001577
name: adenosine receptor A2b
def: "An adenosine receptor that is a translation product of the ADORA2B gene." [PRO:WCB]
comment: Category=gene.
synonym: "Adenosine receptor A2b" EXACT []
synonym: "ADORA2B" RELATED []
synonym: "Adora2b" RELATED []
is_a: PRO:000001439 ! adenosine receptor

[Term]
id: PRO:000001578
name: adenosine receptor A3
def: "An adenosine receptor that is a translation product of the ADORA3 gene." [PRO:WCB]
comment: Category=gene.
synonym: "A3AR" EXACT []
synonym: "Adenosine A3 receptor" EXACT []
synonym: "Adora3" RELATED []
synonym: "ADORA3" RELATED []
synonym: "Gpcr2" RELATED []
is_a: PRO:000001439 ! adenosine receptor

[Term]
id: PRO:000001579
name: delta-opioid receptor
def: "An opioid receptor that is a translation product of the OPRD1 gene. The preferred ligands are enkephalins." [PRO:WCB, Wikipedia:delta_Opioid_receptor]
comment: Category=gene.
synonym: "Delta-type opioid receptor" EXACT []
synonym: "DOR-1" EXACT []
synonym: "K56" EXACT []
synonym: "MSL-2" EXACT []
synonym: "OPRD" RELATED []
synonym: "Oprd1" RELATED []
synonym: "OPRD1" RELATED []
is_a: PRO:000001497 ! opioid receptor

[Term]
id: PRO:000001580
name: fMet-Leu-Phe receptor
def: "An N-formyl peptide receptor that is a translation product of the FPR1 gene. The preferred ligand is the peptide fMet-Leu-Phe, a bacterial peptide that acts as a chemoattractant in various pathophysiological conditions." [InterPro:IPR000826, PRO:WCB]
comment: Category=gene.
synonym: "fMet-Leu-Phe receptor" EXACT []
synonym: "fMLP receptor" EXACT []
synonym: "FPR" EXACT []
synonym: "Fpr1" RELATED []
synonym: "FPR1" RELATED []
synonym: "N-formyl peptide receptor" EXACT []
synonym: "N-formylpeptide chemoattractant receptor" EXACT []
is_a: PRO:000001431 ! N-formyl peptide receptor

[Term]
id: PRO:000001581
name: follitropin receptor
def: "A glycoprotein hormone receptor that is a translation product of the FSHR gene. The preferred ligand is follitropin (follicle-stimulating hormone)." [PRO:WCB]
comment: Category=gene.
synonym: "Follicle-stimulating hormone receptor" EXACT []
synonym: "Follicle-stimulating hormone receptor precursor" EXACT []
synonym: "Follitropin receptor" EXACT []
synonym: "FSH-R" EXACT []
synonym: "Fshr" RELATED []
synonym: "FSHR" RELATED []
synonym: "LGR1" RELATED []
is_a: PRO:000001463 ! glycoprotein hormone receptor

[Term]
id: PRO:000001582
name: free fatty acid receptor 1
def: "A free fatty acid receptor that is a translation product of the FFAR1 gene. Its preferred ligands are medium and long-chain fatty acids. It potentiates fatty acid-stimulated insulin secretion in pancreatic islets." [PRO:WCB, PubMed:17052194]
comment: Category=gene.
synonym: "Ffar1" RELATED []
synonym: "FFAR1" RELATED []
synonym: "Free fatty acid receptor 1" EXACT []
synonym: "G-protein coupled receptor 40" EXACT []
synonym: "Gpr40" RELATED []
synonym: "GPR40" RELATED []
is_a: PRO:000001452 ! free fatty acid receptor

[Term]
id: PRO:000001583
name: free fatty acid receptor 2
def: "A free fatty acid receptor that is a translation product of the FFAR2 gene. It mediates stimulation of adipogenesis by short-chain fatty acids." [PRO:WCB, PubMed:17052194]
comment: Category=gene.
synonym: "FFAR2" RELATED []
synonym: "Ffar2" RELATED []
synonym: "Free fatty acid receptor 2" EXACT []
synonym: "G-protein coupled receptor 43" EXACT []
synonym: "Gpr43" RELATED []
synonym: "GPR43" RELATED []
synonym: "Leukocyte-specific STAT-induced GPCR" EXACT []
synonym: "Lssig" RELATED []
is_a: PRO:000001452 ! free fatty acid receptor

[Term]
id: PRO:000001584
name: free fatty acid receptor 3
def: "A free fatty acid receptor that is a translation product of the FFAR3 gene. It mediates stimulation of leptin release by short-chain fatty acids." [PRO:WCB, PubMed:17052194]
comment: Category=gene.
synonym: "Ffar3" RELATED []
synonym: "FFAR3" RELATED []
synonym: "Free fatty acid receptor 3" EXACT []
synonym: "G-protein coupled receptor 41" EXACT []
synonym: "Gm478" RELATED []
synonym: "GPR41" RELATED []
synonym: "Gpr41" RELATED []
is_a: PRO:000001452 ! free fatty acid receptor

[Term]
id: PRO:000001585
name: galanin receptor 1
def: "A galanin receptor that is a translation product of the GALR1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "GAL1-R" EXACT []
synonym: "Galanin receptor type 1" EXACT []
synonym: "GALNR" RELATED []
synonym: "Galnr" RELATED []
synonym: "Galnr1" RELATED []
synonym: "GALNR1" RELATED []
synonym: "GALR1" RELATED []
synonym: "Galr1" RELATED []
is_a: PRO:000001457 ! galanin receptor

[Term]
id: PRO:000001586
name: galanin receptor 2
def: "A galanin receptor that is a translation product of the GALR2 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Exoc7" RELATED []
synonym: "GAL2-R" EXACT []
synonym: "Galanin receptor type 2" EXACT []
synonym: "Galnr2" RELATED []
synonym: "GALNR2" RELATED []
synonym: "Galr2" RELATED []
synonym: "GALR2" RELATED []
is_a: PRO:000001457 ! galanin receptor

[Term]
id: PRO:000001587
name: galanin receptor 3
def: "A galanin receptor that is a translation product of the GALR3 gene." [PRO:WCB]
comment: Category=gene.
synonym: "GAL3-R" EXACT []
synonym: "Galanin receptor type 3" EXACT []
synonym: "GALNR3" RELATED []
synonym: "Galnr3" RELATED []
synonym: "Galr3" RELATED []
synonym: "GALR3" RELATED []
is_a: PRO:000001457 ! galanin receptor

[Term]
id: PRO:000001588
name: gonadotropin-releasing hormone I receptor
def: "A gonadotropin-releasing hormone receptor that is a translation product of the GNRHR gene. The preferred ligand is gonadotropin-releasing hormone I." [PRO:WCB, PubMed:11935410]
comment: Category=gene.
synonym: "GnRH receptor" EXACT []
synonym: "GnRH-R" EXACT []
synonym: "Gnrhr" RELATED []
synonym: "GNRHR" RELATED []
synonym: "Gonadotropin-releasing hormone receptor" EXACT []
synonym: "GRHR" RELATED []
is_a: PRO:000001464 ! gonadotropin-releasing hormone receptor

[Term]
id: PRO:000001589
name: gonadotropin-releasing hormone II receptor
def: "A gonadotropin-releasing hormone receptor that is a translation product of the GNRHR2 gene. The preferred ligand is gonadotropin-releasing hormone II." [PRO:WCB, PubMed:11935410]
comment: Category=gene.
synonym: "GnRH-II-R" EXACT []
synonym: "GNRHR2" RELATED []
synonym: "Putative gonadotropin-releasing hormone II receptor" EXACT []
synonym: "Type II GnRH receptor" EXACT []
is_a: PRO:000001464 ! gonadotropin-releasing hormone receptor

[Term]
id: PRO:000001590
name: kappa-opioid receptor
def: "An opioid receptor that is a translation product of the OPRK1 gene. The preferred ligand is dynorphin." [PRO:WCB, Wikipedia:kappa_Opioid_receptor]
comment: Category=gene.
synonym: "Kappa-type opioid receptor" EXACT []
synonym: "KOR-1" EXACT []
synonym: "MSL-1" EXACT []
synonym: "OPRK" RELATED []
synonym: "Oprk1" RELATED []
synonym: "oprk1" RELATED []
synonym: "OPRK1" RELATED []
is_a: PRO:000001497 ! opioid receptor

[Term]
id: PRO:000001591
name: leucine-rich repeat-containing G protein-coupled receptor 4
def: "A leucine-rich repeat-containing G protein-coupled receptor 4/5/6 that is a translation product of the LGR4 gene. It is currently classed as an orphan receptor." [PRO:WCB]
comment: Category=gene.
synonym: "G-protein coupled receptor 48" EXACT []
synonym: "Gpr48" RELATED []
synonym: "GPR48" RELATED []
synonym: "Leucine-rich repeat-containing G-protein coupled receptor 4 precursor" EXACT []
synonym: "LGR4" RELATED []
synonym: "Lgr4" RELATED []
is_a: PRO:000001477 ! leucine-rich repeat-containing G protein-coupled receptor 4/5/6

[Term]
id: PRO:000001592
name: leucine-rich repeat-containing G protein-coupled receptor 5
def: "A leucine-rich repeat-containing G protein-coupled receptor 4/5/6 that is a translation product of the LGR5 gene. It is currently classed as an orphan receptor." [PRO:WCB]
comment: Category=gene.
synonym: "Fex" RELATED []
synonym: "G-protein coupled receptor 49" EXACT []
synonym: "G-protein coupled receptor 67" EXACT []
synonym: "Gpr49" RELATED []
synonym: "GPR49" RELATED []
synonym: "GPR67" RELATED []
synonym: "Leucine-rich repeat-containing G-protein coupled receptor 5" EXACT []
synonym: "Leucine-rich repeat-containing G-protein coupled receptor 5 precursor" EXACT []
synonym: "LGR5" RELATED []
synonym: "Lgr5" RELATED []
synonym: "Orphan G-protein coupled receptor FEX" EXACT []
synonym: "Orphan G-protein coupled receptor HG38" EXACT []
is_a: PRO:000001477 ! leucine-rich repeat-containing G protein-coupled receptor 4/5/6

[Term]
id: PRO:000001593
name: leucine-rich repeat-containing G protein-coupled receptor 6
def: "A leucine-rich repeat-containing G protein-coupled receptor 4/5/6 that is a translation product of the LGR6 gene. It is currently classed as an orphan receptor." [PRO:WCB]
comment: Category=gene.
synonym: "Leucine-rich repeat-containing G-protein coupled receptor 6 precursor" EXACT []
synonym: "LGR6" RELATED []
synonym: "Lgr6" RELATED []
is_a: PRO:000001477 ! leucine-rich repeat-containing G protein-coupled receptor 4/5/6

[Term]
id: PRO:000001594
name: leukotriene B4 receptor 1
def: "A leukotriene B4 receptor that is a translation product of the LTB4R gene." [PRO:WCB]
comment: Category=gene.
synonym: "BLT" RELATED []
synonym: "BLT1" RELATED []
synonym: "Bltr" RELATED []
synonym: "BLTR" RELATED []
synonym: "Chemoattractant receptor-like 1" EXACT []
synonym: "CMKRL1" RELATED []
synonym: "G-protein coupled receptor 16" EXACT []
synonym: "GPR16" RELATED []
synonym: "Leukotriene B4 receptor 1" EXACT []
synonym: "LTB4-R 1" EXACT []
synonym: "Ltb4r" RELATED []
synonym: "LTB4R" RELATED []
synonym: "Ltb4r1" RELATED []
synonym: "P2RY7" RELATED []
synonym: "P2Y purinoceptor 7" EXACT []
synonym: "P2Y7" EXACT []
is_a: PRO:000001478 ! leukotriene B4 receptor

[Term]
id: PRO:000001595
name: leukotriene B4 receptor 2
def: "A leukotriene B4 receptor that is a translation product of the LTB4R2 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Blt2" RELATED []
synonym: "BLT2R" RELATED []
synonym: "BLTR2" RELATED []
synonym: "Leukotriene B4 receptor 2" EXACT []
synonym: "Leukotriene B4 receptor BLT2" EXACT []
synonym: "LTB4 receptor JULF2" EXACT []
synonym: "LTB4-R2" EXACT []
synonym: "Ltb4r2" RELATED []
synonym: "LTB4R2" RELATED []
synonym: "Seven transmembrane receptor BLTR2" EXACT []
is_a: PRO:000001478 ! leukotriene B4 receptor

[Term]
id: PRO:000001596
name: lutropin/choriogonadotropin receptor
def: "A glycoprotein hormone receptor that is a translation product of the LHCGR gene. The preferred ligands are lutropin (luteinizing hormone) and choriogonadotropin (choriogonadotropic hormone)." [PRO:WCB]
comment: Category=gene.
synonym: "LCGR" RELATED []
synonym: "LGR2" RELATED []
synonym: "LH/CG-R" EXACT []
synonym: "Lhcgr" RELATED []
synonym: "LHCGR" RELATED []
synonym: "Lhr" RELATED []
synonym: "LHR" EXACT []
synonym: "LHRHR" RELATED []
synonym: "Luteinizing hormone receptor" EXACT []
synonym: "Lutropin-choriogonadotropic hormone receptor" EXACT []
synonym: "Lutropin-choriogonadotropic hormone receptor precursor" EXACT []
is_a: PRO:000001463 ! glycoprotein hormone receptor

[Term]
id: PRO:000001597
name: lysophosphatidic acid receptor 1/2/3
def: "An LPAR1/S1PR1-like lysophospholipid receptor that is a translation product of the LPAR1, LPAR2, or LPAR3 gene and whose active form binds lysophosphatidic acid." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF501020
is_a: PRO:000001427 ! LPAR1/S1PR1-like lysophospholipid receptor

[Term]
id: PRO:000001598
name: lysophosphatidic acid receptor 4
def: "An LPAR4-like receptor that is a translation product of the LPAR4 gene. The preferred ligand is reported to be lysophosphatidic acid. It is currently classed as an orphan receptor." [PRO:WCB, PubMed:12724320]
comment: Category=gene.
synonym: "G-protein coupled receptor 23" EXACT []
synonym: "Gpr23" RELATED []
synonym: "GPR23" RELATED []
synonym: "LPA receptor 4" EXACT []
synonym: "LPA-4" EXACT []
synonym: "LPA4" RELATED []
synonym: "Lpa4" RELATED []
synonym: "Lpar4" RELATED []
synonym: "LPAR4" RELATED []
synonym: "Lysophosphatidic acid receptor 4" EXACT []
synonym: "P2RY9" RELATED []
synonym: "P2Y purinoceptor 9" EXACT []
synonym: "P2Y5-like receptor" EXACT []
synonym: "P2y9" RELATED []
synonym: "P2Y9" EXACT []
synonym: "Purinergic receptor 9" EXACT []
is_a: PRO:000001428 ! LPAR4-like receptor

[Term]
id: PRO:000001599
name: mas-related G protein-coupled receptor A
def: "A mas-related G protein-coupled receptor that is a translation product of the MRGPRA or closely related gene. This gene is present as a single copy in rat and has undergone a lineage-specific expansion in mouse. Orthology with human genes is not clear; possibly human MRGPRX1-MRGPRX4 genes represent an orthologous independent lineage-specific expansion." [PRO:WCB, PubMed:11551509]
comment: Category=family.
is_a: PRO:000001487 ! mas-related G protein-coupled receptor

[Term]
id: PRO:000001600
name: mas-related G protein-coupled receptor B
def: "A mas-related G protein-coupled receptor that is a translation product of the MRGPRB1 or closely related gene. These genes belong to a small subfamily, found in the rodent lineage, that also includes several pseudogenes." [PRO:WCB, PubMed:11551509]
comment: Category=family.
is_a: PRO:000001487 ! mas-related G protein-coupled receptor

[Term]
id: PRO:000001601
name: mas-related G protein-coupled receptor C11
def: "A mas-related G protein-coupled receptor that is a translation product of a gene corresponding to the rodent MRGPRX1 gene, formerly called MRGPRC11 in mouse and SNSR1 in rat, or a closely related gene. Although commonly designated as orthologous to human MRGPRX1, these genes are not as closely related as one would expect of true orthologs. RF-amide-related peptides are reported to be the preferred ligands." [PRO:WCB, PubMed:12397184]
comment: Category=gene.
synonym: "Mas-related G-protein coupled receptor member C11" EXACT []
synonym: "Mas-related G-protein coupled receptor member X1" EXACT []
synonym: "Mrgc11" RELATED []
synonym: "Mrgprc11" RELATED []
synonym: "Mrgprx1" RELATED []
synonym: "Sensory neuron-specific G-protein coupled receptor 1" EXACT []
is_a: PRO:000001487 ! mas-related G protein-coupled receptor

[Term]
id: PRO:000001602
name: mas-related G protein-coupled receptor D
def: "A mas-related G protein-coupled receptor that is a translation product of the MRGPRD gene. It is currently classed as an orphan receptor. It is reported to bind beta-alanine." [PRO:WCB, PubMed:15037633]
comment: Category=gene.
synonym: "Beta-alanine receptor" EXACT []
synonym: "G-protein coupled receptor TGR7" EXACT []
synonym: "Gm499" RELATED []
synonym: "Mas-related G-protein coupled receptor member D" EXACT []
synonym: "MRGD" RELATED []
synonym: "Mrgd" RELATED []
synonym: "MRGPRD" RELATED []
synonym: "Mrgprd" RELATED []
is_a: PRO:000001487 ! mas-related G protein-coupled receptor

[Term]
id: PRO:000001603
name: mas-related G protein-coupled receptor E
def: "A mas-related G protein-coupled receptor that is a translation product of the MRGPRE gene. It is currently classed as an orphan receptor." [PRO:WCB]
comment: Category=gene.
synonym: "Ebrt3" RELATED []
synonym: "Evolutionary breakpoint transcript 3 protein" EXACT []
synonym: "G-protein coupled receptor 167" EXACT []
synonym: "GPR167" RELATED []
synonym: "Mas-related G-protein coupled receptor member E" EXACT []
synonym: "Mrge" RELATED []
synonym: "MRGE" RELATED []
synonym: "MRGPRE" RELATED []
synonym: "Mrgpre" RELATED []
is_a: PRO:000001487 ! mas-related G protein-coupled receptor

[Term]
id: PRO:000001604
name: mas-related G protein-coupled receptor F
def: "A mas-related G protein-coupled receptor that is a translation product of the MRGPRF gene. It is currrently classed as an orphan receptor." [PRO:WCB]
comment: Category=gene.
synonym: "G-protein coupled receptor 140" EXACT []
synonym: "G-protein coupled receptor 168" EXACT []
synonym: "GPR140" RELATED []
synonym: "GPR168" RELATED []
synonym: "Mas-related G-protein coupled receptor member F" EXACT []
synonym: "Mas-related gene F protein" EXACT []
synonym: "MRGF" RELATED []
synonym: "Mrgf" RELATED []
synonym: "MRGPRF" RELATED []
synonym: "Mrgprf" RELATED []
synonym: "PSEC0142" RELATED []
is_a: PRO:000001487 ! mas-related G protein-coupled receptor

[Term]
id: PRO:000001605
name: mas-related G protein-coupled receptor G
def: "A mas-related G protein-coupled receptor that is a translation product of the MRGPRG gene. It is currently classed as an orphan receptor." [PRO:WCB]
comment: Category=gene.
synonym: "Ebrt2" RELATED []
synonym: "Evolutionary breakpoint transcript 2 protein" EXACT []
synonym: "G-protein coupled receptor 169" EXACT []
synonym: "Gm1098" RELATED []
synonym: "GPR169" RELATED []
synonym: "Mas-related G-protein coupled receptor member G" EXACT []
synonym: "Mrgg" RELATED []
synonym: "MRGG" RELATED []
synonym: "Mrgprg" RELATED []
synonym: "MRGPRG" RELATED []
is_a: PRO:000001487 ! mas-related G protein-coupled receptor

[Term]
id: PRO:000001606
name: mas-related G protein-coupled receptor H
def: "A mas-related G protein-coupled receptor that is a translation product of the MRGPRH gene." [PRO:WCB]
comment: Category=gene.
synonym: "G-protein coupled receptor 90" EXACT []
synonym: "Gpr90" RELATED []
synonym: "Mas-related G-protein coupled receptor member H" EXACT []
synonym: "Mrgh" RELATED []
synonym: "Mrgprh" RELATED []
is_a: PRO:000001487 ! mas-related G protein-coupled receptor

[Term]
id: PRO:000001607
name: mas-related G protein-coupled receptor MRG
def: "A mas-related G protein-coupled receptor that is a translation product of the MAS1L gene. It is currently classed as an orphan receptor." [PRO:WCB]
comment: Category=gene.
synonym: "MAS-R" EXACT []
synonym: "Mas-related G-protein coupled receptor MRG" EXACT []
synonym: "MAS1-like" EXACT []
synonym: "MAS1L" RELATED []
synonym: "MRG" RELATED []
is_a: PRO:000001487 ! mas-related G protein-coupled receptor

[Term]
id: PRO:000001608
name: mas-related G protein-coupled receptor X
def: "A mas-related G protein-coupled receptor that is a translation product of the MRGPRX1, MRGPRX2, MRGPRX3 or MRGPRX4 gene. These genes belong to a small subfamily, found in the primate lineage, that also includes several pseudogenes." [PRO:WCB]
comment: Category=family.
is_a: PRO:000001487 ! mas-related G protein-coupled receptor

[Term]
id: PRO:000001609
name: melatonin receptor 1A
def: "An MT1-like melatonin receptor that is a translation product of the MTNR1A gene. The preferred ligand is melatonin." [PRO:WCB]
comment: Category=gene.
synonym: "Mel-1A-R" EXACT []
synonym: "Mel1a melatonin receptor" EXACT []
synonym: "Melatonin receptor type 1A" EXACT []
synonym: "MTNR1A" RELATED []
synonym: "Mtnr1a" RELATED []
is_a: PRO:000001429 ! MT1-like melatonin receptor

[Term]
id: PRO:000001610
name: melatonin receptor 1B
def: "An MT1-like melatonin receptor that is a translation product of the MTNR1B gene. The preferred ligand is melatonin." [PRO:WCB]
comment: Category=gene.
synonym: "Mel-1B-R" EXACT []
synonym: "Mel1b melatonin receptor" EXACT []
synonym: "Melatonin receptor type 1B" EXACT []
synonym: "MTNR1B" RELATED []
synonym: "Mtnr1b" RELATED []
is_a: PRO:000001429 ! MT1-like melatonin receptor

[Term]
id: PRO:000001611
name: melatonin-related receptor
def: "An MT1-like melatonin receptor that is a translation product of the GPR50 gene. It is currently classed as an orphan receptor." [PRO:WCB]
comment: Category=gene.
synonym: "G protein-coupled receptor 50" EXACT []
synonym: "GPR50" RELATED []
synonym: "Gpr50" RELATED []
synonym: "H9" EXACT []
synonym: "Melatonin-related receptor" EXACT []
is_a: PRO:000001429 ! MT1-like melatonin receptor

[Term]
id: PRO:000001612
name: mu-opioid receptor
def: "An opioid receptor that is a translation product of the OPRM1 gene. The preferred ligands are beta-endorphin and enkephalins." [PRO:WCB, Wikipedia:mu_Opioid_receptor]
comment: Category=gene.
synonym: "Mor" RELATED []
synonym: "MOR" RELATED []
synonym: "MOR-1" EXACT []
synonym: "MOR1" RELATED []
synonym: "Mu-type opioid receptor" EXACT []
synonym: "Oprm" RELATED []
synonym: "Oprm1" RELATED []
synonym: "OPRM1" RELATED []
is_a: PRO:000001497 ! opioid receptor

[Term]
id: PRO:000001613
name: muscarinic acetylcholine receptor 1
def: "A muscarinic acetylcholine receptor that is a translation product of the CHRM1 gene. This receptor mediates slow excitatory postsynaptic potential in the postganglionic nerve and is also expressed in exocrine glands and in the central nervous system." [PRO:WCB, Wikipedia:Muscarinic_acetylcholine_receptor]
comment: Category=gene.
synonym: "Chrm-1" RELATED []
synonym: "Chrm1" RELATED []
synonym: "CHRM1" RELATED []
synonym: "Muscarinic acetylcholine receptor M1" EXACT []
is_a: PRO:000001488 ! muscarinic acetylcholine receptor

[Term]
id: PRO:000001614
name: muscarinic acetylcholine receptor 2
def: "A muscarinic acetylcholine receptor that is a translation product of the CHRM2 gene. This receptor is expressed in cardiac tissues and acts to slow the heart rate to normal after sympathetic nervous system stimulation." [PRO:WCB, Wikipedia:Muscarinic_acetylcholine_receptor]
comment: Category=gene.
synonym: "Chrm-2" RELATED []
synonym: "Chrm2" RELATED []
synonym: "CHRM2" RELATED []
synonym: "Muscarinic acetylcholine receptor M2" EXACT []
is_a: PRO:000001488 ! muscarinic acetylcholine receptor

[Term]
id: PRO:000001615
name: muscarinic acetylcholine receptor 3
def: "A muscarinic acetylcholine receptor that is a translation product of the CHRM3 gene. This receptor is expressed in many glands, in lungs, and in the smooth muscles of blood vessels." [PRO:WCB, Wikipedia:Muscarinic_acetylcholine_receptor]
comment: Category=gene.
synonym: "Chrm-3" RELATED []
synonym: "CHRM3" RELATED []
synonym: "Chrm3" RELATED []
synonym: "Mm3 mAChR" EXACT []
synonym: "Muscarinic acetylcholine receptor M3" EXACT []
is_a: PRO:000001488 ! muscarinic acetylcholine receptor

[Term]
id: PRO:000001616
name: muscarinic acetylcholine receptor 4
def: "A muscarinic acetylcholine receptor that is a translation product of the CHRM4 gene. This receptor is expressed in the central nervous system." [PRO:WCB, Wikipedia:Muscarinic_acetylcholine_receptor]
comment: Category=gene.
synonym: "Chrm-4" RELATED []
synonym: "CHRM4" RELATED []
synonym: "Chrm4" RELATED []
synonym: "Mm4 mAChR" EXACT []
synonym: "Muscarinic acetylcholine receptor M4" EXACT []
is_a: PRO:000001488 ! muscarinic acetylcholine receptor

[Term]
id: PRO:000001617
name: muscarinic acetylcholine receptor 5
def: "A muscarinic acetylcholine receptor that is a translation product of the CHRM5 gene. Its expression pattern is yet to be elucidated." [PRO:WCB, Wikipedia:Muscarinic_acetylcholine_receptor]
comment: Category=gene.
synonym: "Chrm5" RELATED []
synonym: "CHRM5" RELATED []
synonym: "Muscarinic acetylcholine receptor M5" EXACT []
is_a: PRO:000001488 ! muscarinic acetylcholine receptor

[Term]
id: PRO:000001618
name: neuromedin U receptor 1
def: "A neuromedin U receptor that is a translation product of the NMUR1 gene. This receptor is expressed predominantly in peripheral tissues." [PRO:WCB, PubMed:10899166]
comment: Category=gene.
synonym: "G-protein coupled receptor 66" EXACT []
synonym: "G-protein coupled receptor FM-3" EXACT []
synonym: "GPR66" RELATED []
synonym: "Gpr66" RELATED []
synonym: "Neuromedin-U receptor 1" EXACT []
synonym: "NMU-R1" EXACT []
synonym: "NMUR1" RELATED []
synonym: "Nmur1" RELATED []
is_a: PRO:000001489 ! neuromedin U receptor

[Term]
id: PRO:000001619
name: neuromedin U receptor 2
def: "A neuromedin U receptor that is a translation product of the NMUR2 gene. This receptor is expressed predominantly in the central nervous system." [PRO:WCB, PubMed:10899166]
comment: Category=gene.
synonym: "G-protein coupled receptor FM-4" EXACT []
synonym: "G-protein coupled receptor TGR-1" EXACT []
synonym: "Neuromedin-U receptor 2" EXACT []
synonym: "NMU-R2" EXACT []
synonym: "NMU2R" RELATED []
synonym: "Nmur2" RELATED []
synonym: "NMUR2" RELATED []
synonym: "TGR1" RELATED []
is_a: PRO:000001489 ! neuromedin U receptor

[Term]
id: PRO:000001620
name: neuropeptide FF receptor 1
def: "A neuropeptide FF receptor that is a translation product of the NPFFR1 gene. The preferred ligands are neuropeptides FF and AF." [PRO:WCB]
comment: Category=gene.
synonym: "G-protein coupled receptor 147" EXACT []
synonym: "Gm236" RELATED []
synonym: "GPR147" RELATED []
synonym: "Gpr147" RELATED []
synonym: "Neuropeptide FF receptor 1" EXACT []
synonym: "NPFF1" RELATED []
synonym: "NPFFR1" RELATED []
synonym: "Npffr1" RELATED []
synonym: "RFamide-related peptide receptor OT7T022" EXACT []
is_a: PRO:000001490 ! neuropeptide FF receptor

[Term]
id: PRO:000001621
name: neuropeptide FF receptor 2
def: "A neuropeptide FF receptor that is a translation product of the NPFFR2 gene. The preferred ligands are neuropeptides FF and AF." [PRO:WCB, PubMed:10851242]
comment: Category=gene.
synonym: "G-protein coupled receptor 74" EXACT []
synonym: "G-protein coupled receptor HLWAR77" EXACT []
synonym: "GPR74" RELATED []
synonym: "Gpr74" RELATED []
synonym: "Neuropeptide FF receptor 2" EXACT []
synonym: "Neuropeptide G-protein coupled receptor" EXACT []
synonym: "Neuropeptide NPFF receptor" EXACT []
synonym: "Npff2" RELATED []
synonym: "NPFF2" RELATED []
synonym: "Npffr2" RELATED []
synonym: "NPFFR2" RELATED []
synonym: "NPGPR" RELATED []
is_a: PRO:000001490 ! neuropeptide FF receptor

[Term]
id: PRO:000001622
name: neuropeptide Y receptor 1
def: "A neuropeptide Y receptor 1/4/6 that is a translation product of the NPY1R gene. The preferred ligands are neuropeptides Y and YY." [PRO:WCB]
comment: Category=gene.
synonym: "Neuropeptide Y receptor type 1" EXACT []
synonym: "NPY1-R" EXACT []
synonym: "NPY1R" RELATED []
synonym: "Npy1r" RELATED []
synonym: "NPYR" RELATED []
synonym: "NPYY1" RELATED []
is_a: PRO:000001492 ! neuropeptide Y receptor 1/4/6

[Term]
id: PRO:000001623
name: neuropeptide Y receptor 4
def: "A neuropeptide Y receptor 1/4/6 that is a translation product of the PPYR1 gene. The preferred ligand is pancreatic polypeptide." [PRO:WCB]
comment: Category=gene.
synonym: "Neuropeptide Y receptor type 4" EXACT []
synonym: "NPY4-R" EXACT []
synonym: "NPY4R" RELATED []
synonym: "Npy4r" RELATED []
synonym: "NPYR-D" EXACT []
synonym: "Pancreatic polypeptide receptor 1" EXACT []
synonym: "PP1" EXACT []
synonym: "Ppyr1" RELATED []
synonym: "PPYR1" RELATED []
is_a: PRO:000001492 ! neuropeptide Y receptor 1/4/6

[Term]
id: PRO:000001624
name: neuropeptide Y receptor 6
def: "A neuropeptide Y receptor 1/4/6 that is a translation product of the NPY6R gene. The preferred ligands are neuropeptides Y and YY. The human protein is the product of an expressed pseudogene and does not bind neuropeptides Y or YY or pancreatic polypeptide." [PRO:WCB, UniProtKB:Q99463]
comment: Category=gene.
synonym: "Neuropeptide Y receptor type 6" EXACT []
synonym: "Npy5r" RELATED []
synonym: "NPY6-R" EXACT []
synonym: "Npy6r" RELATED []
synonym: "Pancreatic polypeptide receptor 2" EXACT []
synonym: "Ppyr2" RELATED []
is_a: PRO:000001492 ! neuropeptide Y receptor 1/4/6

[Term]
id: PRO:000001625
name: neuropeptides B/W receptor 1
def: "A neuropeptides B/W receptor that is a translation product of the NPBWR1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "G-protein coupled receptor 7" EXACT []
synonym: "Gpr7" RELATED []
synonym: "GPR7" RELATED []
synonym: "Neuropeptides B/W receptor type 1" EXACT []
synonym: "Npbwr1" RELATED []
synonym: "NPBWR1" RELATED []
is_a: PRO:000001495 ! neuropeptides B/W receptor

[Term]
id: PRO:000001626
name: neuropeptides B/W receptor 2
def: "A neuropeptides B/W receptor that is a translation product of the NPBWR2 gene." [PRO:WCB]
comment: Category=gene.
synonym: "G-protein coupled receptor 8" EXACT []
synonym: "GPR8" RELATED []
synonym: "Neuropeptides B/W receptor type 2" EXACT []
synonym: "NPBWR2" RELATED []
is_a: PRO:000001495 ! neuropeptides B/W receptor

[Term]
id: PRO:000001627
name: neurotensin receptor 1
def: "A G protein-coupled neurotensin receptor that is a translation product of the NTSR1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "High-affinity levocabastine-insensitive neurotensin receptor" EXACT []
synonym: "Neurotensin receptor type 1" EXACT []
synonym: "NT-R-1" EXACT []
synonym: "Ntr1" RELATED []
synonym: "NTRH" EXACT []
synonym: "NTRR" RELATED []
synonym: "Ntsr" RELATED []
synonym: "NTSR1" RELATED []
synonym: "Ntsr1" RELATED []
is_a: PRO:000001416 ! G protein-coupled neurotensin receptor

[Term]
id: PRO:000001628
name: neurotensin receptor 2
def: "A G protein-coupled neurotensin receptor that is a translation product of the NTSR2 gene. This receptor has a low affinity for neurotensin compared with neurotensin receptor 1 and neurotensin binding is selectively blocked by levocabastine." [PRO:WCB]
comment: Category=gene.
synonym: "Levocabastine-sensitive neurotensin receptor" EXACT []
synonym: "Low-affinity levocabastine-sensitive neurotensin receptor" EXACT []
synonym: "Neurotensin receptor type 2" EXACT []
synonym: "NT-R-2" EXACT []
synonym: "NTR2 receptor" EXACT []
synonym: "NTRL" EXACT []
synonym: "NTSR2" RELATED []
synonym: "Ntsr2" RELATED []
is_a: PRO:000001416 ! G protein-coupled neurotensin receptor

[Term]
id: PRO:000001629
name: nicotinic acid receptor 1
def: "A nicotinic acid receptor that is a translation product of the GPR109A gene. The preferred ligand is nicotinic acid." [PRO:WCB]
comment: Category=gene.
synonym: "G-protein coupled receptor 109" EXACT []
synonym: "G-protein coupled receptor 109A" EXACT []
synonym: "G-protein coupled receptor HM74" EXACT []
synonym: "G-protein coupled receptor HM74A" EXACT []
synonym: "Gpr109" RELATED []
synonym: "GPR109A" RELATED []
synonym: "Gpr109a" RELATED []
synonym: "Gpr109b" RELATED []
synonym: "HM74A" RELATED []
synonym: "Nicotinic acid receptor" EXACT []
synonym: "Nicotinic acid receptor 1" EXACT []
synonym: "Protein PUMA-G" EXACT []
synonym: "Pumag" RELATED []
is_a: PRO:000001496 ! nicotinic acid receptor

[Term]
id: PRO:000001630
name: nicotinic acid receptor 2
def: "A nicotinic acid receptor that is a translation product of the GPR109B gene. This gene is a recent duplication in primates of the GPR109A gene and has no rodent counterpart. This receptor has low affinity for nicotinic acid." [PRO:WCB]
comment: Category=gene.
synonym: "G-protein coupled receptor 109B" EXACT []
synonym: "G-protein coupled receptor HM74" EXACT []
synonym: "G-protein coupled receptor HM74B" EXACT []
synonym: "GPR109B" RELATED []
synonym: "Nicotinic acid receptor 2" EXACT []
is_a: PRO:000001496 ! nicotinic acid receptor

[Term]
id: PRO:000001631
name: nociceptin receptor
def: "An opioid receptor that is a translation product of the OPRL1 gene. The preferred ligand is nociceptin." [PRO:WCB]
comment: Category=gene.
synonym: "K3 opiate receptor" EXACT []
synonym: "Kappa-type 3 opioid receptor" EXACT []
synonym: "KOR-3" EXACT []
synonym: "Nociceptin receptor" EXACT []
synonym: "OOR" RELATED []
synonym: "Oor" RELATED []
synonym: "Oprl" RELATED []
synonym: "Oprl1" RELATED []
synonym: "OPRL1" RELATED []
synonym: "ORGC" EXACT []
synonym: "ORL1" RELATED []
synonym: "Orphanin FQ receptor" EXACT []
is_a: PRO:000001497 ! opioid receptor

[Term]
id: PRO:000001632
name: oleoyl-L-alpha-lysophosphatidic acid receptor
def: "An LPAR4-like receptor that is a translation product of the P2RY5 gene. The preferred ligand is reported to be oleoyl-L-alpha-lysophosphatidic acid (LPA). It is currently classed as an orphan receptor." [PRO:WCB, PubMed:18297070]
comment: Category=gene.
synonym: "Oleoyl-L-alpha-lysophosphatidic acid receptor" EXACT []
synonym: "P2ry5" RELATED []
synonym: "P2RY5" RELATED []
synonym: "P2Y purinoceptor 5" EXACT []
synonym: "P2y5" RELATED []
synonym: "P2Y5" EXACT []
synonym: "Purinergic receptor 5" EXACT []
synonym: "RB intron encoded G-protein coupled receptor" EXACT []
is_a: PRO:000001428 ! LPAR4-like receptor

[Term]
id: PRO:000001633
name: orexin receptor 1
def: "An orexin receptor that is a translation product of the HCRTR1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Hcrtr1" RELATED []
synonym: "HCRTR1" RELATED []
synonym: "Hypocretin receptor type 1" EXACT []
synonym: "Orexin receptor type 1" EXACT []
synonym: "Ox1r" EXACT []
is_a: PRO:000001499 ! orexin receptor

[Term]
id: PRO:000001634
name: orexin receptor 2
def: "An orexin receptor that is a translation product of the HCRTR2 gene." [PRO:WCB]
comment: Category=gene.
synonym: "HCRTR2" RELATED []
synonym: "Hcrtr2" RELATED []
synonym: "Hypocretin receptor type 2" EXACT []
synonym: "Mox2r" RELATED []
synonym: "Orexin receptor type 2" EXACT []
synonym: "Ox2r" EXACT []
is_a: PRO:000001499 ! orexin receptor

[Term]
id: PRO:000001635
name: oxytocin receptor
def: "A vasopressin/oxytocin receptor that is a translation product of the OXTR gene. The preferred ligand is oxytocin." [PRO:WCB]
comment: Category=gene.
synonym: "OT-R" EXACT []
synonym: "Oxtr" RELATED []
synonym: "OXTR" RELATED []
synonym: "Oxtr" EXACT []
synonym: "OXTR" EXACT []
synonym: "Oxytocin receptor" EXACT []
xref: PANTHER:PTHR19264\:SF46
is_a: PRO:000001562 ! vasopressin/oxytocin receptor

[Term]
id: PRO:000001636
name: probable G protein-coupled receptor 12
def: "A GPR6-like G protein-coupled receptor that is a translation product of the GPR12 gene. The preferred ligand is reported to be sphingosine 1-phosphate. It is currently classed as an orphan receptor." [PRO:WCB, PubMed:12220620]
comment: Category=gene.
synonym: "GPCR01" EXACT []
synonym: "Gpcr12" RELATED []
synonym: "GPR12" RELATED []
synonym: "Gpr12" RELATED []
synonym: "Probable G-protein coupled receptor 12" EXACT []
is_a: PRO:000001421 ! GPR6-like G protein-coupled receptor

[Term]
id: PRO:000001637
name: probable G protein-coupled receptor 153
def: "A probable G protein-coupled receptor 153/162 that is a translation product of the GPR153 gene. It is currently classed as an orphan receptor." [PRO:WCB]
comment: Category=gene.
synonym: "G-protein coupled receptor PGR1" EXACT []
synonym: "Gpr153" RELATED []
synonym: "GPR153" RELATED []
synonym: "Pgr1" RELATED []
synonym: "PGR1" RELATED []
synonym: "Probable G-protein coupled receptor 153" EXACT []
is_a: PRO:000001515 ! probable G protein-coupled receptor 153/162

[Term]
id: PRO:000001638
name: probable G protein-coupled receptor 162
def: "A probable G protein-coupled receptor 153/162 that is a translation product of the GPR162 gene. It is currently classed as an orphan receptor." [PRO:WCB]
comment: Category=gene.
synonym: "Gene-rich cluster gene A protein" EXACT []
synonym: "Gpr162" RELATED []
synonym: "GPR162" RELATED []
synonym: "GRCA" RELATED []
synonym: "Probable G-protein coupled receptor 162" EXACT []
is_a: PRO:000001515 ! probable G protein-coupled receptor 153/162

[Term]
id: PRO:000001639
name: probable G protein-coupled receptor 173
def: "A probable G protein-coupled receptor 27/85/173 that is a translation product of the GPR173 gene. It is currently classed as an orphan receptor." [PRO:WCB]
comment: Category=gene.
synonym: "GPR173" RELATED []
synonym: "Gpr173" RELATED []
synonym: "Probable G-protein coupled receptor 173" EXACT []
synonym: "Sreb3" RELATED []
synonym: "SREB3" RELATED []
synonym: "Super conserved receptor expressed in brain 3" EXACT []
is_a: PRO:000001526 ! probable G protein-coupled receptor 27/85/173

[Term]
id: PRO:000001640
name: probable G protein-coupled receptor 174
def: "A P2RY10-like receptor that is a translation product of the GPR174 gene. It is currently classed as an orphan receptor." [PRO:WCB]
comment: Category=gene.
synonym: "FKSG79" RELATED []
synonym: "Gm376" RELATED []
synonym: "Gpr174" RELATED []
synonym: "GPR174" RELATED []
synonym: "Probable G-protein coupled receptor 174" EXACT []
is_a: PRO:000001433 ! P2RY10-like receptor

[Term]
id: PRO:000001641
name: probable G protein-coupled receptor 26
def: "A probable G protein-coupled receptor 26/78 that is a translation product of the GPR26 gene. It is currently classed as an orphan receptor." [PRO:WCB]
comment: Category=gene.
synonym: "Gpr26" RELATED []
synonym: "GPR26" RELATED []
synonym: "Probable G-protein coupled receptor 26" EXACT []
is_a: PRO:000001525 ! probable G protein-coupled receptor 26/78

[Term]
id: PRO:000001642
name: probable G protein-coupled receptor 27
def: "A probable G protein-coupled receptor 27/85/173 that is a translation product of the GPR27 gene. It is currently classed as an orphan receptor." [PRO:WCB]
comment: Category=gene.
synonym: "GPR27" RELATED []
synonym: "Gpr27" RELATED []
synonym: "Probable G-protein coupled receptor 27" EXACT []
synonym: "Sreb1" RELATED []
synonym: "SREB1" RELATED []
synonym: "Super conserved receptor expressed in brain 1" EXACT []
is_a: PRO:000001526 ! probable G protein-coupled receptor 27/85/173

[Term]
id: PRO:000001643
name: probable G protein-coupled receptor 3
def: "A GPR6-like G protein-coupled receptor that is a translation product of the GPR3 gene. The preferred ligand is reported to be sphingosine 1-phosphate. It is currently classed as an orphan receptor." [PRO:WCB, PubMed:12220620]
comment: Category=gene.
synonym: "ACCA" RELATED []
synonym: "ACCA orphan receptor" EXACT []
synonym: "GPCR21" EXACT []
synonym: "Gpcr3" RELATED []
synonym: "GPR3" RELATED []
synonym: "Gpr3" RELATED []
synonym: "mCG_20804" RELATED []
synonym: "Probable G-protein coupled receptor 3" EXACT []
is_a: PRO:000001421 ! GPR6-like G protein-coupled receptor

[Term]
id: PRO:000001644
name: probable G protein-coupled receptor 4
def: "A GPR4-like G protein-coupled receptor that is a translation product of the GPR4 gene." [PRO:WCB]
comment: Category=gene.
synonym: "G-protein coupled receptor 19" EXACT []
synonym: "GPR19" RELATED []
synonym: "GPR4" RELATED []
synonym: "Gpr4" RELATED []
synonym: "Probable G-protein coupled receptor 4" EXACT []
is_a: PRO:000001420 ! GPR4-like G protein-coupled receptor

[Term]
id: PRO:000001645
name: probable G protein-coupled receptor 45
def: "A probable G protein-coupled receptor 45/63 that is a translation product of the GPR45 gene. It is currently classed as an orphan receptor. This receptor is expressed in brain particularly in the basal forebrain, frontal cortex, and caudate, but not in thalamus, hippocampus, or putamen." [PRO:WCB, UniProtKB:Q9Y5Y3]
comment: Category=gene.
synonym: "Gpr45" RELATED []
synonym: "GPR45" RELATED []
synonym: "Probable G-protein coupled receptor 45" EXACT []
synonym: "PSP24-1" EXACT []
synonym: "PSP24-alpha" EXACT []
is_a: PRO:000001533 ! probable G protein-coupled receptor 45/63

[Term]
id: PRO:000001646
name: probable G protein-coupled receptor 52
def: "A probable G protein-coupled receptor 21/52 that is a translation product of the GPR52 gene. It is currently classed as an orphan receptor." [PRO:WCB]
comment: Category=gene.
synonym: "Gpr52" RELATED []
synonym: "GPR52" RELATED []
synonym: "Probable G-protein coupled receptor 52" EXACT []
is_a: PRO:000001522 ! probable G protein-coupled receptor 21/52

[Term]
id: PRO:000001647
name: probable G protein-coupled receptor 63
def: "A probable G protein-coupled receptor 45/63 that is a translation product of the GPR63 gene. It is currently classed as an orphan receptor. This receptor is predominantly expressed in the brain." [PRO:WCB, PubMed:11027574]
comment: Category=gene.
synonym: "GPR63" RELATED []
synonym: "Gpr63" RELATED []
synonym: "Probable G-protein coupled receptor 63" EXACT []
synonym: "PSP24-2" EXACT []
synonym: "PSP24-beta" EXACT []
synonym: "PSP24B" RELATED []
is_a: PRO:000001533 ! probable G protein-coupled receptor 45/63

[Term]
id: PRO:000001648
name: probable G protein-coupled receptor 78
def: "A probable G protein-coupled receptor 26/78 that is a translation product of the GPR78 gene. This receptor is about 50% identical to the GPR26 receptor and has been found in humans but not in mice or rats." [PRO:WCB]
comment: Category=gene.
synonym: "GPR78" RELATED []
synonym: "Probable G-protein coupled receptor 78" EXACT []
is_a: PRO:000001525 ! probable G protein-coupled receptor 26/78

[Term]
id: PRO:000001649
name: probable G protein-coupled receptor 81
def: "A nicotinic acid receptor that is a translation product of the GPR81 gene. It has low affinity for nicotinic acid." [PRO:WCB]
comment: Category=gene.
synonym: "FKSG80" RELATED []
synonym: "G-protein coupled receptor 104" EXACT []
synonym: "GPR104" RELATED []
synonym: "GPR81" RELATED []
synonym: "Gpr81" RELATED []
synonym: "Probable G-protein coupled receptor 81" EXACT []
is_a: PRO:000001496 ! nicotinic acid receptor

[Term]
id: PRO:000001650
name: probable G protein-coupled receptor 85
def: "A probable G protein-coupled receptor 27/85/173 that is a translation product of the GPR85 gene. It is currently classed as an orphan receptor." [PRO:WCB]
comment: Category=gene.
synonym: "Gpr85" RELATED []
synonym: "GPR85" RELATED []
synonym: "Probable G-protein coupled receptor 85" EXACT []
synonym: "SREB2" RELATED []
synonym: "Sreb2" RELATED []
synonym: "Super conserved receptor expressed in brain 2" EXACT []
is_a: PRO:000001526 ! probable G protein-coupled receptor 27/85/173

[Term]
id: PRO:000001651
name: probable G protein-coupled receptor 87
def: "A P2RY12-like receptor that is a translation product of the GPR87 gene. It is currently classed as an orphan receptor." [PRO:WCB]
comment: Category=gene.
synonym: "FKSG78" RELATED []
synonym: "G-protein coupled receptor 95" EXACT []
synonym: "Gpr87" RELATED []
synonym: "GPR87" RELATED []
synonym: "GPR95" RELATED []
synonym: "Probable G-protein coupled receptor 87" EXACT []
is_a: PRO:000001434 ! P2RY12-like receptor

[Term]
id: PRO:000001652
name: probable P2Y purinoceptor 10
def: "A P2RY10-like receptor that is a translation product of the P2RY10 gene. It is currently classed as an orphan receptor." [PRO:WCB]
comment: Category=gene.
synonym: "P2RY10" RELATED []
synonym: "P2ry10" RELATED []
synonym: "P2Y-like receptor" EXACT []
synonym: "Putative P2Y purinoceptor 10" EXACT []
is_a: PRO:000001433 ! P2RY10-like receptor

[Term]
id: PRO:000001653
name: prokineticin receptor 1
def: "A prokineticin receptor that is a translation product of the PROKR1 gene. The preferred ligand is prokineticin 1." [PRO:WCB, UniProtKB:Q8TCW9]
comment: Category=gene.
synonym: "G-protein coupled receptor 73" EXACT []
synonym: "G-protein coupled receptor ZAQ" EXACT []
synonym: "Gpr73" RELATED []
synonym: "GPR73" RELATED []
synonym: "GPR73a" EXACT []
synonym: "PK-R1" EXACT []
synonym: "PKR1" RELATED []
synonym: "Pkr1" RELATED []
synonym: "Prokineticin receptor 1" EXACT []
synonym: "Prokr1" RELATED []
synonym: "PROKR1" RELATED []
is_a: PRO:000001545 ! prokineticin receptor

[Term]
id: PRO:000001654
name: prokineticin receptor 2
def: "A prokineticin receptor that is a translation product of the PROKR2 gene. The preferred ligand is prokineticin 2." [PRO:WCB, UniProtKB:Q8NFJ6]
comment: Category=gene.
synonym: "G-protein coupled receptor 73-like 1" EXACT []
synonym: "GPR73b" EXACT []
synonym: "Gpr73l1" RELATED []
synonym: "GPR73L1" RELATED []
synonym: "GPRg2" EXACT []
synonym: "PK-R2" EXACT []
synonym: "PKR2" RELATED []
synonym: "Pkr2" RELATED []
synonym: "Prokineticin receptor 2" EXACT []
synonym: "PROKR2" RELATED []
synonym: "Prokr2" RELATED []
is_a: PRO:000001545 ! prokineticin receptor

[Term]
id: PRO:000001655
name: prostacyclin receptor
def: "A prostanoid receptor that is a translation product of the PTGIR gene. The preferred ligand is prostacyclin (prostaglandin I2, PGI2). This receptor is widely distributed in blood platelets, vascular smooth muscle and nerve cells." [PRO:WCB, PubMed:7938166]
comment: Category=gene.
synonym: "PGI receptor" EXACT []
synonym: "PRIPR" RELATED []
synonym: "Prostacyclin receptor" EXACT []
synonym: "Prostaglandin I2 receptor" EXACT []
synonym: "Prostanoid IP receptor" EXACT []
synonym: "PTGIR" RELATED []
synonym: "Ptgir" RELATED []
is_a: PRO:000001549 ! prostanoid receptor

[Term]
id: PRO:000001656
name: prostaglandin D2 receptor
def: "A prostanoid receptor that is a translation product of the PTGDR gene. The preferred ligand is prostaglandin D2 (PGD2). This receptor is found mainly in blood platelets, vascular smooth muscle, and nervous tissue. It is the least upiquitous of the prostanoid receptors, almost always occurring in association with other prostanoid receptor types." [PRO:WCB, PubMed:7938166]
comment: Category=gene.
synonym: "PGD receptor" EXACT []
synonym: "Prostaglandin D2 receptor" EXACT []
synonym: "Prostanoid DP receptor" EXACT []
synonym: "Ptgdr" RELATED []
synonym: "PTGDR" RELATED []
is_a: PRO:000001549 ! prostanoid receptor

[Term]
id: PRO:000001657
name: prostaglandin E2 receptor EP1
def: "A prostanoid receptor that is a translation product of the PTGER1 gene. The preferred ligand is prostaglandin E2 (PGE2). This receptor has limited expression, although it is more evident in rodents than in other mammals." [PRO:WCB, PubMed:7938166]
comment: Category=gene.
synonym: "PGE receptor, EP1 subtype" EXACT []
synonym: "Prostaglandin E2 receptor EP1 subtype" EXACT []
synonym: "Prostanoid EP1 receptor" EXACT []
synonym: "PTGER1" RELATED []
synonym: "Ptger1" RELATED []
synonym: "Ptgerep1" RELATED []
is_a: PRO:000001549 ! prostanoid receptor

[Term]
id: PRO:000001658
name: prostaglandin E2 receptor EP2
def: "A prostanoid receptor that is a translation product of the PTGER2 gene. The preferred ligand is prostaglandin E2 (PGE2). This receptor is expressed mediates various effects, including relaxation of vascular smooth muscles, nonacid secretion from epithelial cells, inhibition of mediator release from mast cells and basophils, and activation of sensory afferent nerves." [PRO:WCB, PubMed:7938166]
comment: Category=gene.
synonym: "PGE receptor, EP2 subtype" EXACT []
synonym: "Prostaglandin E2 receptor EP2 subtype" EXACT []
synonym: "Prostanoid EP2 receptor" EXACT []
synonym: "Ptger2" RELATED []
synonym: "PTGER2" RELATED []
synonym: "Ptgerep2" RELATED []
is_a: PRO:000001549 ! prostanoid receptor

[Term]
id: PRO:000001659
name: prostaglandin E2 receptor EP3
def: "A prostanoid receptor that is a translation product of the PTGER3 gene. The preferred ligand is prostaglandin E2 (PGE2). This receptor is the most ubiquitous of the prostaglandin E2 receptors, mediating contraction of gastrointestinal, uterine, and vascular smooth muscle, inhibition of neurotransmitter release from autonomic nerves, inhibition of lipolysis in adipocytes, inhibition of acid secretion from gastric mucosa, and inhibition of water reabsorption in kidney." [PRO:WCB, PubMed:7938166]
comment: Category=gene.
synonym: "PGE receptor, EP3 subtype" EXACT []
synonym: "PGE2-R" EXACT []
synonym: "Prostaglandin E2 receptor EP3 subtype" EXACT []
synonym: "Prostanoid EP3 receptor" EXACT []
synonym: "Ptger3" RELATED []
synonym: "PTGER3" RELATED []
synonym: "Ptgerep3" RELATED []
is_a: PRO:000001549 ! prostanoid receptor

[Term]
id: PRO:000001660
name: prostaglandin F2-alpha receptor
def: "A prostanoid receptor that is a translation product of the PTGFR gene. The preferred ligand is prostaglandin F2a. This receptor is particularly prevalent in the corpus luteum, but is expressed in other tissues also." [PRO:WCB, PubMed:7938166]
comment: Category=gene.
synonym: "fp" RELATED []
synonym: "PGF receptor" EXACT []
synonym: "PGF2 alpha receptor" EXACT []
synonym: "Prostaglandin F2-alpha receptor" EXACT []
synonym: "Prostanoid FP receptor" EXACT []
synonym: "PTGFR" RELATED []
synonym: "Ptgfr" RELATED []
is_a: PRO:000001549 ! prostanoid receptor

[Term]
id: PRO:000001661
name: proteinase-activated receptor 1
def: "A proteinase-activated receptor that is a translation product of the F2R gene. It is activated by thrombin, which cleaves the mature peptide, exposing a new amino end. The new N-terminal residues act as a tethered ligand that induces activity." [PRO:WCB, PubMed:1672265]
comment: Category=gene.
synonym: "Cf2r" RELATED []
synonym: "CF2R" RELATED []
synonym: "Coagulation factor II receptor" EXACT []
synonym: "F2r" RELATED []
synonym: "F2R" RELATED []
synonym: "PAR1" RELATED []
synonym: "Par1" RELATED []
synonym: "Proteinase-activated receptor 1" EXACT []
synonym: "Proteinase-activated receptor 1 precursor" EXACT []
synonym: "Thrombin receptor" EXACT []
synonym: "TR" RELATED []
is_a: PRO:000001550 ! proteinase-activated receptor

[Term]
id: PRO:000001662
name: proteinase-activated receptor 2
def: "A proteinase-activated receptor that is a translation product of the F2RL1 gene. It is activated by trypsin and trypsin-like proteinases, which cleave the mature peptide, exposing a new amino end. The six new N-terminal residues act as a tethered ligand that induces activity." [PRO:WCB, PubMed:7556175]
comment: Category=gene.
synonym: "Coagulation factor II receptor-like 1" EXACT []
synonym: "F2rl1" RELATED []
synonym: "F2RL1" RELATED []
synonym: "G-protein coupled receptor 11" EXACT []
synonym: "Gpcr11" RELATED []
synonym: "GPR11" RELATED []
synonym: "Gpr11" RELATED []
synonym: "PAR-2" EXACT []
synonym: "Par2" RELATED []
synonym: "PAR2" RELATED []
synonym: "Proteinase-activated receptor 2" EXACT []
synonym: "Proteinase-activated receptor 2 precursor" EXACT []
synonym: "Thrombin receptor-like 1" EXACT []
is_a: PRO:000001550 ! proteinase-activated receptor

[Term]
id: PRO:000001663
name: proteinase-activated receptor 3
def: "A proteinase-activated receptor that is a translation product of the F2RL2 gene. It is activated by thrombin, which cleaves the mature peptide, exposing a new amino end. The six new N-terminal residues act as a tethered ligand that induces activity." [PRO:WCB, PubMed:15582715]
comment: Category=gene.
synonym: "Coagulation factor II receptor-like 2" EXACT []
synonym: "F2RL2" RELATED []
synonym: "F2rl2" RELATED []
synonym: "PAR-3" EXACT []
synonym: "Par3" RELATED []
synonym: "PAR3" RELATED []
synonym: "Proteinase-activated receptor 3 precursor" EXACT []
synonym: "Thrombin receptor-like 2" EXACT []
is_a: PRO:000001550 ! proteinase-activated receptor

[Term]
id: PRO:000001664
name: proteinase-activated receptor 4
def: "A proteinase-activated receptor that is a translation product of the F2RL3 gene. It is activated by thrombin and cathepsin G, which cleave the mature peptide, exposing a new amino end. The six new N-terminal residues act as a tethered ligand that induces activity." [PRO:WCB, PubMed:10702240, PubMed:9618465]
comment: Category=gene.
synonym: "Coagulation factor II receptor-like 3" EXACT []
synonym: "F2RL3" RELATED []
synonym: "F2rl3" RELATED []
synonym: "PAR-4" EXACT []
synonym: "PAR4" RELATED []
synonym: "Par4" RELATED []
synonym: "Proteinase-activated receptor 4 precursor" EXACT []
synonym: "Thrombin receptor-like 3" EXACT []
is_a: PRO:000001550 ! proteinase-activated receptor

[Term]
id: PRO:000001665
name: psychosine receptor
def: "A GPR4-like G protein-coupled receptor that is a translation product of the GPR65 gene. The preferred ligand is reported to be psychosine. It is currently classed as an orphan receptor." [PRO:WCB, PubMed:11309421]
comment: Category=gene.
synonym: "G-protein coupled receptor 65" EXACT []
synonym: "Gpcr25" RELATED []
synonym: "GPR65" RELATED []
synonym: "Gpr65" RELATED []
synonym: "Psychosine receptor" EXACT []
synonym: "T-cell death-associated protein 8" EXACT []
synonym: "TDAG8" RELATED []
synonym: "Tdag8" RELATED []
is_a: PRO:000001420 ! GPR4-like G protein-coupled receptor

[Term]
id: PRO:000001666
name: relaxin receptor 1
def: "A relaxin receptor that is a translation product of the RXFP1 gene. This receptor is expressed in the brain, kidney, testis, placenta, uterus, ovary, adrenal, prostate, skin and heart." [PRO:WCB, SwissPro:Q9HBX9]
comment: Category=gene.
synonym: "Leucine-rich repeat-containing G-protein coupled receptor 7" EXACT []
synonym: "Lgr7" RELATED []
synonym: "LGR7" RELATED []
synonym: "Relaxin family peptide receptor 1" EXACT []
synonym: "Relaxin receptor 1" EXACT []
synonym: "RXFP1" RELATED []
synonym: "Rxfp1" RELATED []
is_a: PRO:000001551 ! relaxin receptor

[Term]
id: PRO:000001667
name: relaxin receptor 2
def: "A relaxin receptor that is a translation product of the RXFP2 gene. This receptor is expressed mainly in the brain, kidney, muscle, testis, thyroid, uterus, peripheral blood cells, and bone marrow." [PRO:WCB, UniProtKB:Q8WXD0]
comment: Category=gene.
synonym: "G-protein coupled receptor 106" EXACT []
synonym: "G-protein coupled receptor affecting testicular descent" EXACT []
synonym: "Gpr106" RELATED []
synonym: "GPR106" RELATED []
synonym: "GREAT" RELATED []
synonym: "Great" RELATED []
synonym: "Leucine-rich repeat-containing G-protein coupled receptor 8" EXACT []
synonym: "Lgr8" RELATED []
synonym: "LGR8" RELATED []
synonym: "Relaxin family peptide receptor 2" EXACT []
synonym: "Relaxin receptor 2" EXACT []
synonym: "Rxfp2" RELATED []
synonym: "RXFP2" RELATED []
is_a: PRO:000001551 ! relaxin receptor

[Term]
id: PRO:000001668
name: somatostatin receptor 1
def: "A somatostatin receptor that is a translation product of the SSTR1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Smstr1" RELATED []
synonym: "Somatostatin receptor type 1" EXACT []
synonym: "SRIF-2" EXACT []
synonym: "SS1R" EXACT []
synonym: "SSTR1" RELATED []
synonym: "Sstr1" RELATED []
is_a: PRO:000001555 ! somatostatin receptor

[Term]
id: PRO:000001669
name: somatostatin receptor 2
def: "A somatostatin receptor that is a translation product of the SSTR2 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Smstr2" RELATED []
synonym: "Somatostatin receptor type 2" EXACT []
synonym: "SRIF-1" EXACT []
synonym: "SS2R" EXACT []
synonym: "Sst2" RELATED []
synonym: "SSTR2" RELATED []
synonym: "Sstr2" RELATED []
is_a: PRO:000001555 ! somatostatin receptor

[Term]
id: PRO:000001670
name: somatostatin receptor 3
def: "A somatostatin receptor that is a translation product of the SSTR3 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Smstr3" RELATED []
synonym: "Somatostatin receptor type 3" EXACT []
synonym: "SS3R" EXACT []
synonym: "SSR-28" EXACT []
synonym: "Sstr3" RELATED []
synonym: "SSTR3" RELATED []
is_a: PRO:000001555 ! somatostatin receptor

[Term]
id: PRO:000001671
name: somatostatin receptor 4
def: "A somatostatin receptor that is a translation product of the SSTR4 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Smstr4" RELATED []
synonym: "Somatostatin receptor type 4" EXACT []
synonym: "SS4R" EXACT []
synonym: "Sstr4" RELATED []
synonym: "SSTR4" RELATED []
is_a: PRO:000001555 ! somatostatin receptor

[Term]
id: PRO:000001672
name: somatostatin receptor 5
def: "A somatostatin receptor that is a translation product of the SSTR5 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Smstr5" RELATED []
synonym: "Somatostatin receptor type 5" EXACT []
synonym: "SS5R" EXACT []
synonym: "Sstr5" RELATED []
synonym: "SSTR5" RELATED []
is_a: PRO:000001555 ! somatostatin receptor

[Term]
id: PRO:000001673
name: sphingosine 1-phosphate receptor 1-5
def: "An LPAR1/S1PR1-like lysophospholipid receptor that is a translation product of the S1PR1, S1PR2, S1PR3, S1PR4, or S1PR5 genes and whose active form binds sphingosine 1-phosphate (S1P). S1P is a bioactive lysophospholipid that elicits diverse physiological effects on most types of cells and tissues." [PRO:WCB, UniProtKB:O95136]
comment: Category=family.
xref: PIRSF:PIRSF501018
is_a: PRO:000001427 ! LPAR1/S1PR1-like lysophospholipid receptor

[Term]
id: PRO:000001674
name: sphingosine 1-phosphate receptor GPR6
def: "A GPR6-like G protein-coupled receptor that is a translation product of the GPR6 gene. The preferred ligand is reported to be sphingosine 1-phosphate. It is currently classed as an orphan receptor." [PRO:WCB, PubMed:12220620]
comment: Category=gene.
synonym: "G-protein coupled receptor 6" EXACT []
synonym: "Gm233" RELATED []
synonym: "Gpr6" RELATED []
synonym: "GPR6" RELATED []
synonym: "Sphingosine 1-phosphate receptor GPR6" EXACT []
is_a: PRO:000001421 ! GPR6-like G protein-coupled receptor

[Term]
id: PRO:000001675
name: sphingosylphosphorylcholine receptor
def: "A GPR4-like G protein-coupled receptor that is a translation product of the GPR68 gene. The preferred ligand is reported to be sphingosylphosphorylcholine. It is currently classed as an orphan receptor." [PRO:WCB, PubMed:10806476]
comment: Category=gene.
synonym: "G-protein coupled receptor 68" EXACT []
synonym: "GPR12A" EXACT []
synonym: "Gpr68" RELATED []
synonym: "GPR68" RELATED []
synonym: "OGR-1" EXACT []
synonym: "OGR1" RELATED []
synonym: "Ovarian cancer G-protein coupled receptor 1" EXACT []
synonym: "Sphingosylphosphorylcholine receptor" EXACT []
is_a: PRO:000001420 ! GPR4-like G protein-coupled receptor

[Term]
id: PRO:000001676
name: thromboxane A2 receptor
def: "A prostanoid receptor that is a translation product of the TBXA2R gene. The preferred ligand is thromboxane A2. This receptor is found mainly in vascular smooth muscle, where it mediates vasoconstriction, in platelets, where it mediates aggregation, and in airway smooth muscle." [PRO:WCB, PubMed:7938166]
comment: Category=gene.
synonym: "Prostanoid TP receptor" EXACT []
synonym: "TBXA2R" RELATED []
synonym: "Tbxa2r" RELATED []
synonym: "Thromboxane A2 receptor" EXACT []
synonym: "tp" RELATED []
synonym: "TP receptor" RELATED []
synonym: "TXA2-R" EXACT []
is_a: PRO:000001549 ! prostanoid receptor

[Term]
id: PRO:000001677
name: thyrotropin receptor
def: "A glycoprotein hormone receptor that is a translation product of the TSHR gene. The preferred ligand is thyrotropin (thyroid-stimulating hormone)." [PRO:WCB]
comment: Category=gene.
synonym: "LGR3" RELATED []
synonym: "Thyroid-stimulating hormone receptor" EXACT []
synonym: "Thyrotropin receptor" EXACT []
synonym: "Thyrotropin receptor precursor" EXACT []
synonym: "TSH-R" EXACT []
synonym: "Tshr" RELATED []
synonym: "TSHR" RELATED []
is_a: PRO:000001463 ! glycoprotein hormone receptor

[Term]
id: PRO:000001678
name: trace amine associated receptor 1-4
def: "A trace amine associated receptor that is a member of a subfamily comprising TAAR1, TAAR2, TAAR3 and TAAR4." [PRO:WCB, PubMed:15718104]
comment: Category=family.
is_a: PRO:000001558 ! trace amine associated receptor

[Term]
id: PRO:000001679
name: trace amine associated receptor 5
def: "A trace amine associated receptor-related protein that is a translation product of the TAAR5 gene. It is currently classed as an orphan receptor." [PRO:WCB]
comment: Category=gene.
synonym: "Gm227" RELATED []
synonym: "PNR" RELATED []
synonym: "Putative neurotransmitter receptor" EXACT []
synonym: "TAAR5" RELATED []
synonym: "Taar5" RELATED []
synonym: "Trace amine-associated receptor 5" EXACT []
is_a: PRO:000001558 ! trace amine associated receptor

[Term]
id: PRO:000001680
name: trace amine associated receptor 6-9
def: "A trace amine associated receptor that is a member of a subfamily comprising TAAR6, TAAR7, TAAR8 and TAAR9." [PRO:WCB, PubMed:15718104]
comment: Category=family.
is_a: PRO:000001558 ! trace amine associated receptor

[Term]
id: PRO:000001681
name: vasopressin receptor 1A
def: "A vasopressin/oxytocin receptor that is a translation product of the AVPR1A gene. The preferred ligand is vasopressin. The receptor is expressed in vascular smooth muscle cells, hepatocytes, platelets, brain cells, and uterus cells." [PRO:WCB, Wikipedia:vasopressin_receptor]
comment: Category=gene.
synonym: "Antidiuretic hormone receptor 1a" EXACT []
synonym: "AVPR V1a" EXACT []
synonym: "AVPR1" RELATED []
synonym: "AVPR1A" RELATED []
synonym: "Avpr1a" RELATED []
synonym: "V1aR" EXACT []
synonym: "Vascular/hepatic-type arginine vasopressin receptor" EXACT []
synonym: "Vasopressin V1a receptor" EXACT []
xref: PANTHER:PTHR19264\:SF48
is_a: PRO:000001562 ! vasopressin/oxytocin receptor

[Term]
id: PRO:000001682
name: vasopressin receptor 1B
def: "A vasopressin/oxytocin receptor that is a translation product of the AVPR1B gene. The preferred ligand is vasopressin. The receptor is expressed in cells in the anterior pituitary and throughout the brain." [PRO:WCB, Wikipedia:vasopressin_receptor]
comment: Category=gene.
synonym: "Antidiuretic hormone receptor 1b" EXACT []
synonym: "AVPR V1b" RELATED []
synonym: "AVPR V1b" EXACT []
synonym: "AVPR V3" RELATED []
synonym: "AVPR V3" EXACT []
synonym: "AVPR1B" RELATED []
synonym: "Avpr1b" RELATED []
synonym: "AVPR3" RELATED []
synonym: "V1br" RELATED []
synonym: "V1bR" EXACT []
synonym: "Vasopressin V1b receptor" EXACT []
synonym: "Vasopressin V3 receptor" EXACT []
synonym: "VPR3" RELATED []
synonym: "VPR3" EXACT []
xref: PANTHER:PTHR19264\:SF47
is_a: PRO:000001562 ! vasopressin/oxytocin receptor

[Term]
id: PRO:000001683
name: vasopressin receptor 2
def: "A vasopressin/oxytocin receptor that is a translation product of the AVPR2 gene. The preferred ligand is vasopressin. The receptor is expressed in kidney tubule, fetal lung, lung cancer, and liver." [PRO:WCB, Wikipedia:vasopressin_receptor]
comment: Category=gene.
synonym: "ADHR" RELATED []
synonym: "Antidiuretic hormone receptor" EXACT []
synonym: "AVPR V2" RELATED []
synonym: "AVPR V2" EXACT []
synonym: "Avpr2" RELATED []
synonym: "AVPR2" RELATED []
synonym: "DIR" RELATED []
synonym: "DIR3" RELATED []
synonym: "Renal-type arginine vasopressin receptor" EXACT []
synonym: "V2r" RELATED []
synonym: "V2R" RELATED []
synonym: "Vasopressin V2 receptor" EXACT []
xref: PANTHER:PTHR19264\:SF45
is_a: PRO:000001562 ! vasopressin/oxytocin receptor

[Term]
id: PRO:000001684
name: lysophosphatidic acid receptor 1
def: "A lysophosphatidic acid receptor 1/2/3 that is a translation product of the LPAR1 gene. It is expressed in many adult organs, including brain, heart, colon, small intestine, placenta, prostate, ovary, pancreas, testis, spleen, skeletal muscle, and kidney. There is little or no expression in liver, lung, thymus, or peripheral blood leukocytes." [PRO:WCB, UniProtKB:Q92633]
comment: Category=gene.
synonym: "EDG2" RELATED []
synonym: "Edg2" RELATED []
synonym: "Gpcr26" RELATED []
synonym: "LPA receptor 1" EXACT []
synonym: "LPA-1" EXACT []
synonym: "Lpa1" RELATED []
synonym: "LPA1" RELATED []
synonym: "LPAR1" RELATED []
synonym: "Lpar1" RELATED []
synonym: "Lysophosphatidic acid receptor 1" EXACT []
synonym: "Lysophosphatidic acid receptor Edg-2" EXACT []
synonym: "Rec1.3" EXACT []
synonym: "VZG-1" EXACT []
synonym: "Vzg1" RELATED []
is_a: PRO:000001597 ! lysophosphatidic acid receptor 1/2/3

[Term]
id: PRO:000001685
name: lysophosphatidic acid receptor 2
def: "A lysophosphatidic acid receptor 1/2/3 that is a translation product of the LPAR2 gene. It is expressed most abundantly in testis and peripheral blood leukocytes with less expression in pancreas, spleen, thymus and prostate. There is little or no expression in heart, brain, placenta, lung, liver, skeletal muscle, kidney, ovary, small intestine, or colon." [PRO:WCB, UniProtKB:Q9HBW0]
comment: Category=gene.
synonym: "EDG4" RELATED []
synonym: "Edg4" RELATED []
synonym: "LPA receptor 2" EXACT []
synonym: "LPA-2" EXACT []
synonym: "LPA2" RELATED []
synonym: "Lpa2" RELATED []
synonym: "Lpar2" RELATED []
synonym: "LPAR2" RELATED []
synonym: "Lysophosphatidic acid receptor 2" EXACT []
synonym: "Lysophosphatidic acid receptor Edg-4" EXACT []
is_a: PRO:000001597 ! lysophosphatidic acid receptor 1/2/3

[Term]
id: PRO:000001686
name: lysophosphatidic acid receptor 3
def: "A lysophosphatidic acid receptor 1/2/3 that is a translation product of the LPAR3 gene. It is most abundantly expressed in prostate, testis, pancreas, and heart, with moderate levels in lung and ovary. There is no detectable expression in brain, placenta, liver, skeletal muscle, kidney, spleen, thymus, small intestine, colon, or peripheral blood leukocytes." [PRO:WCB, UniProtKB:Q9UBY5]
comment: Category=gene.
synonym: "EDG7" RELATED []
synonym: "Edg7" RELATED []
synonym: "LPA receptor 3" EXACT []
synonym: "LPA3" RELATED []
synonym: "Lpa3" RELATED []
synonym: "Lpar3" RELATED []
synonym: "LPAR3" RELATED []
synonym: "Lysophosphatidic acid receptor 3" EXACT []
synonym: "Lysophosphatidic acid receptor Edg-7" EXACT []
is_a: PRO:000001597 ! lysophosphatidic acid receptor 1/2/3

[Term]
id: PRO:000001687
name: mas-related G protein-coupled receptor A1
def: "A mas-related G protein-coupled receptor A that is a translation product of the MRGPRA1 gene. RF-amide-related peptides are reported to be the preferred ligands." [PRO:WCB, PubMed:11551509, PubMed:12397184]
comment: Category=gene.
synonym: "Mas-related G-protein coupled receptor member A1" EXACT []
synonym: "Mrga1" RELATED []
synonym: "Mrgpra1" RELATED []
synonym: "RF-amide G-protein coupled receptor" EXACT []
is_a: PRO:000001599 ! mas-related G protein-coupled receptor A

[Term]
id: PRO:000001688
name: mas-related G protein-coupled receptor A2
def: "A mas-related G protein-coupled receptor A that is a translation product of the MRGPR2 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Mas-related G-protein coupled receptor member A2" EXACT []
synonym: "Mrga2" RELATED []
synonym: "Mrgpra2" RELATED []
is_a: PRO:000001599 ! mas-related G protein-coupled receptor A

[Term]
id: PRO:000001689
name: mas-related G protein-coupled receptor A3
def: "A mas-related G protein-coupled receptor A that is a translation product of the MRGPRA3 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Mas-related G-protein coupled receptor member A3" EXACT []
synonym: "Mrga3" RELATED []
synonym: "Mrgpra3" RELATED []
is_a: PRO:000001599 ! mas-related G protein-coupled receptor A

[Term]
id: PRO:000001690
name: mas-related G protein-coupled receptor A4
def: "A mas-related G protein-coupled receptor A that is a translation product of the MRGPRA4 gene. RF-amide-related peptides are reported to be the preferred ligands." [PRO:WCB, PubMed:11551509]
comment: Category=gene.
synonym: "Mas-related G-protein coupled receptor member A4" EXACT []
synonym: "Mrga4" RELATED []
synonym: "Mrgpra4" RELATED []
synonym: "RF-amide G-protein coupled receptor" EXACT []
is_a: PRO:000001599 ! mas-related G protein-coupled receptor A

[Term]
id: PRO:000001691
name: mas-related G protein-coupled receptor A5
def: "A mas-related G protein-coupled receptor A that is a translation product of the MRGPRA5 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Mas-related G-protein coupled receptor member A5" EXACT []
synonym: "Mrga5" RELATED []
synonym: "Mrgpra5" RELATED []
is_a: PRO:000001599 ! mas-related G protein-coupled receptor A

[Term]
id: PRO:000001692
name: mas-related G protein-coupled receptor A6
def: "A mas-related G protein-coupled receptor A that is a translation product of the MRGPRA6 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Mas-related G-protein coupled receptor member A6" EXACT []
synonym: "Mrga6" RELATED []
synonym: "Mrgpra6" RELATED []
is_a: PRO:000001599 ! mas-related G protein-coupled receptor A

[Term]
id: PRO:000001693
name: mas-related G protein-coupled receptor A7
def: "A mas-related G protein-coupled receptor A that is a translation product of the MRGPRA7 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Mas-related G-protein coupled receptor member A7" EXACT []
synonym: "Mrga7" RELATED []
synonym: "Mrgpra7" RELATED []
is_a: PRO:000001599 ! mas-related G protein-coupled receptor A

[Term]
id: PRO:000001694
name: mas-related G protein-coupled receptor A8
def: "A mas-related G protein-coupled receptor A that is a translation product of the MRGPRA8 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Mas-related G-protein coupled receptor member A8" EXACT []
synonym: "Mrga8" RELATED []
synonym: "Mrgpra8" RELATED []
is_a: PRO:000001599 ! mas-related G protein-coupled receptor A

[Term]
id: PRO:000001695
name: mas-related G protein-coupled receptor B1
def: "A mas-related G protein-coupled receptor B that is a translation product of the MRGPRB1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Mas-related G-protein coupled receptor member B1" EXACT []
synonym: "Mrgb1" RELATED []
synonym: "Mrgprb1" RELATED []
is_a: PRO:000001600 ! mas-related G protein-coupled receptor B

[Term]
id: PRO:000001696
name: mas-related G protein-coupled receptor B10
def: "A mas-related G protein-coupled receptor B that is a translation product of a gene corresponding to the mouse MRGPRX2 gene, formerly called MRGPRB10, or a closely related gene. Although commonly designated as orthologous to human MRGPRX2, these genes are not as closely related as one would expect of true orthologs." [PRO:WCB]
comment: Category=gene.
synonym: "mas-related G protein-coupled receptor B10" EXACT []
synonym: "Mas-related G-protein coupled receptor member B10" EXACT []
synonym: "Mrgprb10" RELATED []
synonym: "Mrgprx2" RELATED []
is_a: PRO:000001600 ! mas-related G protein-coupled receptor B

[Term]
id: PRO:000001697
name: mas-related G protein-coupled receptor B2
def: "A mas-related G protein-coupled receptor B that is a translation product of the MRGPRB2 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Mas-related G-protein coupled receptor member B2" EXACT []
synonym: "Mrgb2" RELATED []
synonym: "Mrgprb2" RELATED []
is_a: PRO:000001600 ! mas-related G protein-coupled receptor B

[Term]
id: PRO:000001698
name: mas-related G protein-coupled receptor B3
def: "A mas-related G protein-coupled receptor B that is a translation product of the MRGPRB3 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Mas-related G-protein coupled receptor member B3" EXACT []
synonym: "Mrgb3" RELATED []
synonym: "Mrgprb3" RELATED []
is_a: PRO:000001600 ! mas-related G protein-coupled receptor B

[Term]
id: PRO:000001699
name: mas-related G protein-coupled receptor B4
def: "A mas-related G protein-coupled receptor B that is a translation product of the MRGPRB4 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Mas-related G-protein coupled receptor member B4" EXACT []
synonym: "Mrgb4" RELATED []
synonym: "Mrgprb4" RELATED []
is_a: PRO:000001600 ! mas-related G protein-coupled receptor B

[Term]
id: PRO:000001700
name: mas-related G protein-coupled receptor B5
def: "A mas-related G protein-coupled receptor B that is a translation product of the MRGPRB5 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Mas-related G-protein coupled receptor member B5" EXACT []
synonym: "Mrgb5" RELATED []
synonym: "Mrgprb5" RELATED []
is_a: PRO:000001600 ! mas-related G protein-coupled receptor B

[Term]
id: PRO:000001701
name: mas-related G protein-coupled receptor B8
def: "A mas-related G protein-coupled receptor B that is a translation product of the MRGPRB8 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Mas-related G-protein coupled receptor member B8" EXACT []
synonym: "Mrgb8" RELATED []
synonym: "Mrgprb8" RELATED []
is_a: PRO:000001600 ! mas-related G protein-coupled receptor B

[Term]
id: PRO:000001702
name: mas-related G protein-coupled receptor X1
def: "A mas-related G protein-coupled receptor X that is a translation product of the MRGPRX1 gene. It is currrently classed as an orphan receptor. This receptor is specific to a subset of small dorsal root and trigeminal sensory neurons. This receptor is strongly activated by bovine adrenal medulla peptide 22 (BAM22) and related peptides." [PRO:WCB, PubMed:16284629, UniProtKB:Q96LB2]
comment: Category=gene.
synonym: "Mas-related G-protein coupled receptor member X1" EXACT []
synonym: "MRGPRX1" RELATED []
synonym: "MRGX1" RELATED []
synonym: "Sensory neuron-specific G-protein coupled receptor 3/4" EXACT []
synonym: "SNSR3" RELATED []
synonym: "SNSR4" RELATED []
is_a: PRO:000001608 ! mas-related G protein-coupled receptor X

[Term]
id: PRO:000001703
name: mas-related G protein-coupled receptor X2
def: "A mas-related G protein-coupled receptor X that is a translation product of the MRGPRX2 gene. It is currrently classed as an orphan receptor. This receptor has limited expression in peripheral and central nervous system, with highest levels in dorsal root ganglion. In contrast with the X1 receptor, it is activated by cortistatin-14 but only weakly by BAM22." [PRO:WCB, PubMed:16284629, UniProtKB:Q96LB1]
comment: Category=gene.
synonym: "Mas-related G-protein coupled receptor member X2" EXACT []
synonym: "MRGPRX2" RELATED []
synonym: "MRGX2" RELATED []
is_a: PRO:000001608 ! mas-related G protein-coupled receptor X

[Term]
id: PRO:000001704
name: mas-related G protein-coupled receptor X3
def: "A mas-related G protein-coupled receptor X that is a translation product of the MRGPRX3 gene. This receptor is specific to a subset of small dorsal root and trigeminal sensory neurons." [PRO:WCB, UniProtKB:Q96LB0]
comment: Category=gene.
synonym: "Mas-related G-protein coupled receptor member X3" EXACT []
synonym: "MRGPRX3" RELATED []
synonym: "MRGX3" RELATED []
synonym: "Sensory neuron-specific G-protein coupled receptor 1/2" EXACT []
synonym: "SNSR1" RELATED []
synonym: "SNSR2" RELATED []
is_a: PRO:000001608 ! mas-related G protein-coupled receptor X

[Term]
id: PRO:000001705
name: mas-related G protein-coupled receptor X4
def: "A mas-related G protein-coupled receptor X that is a translation product of the MRGPRX4 gene. It is currrently classed as an orphan receptor. This receptor is specific to ia subset of small dorsal root and trigeminal sensory neurons." [PRO:WCB, UniProtKB:Q96LA9]
comment: Category=gene.
synonym: "Mas-related G-protein coupled receptor member X4" EXACT []
synonym: "MRGPRX4" RELATED []
synonym: "MRGX4" RELATED []
synonym: "Sensory neuron-specific G-protein coupled receptor 5/6" EXACT []
synonym: "SNSR5" RELATED []
synonym: "SNSR6" RELATED []
is_a: PRO:000001608 ! mas-related G protein-coupled receptor X

[Term]
id: PRO:000001706
name: sphingosine 1-phosphate receptor 1
def: "A sphingosine 1-phosphate receptor 1-5 that is a translation product of the S1PR1 gene. The receptor is specifically expressed in endothelial cells, and to a lesser extent, in vascular smooth muscle cells, fibroblasts, melanocytes, and cells of epithelioid origin." [PRO:WCB, UniProtKB:P21453]
comment: Category=gene.
synonym: "EDG1" RELATED []
synonym: "Edg1" RELATED []
synonym: "Endothelial differentiation G-protein coupled receptor 1" EXACT []
synonym: "Lpb1" RELATED []
synonym: "Lysophospholipid receptor B1" EXACT []
synonym: "S1P receptor 1" EXACT []
synonym: "S1P receptor Edg-1" EXACT []
synonym: "S1P1" EXACT []
synonym: "S1pr1" RELATED []
synonym: "S1PR1" RELATED []
synonym: "Sphingosine 1-phosphate receptor 1" EXACT []
synonym: "Sphingosine 1-phosphate receptor Edg-1" EXACT []
is_a: PRO:000001673 ! sphingosine 1-phosphate receptor 1-5

[Term]
id: PRO:000001707
name: sphingosine 1-phosphate receptor 2
def: "A sphingosine 1-phosphate receptor 1-5 that is a translation product of the S1PR2 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Edg5" RELATED []
synonym: "EDG5" RELATED []
synonym: "Endothelial differentiation G-protein coupled receptor 5" EXACT []
synonym: "Gpcr13" RELATED []
synonym: "Lpb2" RELATED []
synonym: "Lysophospholipid receptor B2" EXACT []
synonym: "S1P receptor 2" EXACT []
synonym: "S1P receptor Edg-5" EXACT []
synonym: "S1P2" EXACT []
synonym: "S1pr2" RELATED []
synonym: "S1PR2" RELATED []
synonym: "Sphingosine 1-phosphate receptor 2" EXACT []
synonym: "Sphingosine 1-phosphate receptor Edg-5" EXACT []
is_a: PRO:000001673 ! sphingosine 1-phosphate receptor 1-5

[Term]
id: PRO:000001708
name: sphingosine 1-phosphate receptor 3
def: "A sphingosine 1-phosphate receptor 1-5 that is a translation product of the S1PR3 gene. It is expressed in all tissues, but most abundantly in heart, placenta, kidney, and liver." [PRO:WCB, UniProtKB:Q99500]
comment: Category=gene.
synonym: "Edg3" RELATED []
synonym: "EDG3" RELATED []
synonym: "Endothelial differentiation G-protein coupled receptor 3" EXACT []
synonym: "Lpb3" RELATED []
synonym: "Lysophospholipid receptor B3" EXACT []
synonym: "S1P receptor 3" EXACT []
synonym: "S1P receptor Edg-3" EXACT []
synonym: "S1P3" EXACT []
synonym: "S1pr3" RELATED []
synonym: "S1PR3" RELATED []
synonym: "Sphingosine 1-phosphate receptor 3" EXACT []
synonym: "Sphingosine 1-phosphate receptor Edg-3" EXACT []
is_a: PRO:000001673 ! sphingosine 1-phosphate receptor 1-5

[Term]
id: PRO:000001709
name: sphingosine 1-phosphate receptor 4
def: "A sphingosine 1-phosphate receptor 1-5 that is a translation product of the S1PR4 gene. This receptor is specifically expressed in fetal and adult lymphoid and hematopoietic tissue as well as in lung." [PRO:WCB, UniProtKB:O95977]
comment: Category=gene.
synonym: "EDG6" RELATED []
synonym: "Edg6" RELATED []
synonym: "Endothelial differentiation G-protein coupled receptor 6" EXACT []
synonym: "Lpc1" RELATED []
synonym: "Lysophospholipid receptor C1" EXACT []
synonym: "S1P receptor 4" EXACT []
synonym: "S1P receptor Edg-6" EXACT []
synonym: "S1p4" RELATED []
synonym: "S1pr4" RELATED []
synonym: "S1PR4" RELATED []
synonym: "Sphingosine 1-phosphate receptor 4" EXACT []
synonym: "Sphingosine 1-phosphate receptor Edg-6" EXACT []
is_a: PRO:000001673 ! sphingosine 1-phosphate receptor 1-5

[Term]
id: PRO:000001710
name: sphingosine 1-phosphate receptor 5
def: "A sphingosine 1-phosphate receptor 1-5 that is a translation product of the S1PR5 gene. Although widely expressed in the brain, most prominently in the corpus callosum, it is detected at a low level in most tissues." [PRO:WCB, UniProtKB:Q9H228]
comment: Category=gene.
synonym: "EDG8" RELATED []
synonym: "Edg8" RELATED []
synonym: "Endothelial differentiation G-protein-coupled receptor 8" EXACT []
synonym: "Lpb4" RELATED []
synonym: "Lysophospholipid receptor B4" EXACT []
synonym: "S1P receptor 5" EXACT []
synonym: "S1P receptor Edg-8" EXACT []
synonym: "S1P5" EXACT []
synonym: "S1pr5" RELATED []
synonym: "S1PR5" RELATED []
synonym: "Sphingosine 1-phosphate receptor 5" EXACT []
synonym: "Sphingosine 1-phosphate receptor Edg-8" EXACT []
is_a: PRO:000001673 ! sphingosine 1-phosphate receptor 1-5

[Term]
id: PRO:000001711
name: trace amine associated receptor 1
def: "A trace amine associated receptor 1-4 that is a translation product of the TAAR1 gene. The preferred ligands of the human protein are trace amines, including beta-phenylethylamine, p-tyramine, octopamine and tryptamine. It is unresponsive to amines such as epinephrine and histamine and only partially activated by dopamine and serotonine." [PRO:WCB, UniProtKB:Q96RJ0]
comment: Category=gene.
synonym: "Ta1" RELATED []
synonym: "TA1" RELATED []
synonym: "Taar1" RELATED []
synonym: "TAAR1" RELATED []
synonym: "TaR-1" EXACT []
synonym: "TAR1" RELATED []
synonym: "Tar1" RELATED []
synonym: "Trace amine receptor 1" EXACT []
synonym: "Trace amine-associated receptor 1" EXACT []
synonym: "TRAR1" RELATED []
synonym: "Trar1" RELATED []
is_a: PRO:000001678 ! trace amine associated receptor 1-4

[Term]
id: PRO:000001712
name: trace amine associated receptor 2
def: "A trace amine associated receptor 1-4 that is a translation product of the TAAR2 gene. It is currently classed as an orphan receptor." [PRO:WCB]
comment: Category=gene.
synonym: "G-protein coupled receptor 58" EXACT []
synonym: "Gm225" RELATED []
synonym: "GPR58" RELATED []
synonym: "Gpr58" RELATED []
synonym: "TAAR2" RELATED []
synonym: "Taar2" RELATED []
synonym: "Trace amine-associated receptor 2" EXACT []
is_a: PRO:000001678 ! trace amine associated receptor 1-4

[Term]
id: PRO:000001713
name: trace amine associated receptor 3
def: "A trace amine associated receptor 1-4 that is a translation product of the TAAR3 gene. It is currently classed as an orphan receptor. The human protein is expressed but is probably not functional due to a frameshift mutation." [PRO:WCB, UniProtKB:Q9P1P4]
comment: Category=gene.
synonym: "G-protein coupled receptor 57" EXACT []
synonym: "GPR57" RELATED []
synonym: "Putative trace amine-associated receptor 3" EXACT []
synonym: "Taar3" RELATED []
synonym: "TAAR3" RELATED []
synonym: "Trace amine-associated receptor 3" EXACT []
is_a: PRO:000001678 ! trace amine associated receptor 1-4

[Term]
id: PRO:000001714
name: trace amine associated receptor 4
def: "A trace amine associated receptor 1-4 that is a translation product of the TAAR4 gene. It is currently classed as an orphan receptor. The preferred ligands of the rat protein are beta-phenylethylamine and tryptamine. The corresponding human gene, TAAR4P, is non-functional." [PRO:WCB, PubMEd:11459929]
comment: Category=gene.
synonym: "Gm226" RELATED []
synonym: "Taar4" RELATED []
synonym: "Trace amine-associated receptor 4" EXACT []
is_a: PRO:000001678 ! trace amine associated receptor 1-4

[Term]
id: PRO:000001715
name: trace amine associated receptor 6
def: "A trace amine associated receptor 6-9 that is a translation product of the TAAR6 gene. It is currently classed as an orphan receptor." [PRO:WCB]
comment: Category=gene.
synonym: "Gm228" RELATED []
synonym: "TA4" RELATED []
synonym: "TAAR6" RELATED []
synonym: "Taar6" RELATED []
synonym: "TaR-4" EXACT []
synonym: "TAR4" RELATED []
synonym: "Trace amine receptor 4" EXACT []
synonym: "Trace amine-associated receptor 6" EXACT []
synonym: "TRAR4" RELATED []
is_a: PRO:000001680 ! trace amine associated receptor 6-9

[Term]
id: PRO:000001716
name: trace amine associated receptor 7
def: "A trace amine associated receptor 6-9 that is a translation product of the TAAR7 related genes (TAAR7A-F). There have been independent lineage-specific expansions of the TAAR7 gene in rat and mouse. It is a pseudogene in human. They are orphan receptors." [PRO:WCB]
comment: Category=gene.
synonym: "Gm229" RELATED []
synonym: "Gm697" RELATED []
synonym: "Gm698" RELATED []
synonym: "Taar7a" RELATED []
synonym: "Taar7b" RELATED []
synonym: "Taar7d" RELATED []
synonym: "Taar7e" RELATED []
synonym: "Taar7f" RELATED []
synonym: "trace amine associated receptor 7a" EXACT []
synonym: "trace amine associated receptor 7b" EXACT []
synonym: "trace amine associated receptor 7d" EXACT []
synonym: "trace amine associated receptor 7e" EXACT []
synonym: "trace amine associated receptor 7f" EXACT []
is_a: PRO:000001680 ! trace amine associated receptor 6-9

[Term]
id: PRO:000001717
name: trace amine associated receptor 8
def: "A trace amine associated receptor 6-9 that is a translation product of a gene corresponding to the human TAAR8 gene. There have been independent lineage-specific expansions of this gene in rat and mouse. They are orphan receptors." [PRO:WCB]
comment: Category=gene.
synonym: "G-protein coupled receptor 102" EXACT []
synonym: "Gm1149" RELATED []
synonym: "Gm230" RELATED []
synonym: "GPR102" RELATED []
synonym: "TA5" RELATED []
synonym: "TAAR8" RELATED []
synonym: "Taar8a" RELATED []
synonym: "Taar8b" RELATED []
synonym: "Taar8c" RELATED []
synonym: "TaR-5" EXACT []
synonym: "TAR5" RELATED []
synonym: "trace amine associated receptor 8a" EXACT []
synonym: "trace amine associated receptor 8c" EXACT []
synonym: "Trace amine receptor 5" EXACT []
synonym: "Trace amine-associated receptor 8" EXACT []
synonym: "Trace amine-associated receptor 8a" EXACT []
synonym: "Trace amine-associated receptor 8b" EXACT []
synonym: "Trace amine-associated receptor 8c" EXACT []
synonym: "TRAR5" RELATED []
is_a: PRO:000001680 ! trace amine associated receptor 6-9

[Term]
id: PRO:000001718
name: trace amine associated receptor 9
def: "A trace amine associated receptor 6-9 that is a translation product of the TAAR9 gene. It is currently classed as an orphan receptor." [PRO:WCB]
comment: Category=gene.
synonym: "TA3" RELATED []
synonym: "TAAR9" RELATED []
synonym: "Taar9" RELATED []
synonym: "TaR-3" EXACT []
synonym: "TAR3" RELATED []
synonym: "Trace amine receptor 3" EXACT []
synonym: "Trace amine-associated receptor 9" EXACT []
synonym: "TRAR3" RELATED []
synonym: "Trar3" RELATED []
is_a: PRO:000001680 ! trace amine associated receptor 6-9

[Term]
id: PRO:000001719
name: transient receptor potential cation channel TRPM8
def: "A protein that is a translation product of the TRPM8 gene. TRPM8 is a member of the subfamily M of the transient receptor potential cation channels (TRPs). In common with other TRPs, these proteins have amino- and carboxyl-terminal intracellular domains separated by a domain containing six transmembrane helices (S1-S6) in which the last two helices (S5 and S6) flank a loop, called the pore loop, which determines ion selectivity.\nTRPM8 forms a nonselective cation channel that is activated by cold and by menthol and other substances that produce the sensation of coolness. These channels exhibit voltage-dependance and regulation by phosphatidylinositol-4,5-bisphosphate (PIP2)." [PMID:15852009, PRO:CNA]
comment: Category=gene.
synonym: "Long transient receptor potential channel 6" EXACT []
synonym: "LTrpC6" EXACT []
synonym: "Transient receptor potential cation channel subfamily M member 8" EXACT []
synonym: "Transient receptor potential-p8" EXACT []
synonym: "Trp-p8" EXACT []
synonym: "Trpm8" RELATED []
synonym: "TRPP8" RELATED []
xref: PIRSF:PIRSF038526
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001720
name: transient receptor potential cation channel TRPM8 isoform 1
def: "A transient receptor potential cation channel TRPM8 that is a translation product of a mature transcript of the TRPM8 gene. Represented by the sequence UniProtKB:Q7Z2W7-1." [PRO:CNA]
comment: Category=sequence.
synonym: "Transient receptor potential cation channel subfamily M member 8 isoform 1" RELATED []
is_a: PRO:000001719 ! transient receptor potential cation channel TRPM8

[Term]
id: PRO:000001721
name: transient receptor potential cation channel TRPM8 isoform 2
def: "A transient receptor potential cation channel TRPM8 that is a translation product of a mature transcript of the TRPM8 gene. This protein has an alternative N-terminal sequence as compared to isoform 1, and is missing the transmembrane domain. Represented by the sequence UniProtKB:Q7Z2W7-2." [PRO:CNA]
comment: Category=sequence.
synonym: "isoform beta" RELATED []
synonym: "Transient receptor potential cation channel subfamily M member 8 isoform 2" RELATED []
synonym: "transient receptor potential cation channel TRPM8 isoform beta" EXACT []
is_a: PRO:000001719 ! transient receptor potential cation channel TRPM8

[Term]
id: PRO:000001722
name: transient receptor potential cation channel TRPM8 isoform 3
def: "A transient receptor potential cation channel TRPM8 that is a translation product of a mature transcript of the TRPM8 gene. Represented by the sequence UniProtKB:Q7Z2W7-3." [PRO:CNA]
comment: Category=sequence.
synonym: "isoform alpha" RELATED []
synonym: "Transient receptor potential cation channel subfamily M member 8 isoform 3" RELATED []
synonym: "transient receptor potential cation channel TRPM8 isoform alpha" EXACT []
is_a: PRO:000001719 ! transient receptor potential cation channel TRPM8

[Term]
id: PRO:000001723
name: transient receptor potential cation channel TRPM8 isoform 1 glycosylated form
def: "A transient receptor potential cation channel TRPM8 isoform 1 that has been post-translationally modified to include a glycosylated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000001720 ! transient receptor potential cation channel TRPM8 isoform 1
intersection_of: has_modification MOD:00693 ! glycosylated residue

[Term]
id: PRO:000001724
name: transient receptor potential cation channel TRPM8 isoform 1 glycosylated 1
def: "A transient receptor potential cation channel TRPM8 isoform 1 glycosylated form that has been glycosylated in the Asn consensus glycosylation site within the pore loop region. Example:UniProtKB:Q8R4D5-1, has_modification MOD:00160 N4-glycosyl-L-asparagine, Asn-934." [PMID:17015441]
comment: Category=modification.
is_a: PRO:000001723 ! transient receptor potential cation channel TRPM8 isoform 1 glycosylated form

[Term]
id: PRO:000001725
name: transient receptor potential cation channel TRPC2
def: "A transient receptor potential cation channel TRPC that is a translation product of the TRPC2 gene. It mediates both receptor- and store depletion-triggered calcium entry. It plays an important role in the transduction machinery underlying the detection of pheromone signals by the vomeronasal organ (VNO), a part of the accessory olfactory system." [PMID:15971083, PMID:17217050]
comment: Category=gene.
synonym: "Short transient receptor potential channel 2" EXACT []
synonym: "Transient receptor protein 2" EXACT []
synonym: "TRP-2" EXACT []
xref: PIRSF:PIRSF501000
is_a: PRO:000000680 ! transient receptor potential cation channel TRPC

[Term]
id: PRO:000001726
name: transient receptor potential cation channel TRPC2 isoform 1
def: "A transient receptor potential cation channel TRPM8 that is a translation product of a mature transcript of the TRPC2 gene. Represented by the sequence UniProtKB:Q9R244-1." [PRO:CNA]
comment: Category=sequence.
synonym: "isoform A" RELATED []
is_a: PRO:000001725 ! transient receptor potential cation channel TRPC2

[Term]
id: PRO:000001727
name: transient receptor potential cation channel TRPC2 isoform 2
def: "A transient receptor potential cation channel TRPM8 that is a translation product of a mature transcript of the TRPC2 gene. Represented by the sequence UniProtKB:Q9R244-2." [PRO:CNA]
comment: Category=sequence.
synonym: "isoform B" RELATED []
is_a: PRO:000001725 ! transient receptor potential cation channel TRPC2

[Term]
id: PRO:000001728
name: transient receptor potential cation channel TRPC2 isoform 3
def: "A transient receptor potential cation channel TRPM8 that is a translation product of a mature transcript of the TRPC2 gene. Represented by the sequence UniProtKB:Q9R244-3." [PMID:10998353, PRO:CNA]
comment: Category=sequence.
synonym: "isoform alpha" RELATED []
synonym: "TRPC2alpha" RELATED []
is_a: PRO:000001725 ! transient receptor potential cation channel TRPC2

[Term]
id: PRO:000001729
name: transient receptor potential cation channel TRPC2 isoform 4
def: "A transient receptor potential cation channel TRPM8 that is a translation product of a mature transcript of the TRPC2 gene. Represented by the sequence UniProtKB:Q9R244-4." [PMID:10998353, PRO:CNA]
comment: Category=sequence.
synonym: "TRPC2beta" RELATED []
is_a: PRO:000001725 ! transient receptor potential cation channel TRPC2

[Term]
id: PRO:000001730
name: inhibin alpha chain
def: "A TGF-beta-like cystine-knot cytokine that is a translation product of the INHA gene." [PRO:CNA]
comment: Category=gene.
synonym: "INHA" RELATED []
synonym: "inhibin alpha chain" EXACT []
xref: PIRSF:PIRSF037328
is_a: PRO:000000008 ! TGF-beta-like cystine-knot cytokine

[Term]
id: PRO:000001731
name: inhibin alpha chain isoform 1
def: "An inhibin alpha chain that is a translation product of a mature transcript of the INHA gene. Represented by the sequence UniProtKB:P05111-1." [PRO:CNA]
comment: Category=sequence.
synonym: "inhibin alpha precursor" EXACT []
is_a: PRO:000001730 ! inhibin alpha chain

[Term]
id: PRO:000001732
name: inhibin alpha chain isoform 1 cleaved and glycosylated form
def: "An inhibin alpha chain isoform 1 that has been processed by proteolytic cleavage and has been post-translationally modified to include glycosylated residues." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000001731 ! inhibin alpha chain isoform 1
intersection_of: has_modification MOD:00693 ! glycosylated residue
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000001733
name: inhibin alpha chain isoform 1 cleaved and glycosylated 2
def: "An inhibin alpha chain isoform 1 cleaved form that has been processed to the mature peptide by removal of the signal peptide, subsequent release of the propeptide and glycosylated at Asn residues within the two consensus glycosylation sites. Glycosylation favors formation of the inhibin A complex." [PMID:17456790, PMID:8885240]
comment: Category=modification.
synonym: "inhibin alpha mature peptide" RELATED []
synonym: "mature alphaC protein " RELATED []
is_a: PRO:000001732 ! inhibin alpha chain isoform 1 cleaved and glycosylated form

[Term]
id: PRO:000001734
name: inhibin alpha chain isoform 1 cleaved form
def: "An inhibin alpha chain isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000001731 ! inhibin alpha chain isoform 1
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000001735
name: inhibin alpha chain isoform 1 cleaved 1
def: "An inhibin alpha chain isoform 1 cleaved form that has been processed to the mature peptide by removal of the signal peptide, subsequent release of the propeptide." [PMID:8885240]
comment: Category=modification.
synonym: "inhibin alpha mature peptide" RELATED []
is_a: PRO:000001734 ! inhibin alpha chain isoform 1 cleaved form

[Term]
id: PRO:000001736
name: inhibin alpha chain isoform 1 cleaved and glycosylated 1
def: "An inhibin alpha chain isoform 1 cleaved form that has been processed to the mature peptide by removal of the signal peptide, subsequent release of the propeptide and glycosylated at an Asn residues within the first (or unique) consensus glycosylation site. Glycosylation favors formation of the inhibin A complex." [PMID:17456790]
comment: Category=modification.
synonym: "mature alphaC protein" RELATED []
is_a: PRO:000001732 ! inhibin alpha chain isoform 1 cleaved and glycosylated form

[Term]
id: PRO:000001737
name: inhibin alpha chain isoform 1 glycosylated form
def: "An inhibin alpha chain isoform 1 that has been post-translationally modified to include glycosylated residues." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000001731 ! inhibin alpha chain isoform 1
intersection_of: has_modification MOD:00693 ! glycosylated residue

[Term]
id: PRO:000001738
name: inhibin alpha chain isoform 1 glycosylated 1
def: "An inhibin alpha chain isoform 1 glycosylated form that is glycosylated at the Asn residue within the conserved glycosylation consensus site within the alphan N-terminal region, and in the first (or unique) consensus glycosylation site in the alpha C-terminal region. This is a glycosylated precursor for the mature inhibin alpha." [PMID:17456790]
comment: Category=modification.
synonym: "pro-alphaN-aphaC" RELATED []
is_a: PRO:000001737 ! inhibin alpha chain isoform 1 glycosylated form

[Term]
id: PRO:000001739
name: inhibin alpha chain isoform 1 glycosylated 2
def: "An inhibin alpha chain isoform 1 glycosylated form that is glycosylated at the Asn residue located in the conserved glycosylation consensus site within the alphan N-terminal region, and at the Asn residues within the two consensus glycosylation sites within the alpha C-terminal region. This is a glycosylated precursor for the mature inhibin alpha." [PMID:17456790]
comment: Category=modification.
is_a: PRO:000001737 ! inhibin alpha chain isoform 1 glycosylated form

[Term]
id: PRO:000001740
name: myeloid differentiation primary response protein MyD88
def: "A protein that is a translation product of the MYD88 gene. This protein is an adapter involved in the Toll-like receptor and IL-1 receptor signaling pathway in the innate immune response." [PMID:9575168, PRO:CNA]
comment: Category=gene.
synonym: "MYD88" RELATED []
xref: PIRSF:PIRSF037756
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001741
name: myeloid differentiation primary response protein MyD88 isoform 1
def: "A myeloid differentiation primary response protein MyD88 that is a translation product of a mature transcript of the MYD88 gene. Represented by the sequence UniProtKB:Q99836-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000001740 ! myeloid differentiation primary response protein MyD88

[Term]
id: PRO:000001742
name: myeloid differentiation primary response protein MyD88 variant 1
def: "A myeloid differentiation primary response protein MyD88 that is a translation product of the MYD88 gene that has a Pro residue at the position equivalent to Leu-93 in the human sequence UniProtKB:Q99836-1. This residue is located within the Death domain. Results in a loss of function." [PMID:18669862]
comment: Category=sequence.
is_a: PRO:000001740 ! myeloid differentiation primary response protein MyD88

[Term]
id: PRO:000001743
name: myeloid differentiation primary response protein MyD88 variant 2
def: "A myeloid differentiation primary response protein MyD88 that is a translation product of the MYD88 gene that has a Cys residue at the position equivalent to Arg-196 in the human sequence UniProtKB:Q99836-1. This residue is located within the TIR domain. Results in a loss of function." [PMID:18669862]
comment: Category=sequence.
is_a: PRO:000001740 ! myeloid differentiation primary response protein MyD88

[Term]
id: PRO:000001744
name: translocation-associated membrane protein
def: "A protein with core architecture consisting of an N-terminal TRAM-1 like domain (PF08390) and a C-terminal TLC domain (PF03798). Members of this class function as adaptors in Toll-like receptor signaling." [PMID:17449723, PMID:18706831]
comment: Category=family.
synonym: "TRAM" EXACT []
xref: PIRSF:PIRSF005449
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001745
name: translocation-associated membrane protein 1
def: "A translocation-associated membrane protein that is a translation product of the TRAM1 gene." [PRO:CNA]
comment: Category=gene.
synonym: "TRAM" RELATED []
synonym: "TRAM1" RELATED []
is_a: PRO:000001744 ! translocation-associated membrane protein

[Term]
id: PRO:000001746
name: translocation-associated membrane protein 2
def: "A translocation-associated membrane protein that is a translation product of the TRAM2 gene." [PRO:CNA]
comment: Category=gene.
synonym: "TRAM2" RELATED []
is_a: PRO:000001744 ! translocation-associated membrane protein

[Term]
id: PRO:000001747
name: translocation-associated membrane protein 1 isoform 1
def: "A translocation-associated membrane protein 1 that is a translation product of a mature transcript of the TRAM1 gene. Represented by the sequence UniProtKB:Q91V04-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000001745 ! translocation-associated membrane protein 1

[Term]
id: PRO:000001748
name: translocation-associated membrane protein 2 isoform 1
def: "A translocation-associated membrane protein 2 that is a translation product of a mature transcript of the TRAM2 gene. Represented by the sequence UniProtKB:Q924Z5-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000001746 ! translocation-associated membrane protein 2

[Term]
id: PRO:000001749
name: TIR domain-containing adapter molecule
def: "A protein that is a translation product of the TICAM1 gene." [PRO:CNA]
comment: Category=gene.
synonym: "TICAM-1" EXACT []
synonym: "TICAM1" RELATED []
synonym: "toll-interleukin I receptor domain-containing adaptor protein" EXACT []
xref: PIRSF:PIRSF037744
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001750
name: TIR domain-containing adapter molecule 2
def: "A protein that is a translation product of the TICAM2 gene." [PRO:CNA]
comment: Category=gene.
synonym: "putative NF-kappa-B-activating protein 502" EXACT []
synonym: "TICAM-2" EXACT []
synonym: "TICAM2" RELATED []
synonym: "TIR domain-containing adapter molecule 2" EXACT []
synonym: "TIR domain-containing adapter protein TICAM-2" EXACT []
synonym: "TIRAP3" RELATED []
synonym: "TIRP" RELATED []
synonym: "Toll-like receptor adaptor protein 3" EXACT []
synonym: "Toll/interleukin-1 receptor domain-containing protein" EXACT []
synonym: "TRAM" RELATED []
synonym: "TRIF-related adapter molecule" EXACT []
xref: PIRSF:PIRSF037745
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001751
name: toll/interleukin-1 receptor domain-containing adapter protein
def: "A protein that is a translation product of the TIRAP gene." [PRO:CNA]
comment: Category=gene.
synonym: "adaptor protein Wyatt" EXACT []
synonym: "MAL" RELATED []
synonym: "MyD88 adapter-like protein" EXACT []
synonym: "TIR domain-containing adapter protein" RELATED []
synonym: "TIRAP" RELATED []
synonym: "toll/interleukin-1 receptor domain-containing adapter protein" EXACT []
xref: PIRSF:PIRSF037750
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001752
name: NF-kappa-B essential modulator
def: "A protein that is a translation product of the IKBKG gene. In response to a large variety of stimuli, among them pro-inflammatory cytokines, growth factors and microbial pathogens, signals emanating from cell surface receptors converge at the IkappaB kinase (IKK) complex. This complex is composed of four subunits, IKKalpha, IKKbeta, ELK, and NEMO. IKKbeta and NEMO subunits are known to be essential for activating NF-kappaB. Activation of NF-kappaB dimers is the result of IKK-mediated, phosphorylation-induced degradation of the IkappaB inhibitor, which enables the NF-kappaB dimers to enter the nucleus and activate specific target gene expression." [PIRSF:PIRSF038160]
comment: Category=gene.
synonym: "FIP-3" EXACT []
synonym: "FIP3" RELATED []
synonym: "I-kappa-B kinase gamma" EXACT []
synonym: "IkB kinase subunit gamma" EXACT []
synonym: "IkB kinase-associated protein 1" EXACT []
synonym: "IKK-gamma" EXACT []
synonym: "IKKAP1" EXACT []
synonym: "IKKG" EXACT []
synonym: "Inhibitor of nuclear factor kappa-B kinase subunit gamma" EXACT []
synonym: "NEMO" EXACT []
synonym: "NF-kappa-B essential modifier" EXACT []
synonym: "NF-kappa-B essential modulator" EXACT []
xref: PIRSF:PIRSF038160
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001753
name: transcription factor NF-kappa-B
def: "A protein with a core domain composition consisting of a Rel homology domain (RHD) (PF00554), an IPT/TIG domain (PF01833), six copies of the Ankyrin repeat (PF00023), a Death domain (PF00531) and a C-terminal PEST region." [PRO:JAN]
comment: Category=family.
xref: PIRSF:PIRSF036310
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001754
name: nuclear factor NF-kappa-B p105 subunit
def: "A transcription factor NF-kappa-B that is a translation product of the NFKB1 gene. NF-kappa-B is a pleiotropic transcription factor which is present in almost all cell types and is involved in many biological processed such as inflammation, immunity, differentiation, cell growth, tumorigenesis and apoptosis." [PMID:15485931, PRO:JAN]
comment: Category=gene.
synonym: "DNA-binding factor KBF1" EXACT []
synonym: "DNF-kappa-B1 p84/NF-kappa-B1 p98" RELATED []
synonym: "EBP-1" EXACT []
synonym: "NF-kappa B1/p105" EXACT []
is_a: PRO:000001753 ! transcription factor NF-kappa-B

[Term]
id: PRO:000001755
name: nuclear factor NF-kappa-B p105 subunit isoform 1
def: "A nuclear factor NF-kappa-B p105 subunit protein that is a translation product of a matured transcript of the NFKB1 gene represented by the sequence UniprotKB:P25799-1." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000001754 ! nuclear factor NF-kappa-B p105 subunit

[Term]
id: PRO:000001756
name: nuclear factor NF-kappa-B p105 subunit isoform 1 cleaved form
def: "A nuclear factor NF-kappa-B p105 subunit isoform 1 that has been processed by proteolytic cleavage." [PRO:JAN]
comment: Category=modification.
intersection_of: PRO:000001755 ! nuclear factor NF-kappa-B p105 subunit isoform 1
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000001757
name: nuclear factor NF-kappa-B p105 subunit isoform 1 cleaved 1
def: "A nuclear factor NF-kappa-B p105 subunit isoform 1 cleaved form that has been processed by proteolytic cleavage to release the C-terminal domain of p105 downstream the 23 residue, glycine rich region (GRR). GRR functions as a processing signal for the generation of p50." [PMID:8628291, PRO:JAN]
comment: Category=modification.
synonym: "NF-KAPPA-B P50" EXACT []
synonym: "NFKB1 p50" EXACT []
synonym: "p50" RELATED []
is_a: PRO:000001756 ! nuclear factor NF-kappa-B p105 subunit isoform 1 cleaved form

[Term]
id: PRO:000001758
name: nuclear factor NF-kappa-B p105 subunit isoform 2
def: "A nuclear factor NF-kappa-B p105 subunit protein that is a translation product of a matured transcript of the NFKB1 gene represented by the sequence UniprotKB:P19838-1." [PMID:1992489]
comment: Category=sequence.
is_a: PRO:000001754 ! nuclear factor NF-kappa-B p105 subunit

[Term]
id: PRO:000001759
name: nuclear factor NF-kappa-B p105 subunit isoform 2 phosphorylated form
def: "A nuclear factor NF-kappa-B p105 subunit isoform 1 that has been post-translationally modified to include a phosphorylated residue." [PRO:JAN]
comment: Category=modification.
intersection_of: PRO:000001758 ! nuclear factor NF-kappa-B p105 subunit isoform 2
intersection_of: has_modification MOD:00696 ! phosphorylated residue

[Term]
id: PRO:000001760
name: nuclear factor NF-kappa-B p105 subunit isoform 2 phosphorylated 1
def: "A nuclear factor NF-kappa-B p105 subunit isoform 2 phosphorylated form that has been phosphorylated by GSK-3 beta which forms an in vivo complex with and specifically phosphorylates nuclear factor NF-kappa-B p105 subunit at two Ser residues in the C-terminal region contiguos to the Death domain. Phosphorylation by GSK-3 stabilizes the protein. Example: UniprotKB:P19838-1, Ser-903/Ser-907, MOD:00046." [PMID:12871932, PRO:JAN]
comment: Category=modification. UniprotKB:P19838-1, Ser-903/Ser-907, MOD:00046, PMID:12871932.
is_a: PRO:000001759 ! nuclear factor NF-kappa-B p105 subunit isoform 2 phosphorylated form

[Term]
id: PRO:000001761
name: nuclear factor NF-kappa-B p105 subunit isoform 3
def: "A nuclear factor NF-kappa-B p105 subunit protein that is a translation product of a matured transcript of the NFKB1 gene represented by the human sequence UniprotKB:P19838-2." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000001754 ! nuclear factor NF-kappa-B p105 subunit

[Term]
id: PRO:000001762
name: nuclear factor NF-kappa-B p105 subunit isoform 2 phosphorylated 2
def: "A nuclear factor NF-kappa-B p105 subunit isoform 2 phosphorylated form that has been pre-phosphorylated by GSK-3 beta (PRO:000001760) followed by phosphorylation of the two Ser residues within the conserved motif DSGVETS in the PEST region. Phosphorylation occurs after the stimulation of cells with proinflammatory cytokines, such as tumor necrosis factor alpha or interleukin-1. This phosphorylation results in accelerated nuclear factor NF-kappa-B p105 degradation." [PMID:12482991, PMID:12871932]
comment: Category=modification. UniprotKB:P19838-1, Ser-903/Ser-907/Ser-927/Ser-932, MOD:00046, PMID:12871932|PMID:12482991.
is_a: PRO:000001759 ! nuclear factor NF-kappa-B p105 subunit isoform 2 phosphorylated form

[Term]
id: PRO:000001763
name: NF-kappa-B essential modulator isoform 1
def: "A NF-kappa-B essential modulator that is a translation product of a matured transcript of the IKBKG gene represented by the human sequence UniprotKB:Q9Y6K9-1." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000001752 ! NF-kappa-B essential modulator

[Term]
id: PRO:000001764
name: NF-kappa-B essential modulator isoform 1 phosphorylated and ubiquitinated form
def: "A NF-kappa-B essential modulator isoform 1 that has been post-translationally modified to include a phosphorylated residue and an ubiquitinated residue." [PRO:JAN]
comment: Category=modification.
is_a: PRO:000001763 ! NF-kappa-B essential modulator isoform 1

[Term]
id: PRO:000001765
name: NF-kappa-B essential modulator isoform 1 phosphorylated form
def: "A NF-kappa-B essential modulator isoform 1 that has been post-translationally modified to include a phosphorylated residue." [PRO:JAN]
comment: Category=modification.
is_a: PRO:000001763 ! NF-kappa-B essential modulator isoform 1

[Term]
id: PRO:000001766
name: NF-kappa-B essential modulator isoform 1 phosphorylated 1
def: "A NF-kappa-B essential modulator isoform 1 phosphorylated form that has been phosphorylated at two Ser residues within the IKK-binding region and at a Ser residue at the C-terminal region by activated IKK beta." [PMID:12657630, PRO:JAN]
comment: Category=modification.
is_a: PRO:000001765 ! NF-kappa-B essential modulator isoform 1 phosphorylated form

[Term]
id: PRO:000001767
name: NF-kappa-B essential modulator isoform 1 phosphorylated 2
def: "A NF-kappa-B essential modulator isoform 1 phosphorylated form that has been phosphorylated at a Ser residues of the IKK-binding region by acivated IKK beta." [PMID:17977820, PRO:JAN]
comment: Category=modification.
is_a: PRO:000001765 ! NF-kappa-B essential modulator isoform 1 phosphorylated form

[Term]
id: PRO:000001768
name: NF-kappa-B essential modulator isoform 1 phosphorylated 3
def: "A NF-kappa-B essential modulator isoform 1 phosphorylated form protein that has been phosphorylated at a Ser residue by genotoxic signals (through ATM). This phosphorylation promotes its ubiquitin-dependent nuclear export." [PMID:16497931]
comment: Category=modification.
is_a: PRO:000001765 ! NF-kappa-B essential modulator isoform 1 phosphorylated form

[Term]
id: PRO:000001769
name: mitogen-activated protein kinase kinase kinase 7-interacting protein 2/3
def: "A protein with core domain architecture consisting of an N-terminal CUE domain (PF02845) and a copy of the Zn-finger in Ran binding protein and others (PF00641) domain. TAB2 and TAB3 are receptors that bind preferentially to lysine-linked polyubiquitin chains through the Zn-finger domain." [PMID:15327770, PRO:CNA]
comment: Category=family.
xref: PIRSF:PIRSF038187
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001770
name: mitogen-activated protein kinase kinase kinase 7-interacting protein 1
def: "A protein that is a translation product of the MAP3K7IP1 gene. It contains a copy of the Protein phosphatase 2C (PF00481) domain." [PRO:CNA]
comment: Category=gene.
synonym: "MAP3K7IP1" RELATED []
synonym: "TAB1" RELATED []
synonym: "TAK1-binding protein 1" EXACT []
synonym: "TGF-beta-activated kinase 1-binding protein 1" EXACT []
xref: PIRSF:PIRSF038188
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001771
name: mitogen-activated protein kinase kinase kinase 7-interacting protein 2
def: "A mitogen-activated protein kinase kinase kinase 7-interacting protein 2/3 that is a translation product of the MAP3K7IP2 gene." [PRO:CNA]
comment: Category=gene.
synonym: "Map3k7ip2" RELATED []
synonym: "TAB2" EXACT []
synonym: "TAK1-binding protein 2" EXACT []
is_a: PRO:000001769 ! mitogen-activated protein kinase kinase kinase 7-interacting protein 2/3

[Term]
id: PRO:000001772
name: mitogen-activated protein kinase kinase kinase 7-interacting protein 3
def: "A mitogen-activated protein kinase kinase kinase 7-interacting protein 2/3 that is a translation product of the MAP3K7IP3 gene." [PRO:CNA]
comment: Category=gene.
synonym: "MAP3K7IP3" RELATED []
synonym: "NF-kappa-B-activating protein 1" EXACT []
synonym: "TAB3" EXACT []
synonym: "TAK1-binding protein 3" EXACT []
is_a: PRO:000001769 ! mitogen-activated protein kinase kinase kinase 7-interacting protein 2/3

[Term]
id: PRO:000001773
name: lipopolysaccharide-binding protein
def: "A protein that is a translation product of the LBP gene." [PRO:CNA]
comment: Category=gene.
synonym: "LBP" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001774
name: inhibitor of nuclear factor kappa-B kinase complex alpha/beta subunits
def: "A protein with core domain architecture consisting of an N-terminal Protein kinase domain (PF00069), and a C-terminus that is involved in the interaction with NEMO (PRO:000001752). In response to a large variety of stimuli, among them pro-inflammatory cytokines, growth factors and microbial pathogens, signals emanating from cell surface receptors converge at the IkappaB kinase (IKK) complex. This complex is composed of four subunits, IKKalpha, IKKbeta, ELK, and NEMO. IKKbeta and NEMO subunits are known to be essential for activating NF-kappaB. Activation of NF-kappaB dimers is the result of IKK-mediated, phosphorylation-induced degradation of the IkappaB inhibitor, which enables the NF-kappaB dimers to enter the nucleus and activate specific target gene expression." [PIRSF:PIRSF000581, PMID:10359587, PMID:18462684, PRO:CNA]
comment: Category=family.
xref: PIRSF:PIRSF000581
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001775
name: inhibitor of nuclear factor kappa-b kinase subunit alpha
def: "An inhibitor of nuclear factor kappa-B kinase complex alpha/beta subunits that is a translation product of the CHUK gene." [PRO:CNA]
comment: Category=gene.
synonym: "Chuk" RELATED []
synonym: "Conserved helix-loop-helix ubiquitous kinase" EXACT []
synonym: "I kappa-B kinase alpha" EXACT []
synonym: "I-kappa-B kinase 1" EXACT []
synonym: "IkappaB kinase" EXACT []
synonym: "IkBKA" EXACT []
synonym: "IKK-A" EXACT []
synonym: "IKK-alpha" EXACT []
synonym: "IKK1" EXACT []
synonym: "IKKA" RELATED []
synonym: "Inhibitor of nuclear factor kappa-B kinase subunit alpha" EXACT []
synonym: "NFKBIKA" EXACT []
synonym: "Nuclear factor NF-kappa-B inhibitor kinase alpha" EXACT []
synonym: "TFC16" RELATED []
is_a: PRO:000001774 ! inhibitor of nuclear factor kappa-B kinase complex alpha/beta subunits

[Term]
id: PRO:000001776
name: inhibitor of nuclear factor kappa-b kinase subunit beta
def: "An inhibitor of nuclear factor kappa-B kinase complex alpha/beta subunits that is a translation product of the IKBKB gene." [PRO:CNA]
comment: Category=gene.
synonym: "I-kappa-B kinase 2" EXACT []
synonym: "I-kappa-B-kinase beta" EXACT []
synonym: "IKBKB" RELATED []
synonym: "IkBKB" EXACT []
synonym: "IKK-B" EXACT []
synonym: "IKK-beta" EXACT []
synonym: "IKK2" EXACT []
synonym: "IKKB" RELATED []
synonym: "Inhibitor of nuclear factor kappa-B kinase subunit beta" EXACT []
synonym: "NFKBIKB" EXACT []
synonym: "Nuclear factor NF-kappa-B inhibitor kinase beta" EXACT []
is_a: PRO:000001774 ! inhibitor of nuclear factor kappa-B kinase complex alpha/beta subunits

[Term]
id: PRO:000001777
name: IKK-related kinase
def: "A protein with a core domain composition consisting of one copy of the Protein kinase domain (PF00069) at the N-terminus, and with average length of about 720 residues. Members of this class have essential roles in innate immunity through signal-induced activation of IRF3 and IRF7." [PMID:18353649, PRO:CNA]
comment: Category=family.
xref: PIRSF:PIRSF038348
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001778
name: inhibitor of nuclear factor kappa-b kinase subunit epsilon
def: "An IKK-related kinase that is a translation product of the IKBKE gene. Members of this class are part of the PMA-inducible IkappaB kinase complex." [PMID:10882136, PRO:CNA]
comment: Category=gene.
synonym: "I kappa-B kinase epsilon" EXACT []
synonym: "IkBKE" EXACT []
synonym: "IKK-E" EXACT []
synonym: "IKK-epsilon" EXACT []
synonym: "IKK-i" EXACT []
synonym: "IKKE" RELATED []
synonym: "Inducible I kappa-B kinase" EXACT []
is_a: PRO:000001777 ! IKK-related kinase

[Term]
id: PRO:000001779
name: serine/threonine-protein kinase tbk1
def: "An IKK-related kinase that is a translation product of the TBK1 gene." [PRO:CNA]
comment: Category=gene.
synonym: "NAK" RELATED []
synonym: "NF-kappa-B-activating kinase" RELATED []
synonym: "T2K" EXACT []
synonym: "TANK-binding kinase 1" EXACT []
synonym: "Tbk1" RELATED []
is_a: PRO:000001777 ! IKK-related kinase

[Term]
id: PRO:000001780
name: interleukin-1 receptor-associated kinase 4
def: "A protein that is a translation product of the IRAK4 gene. The archetypical form consists of an N-terminal Death domain (PF00531) and a C-terminal Protein kinase domain (PF00069). This protein is an essential component of innate immunity." [PMID:11960013, PMID:16177054, PRO:CNA]
comment: Category=gene.
synonym: "IRAK-4" EXACT []
synonym: "IRAK4" RELATED []
synonym: "NY-REN-64 antigen" EXACT []
xref: PANTHER:PTHR23258\:SF428
xref: PIRSF:PIRSF038189
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001781
name: interleukin-1 receptor-associated kinase IRAK1/3
def: "A protein with core domain architecture consisting of an N-terminal Death domain (PF00531) followed by a Protein kinase domain (PF00069). This class is closely related to IRAK-4 (PRO:000001780), but it contains an extra C-terminal region of about 200 residues." [PMID:12620219]
comment: Category=family.
synonym: "IRAK" RELATED []
xref: PIRSF:PIRSF038190
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001782
name: interleukin-1 receptor-associated kinase 1
def: "An interleukin-1 receptor-associated kinase IRAK1/3 that is a translation product of the IRAK1 gene." [PRO:CNA]
comment: Category=gene.
synonym: "IRAK-1" EXACT []
is_a: PRO:000001781 ! interleukin-1 receptor-associated kinase IRAK1/3

[Term]
id: PRO:000001783
name: interleukin-1 receptor-associated kinase-like 2
def: "An interleukin-1 receptor-associated kinase IRAK1/3 that is a translation product of the IRAK2 gene. This protein class is inactive as a kinase due to a change of an Asn instead of an Asp redisue in a catalytic site." [PMID:9374458, PRO:CNA]
comment: Category=gene.
synonym: "IRAK" RELATED []
synonym: "IRAK-2" EXACT []
is_a: PRO:000001781 ! interleukin-1 receptor-associated kinase IRAK1/3

[Term]
id: PRO:000001784
name: interleukin-1 receptor-associated kinase 3
def: "An interleukin-1 receptor-associated kinase IRAK1/3 that is a translation product of the IRAK3 gene." [PMID:12150927, PRO:CNA]
comment: Category=gene.
synonym: "IL-1 receptor-associated kinase M" EXACT []
synonym: "IRAK-M" EXACT []
synonym: "IRAK3" RELATED []
is_a: PRO:000001781 ! interleukin-1 receptor-associated kinase IRAK1/3

[Term]
id: PRO:000001785
name: prominin
def: "A protein with core architecture consisting of one Prominin (PF05478) domain. The prominins are an emerging family of proteins that, among the multispan membrane proteins, display a novel topology. Mouse and Homo sapiens prominin and prominin-like 1 are predicted to contain five membrane spanning domains, with an N-terminal domain exposed to the extracellular space followed by four, alternating small cytoplasmic and large extracellular, loops and a cytoplasmic C-terminal domain." [InterPro:IPR008795, PMID:11467842]
comment: Category=family.
xref: PANTHER:PTHR22730
xref: PIRSF:PIRSF017831
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001786
name: prominin-1
def: "A prominin that is a translation product of the PROM1 gene." [PRO:CNA]
comment: Category=gene.
synonym: "Antigen AC133" EXACT []
synonym: "Antigen AC133 homolog" EXACT []
synonym: "CD133" EXACT []
synonym: "Prominin-like protein 1" EXACT []
synonym: "Proml1" RELATED []
is_a: PRO:000001785 ! prominin

[Term]
id: PRO:000001787
name: prominin-1 isoform 1
def: "A prominin-1 that is a translation product of a mature transcript of the PROM1 gene. Represented by the sequence UniProtKB:O54990-1." [PRO:HJD]
comment: Category=sequence.
synonym: "prominin-1.s1 splice variant" RELATED []
is_a: PRO:000001786 ! prominin-1

[Term]
id: PRO:000001788
name: prominin-1 isoform 3
def: "A prominin-1 that is a translation product of a mature transcript of the PROM1 gene. Represented by the sequence UniProtKB:Q8BH12-1." [PMID:15316084, PRO:HJD]
comment: Category=sequence.
synonym: "prominin-1.s3 splice variant" EXACT []
is_a: PRO:000001786 ! prominin-1

[Term]
id: PRO:000001789
name: prominin-1 isoform 4
def: "A prominin-1 that is a translation product of a mature transcript of the PROM1 gene. Represented by the sequence UniProtKB:Q80XB3." [PMID:15316084, PRO:HJD]
comment: Category=sequence.
synonym: "prominin-1.s4 splice variant" EXACT []
is_a: PRO:000001786 ! prominin-1

[Term]
id: PRO:000001790
name: prominin-1 isoform 5
def: "A prominin-1 that is a translation product of a mature transcript of the PROM1 gene. Represented by the sequence UniProtKB:Q80XB2." [PMID:15316084, PRO:HJD]
comment: Category=sequence.
synonym: "prominin-1.s5 splice variant" EXACT []
is_a: PRO:000001786 ! prominin-1

[Term]
id: PRO:000001791
name: prominin-1 isoform 6
def: "A prominin-1 that is a translation product of a mature transcript of the PROM1 gene. Represented by the sequence UniProtKB:Q80XB6." [PMID:15316084, PRO:HJD]
comment: Category=sequence.
synonym: "prominin-1.s6 splice variant" EXACT []
is_a: PRO:000001786 ! prominin-1

[Term]
id: PRO:000001792
name: prominin-1 isoform 6 glycosylated form
def: "A prominin-1 isoform 6 that has been post-translationally modified to include an N-glycoslylated residue." [PRO:HJD]
comment: Category=modification.
intersection_of: PRO:000001791 ! prominin-1 isoform 6
intersection_of: has_modification MOD:00693 ! glycosylated residue

[Term]
id: PRO:000001793
name: prominin-1 isoform 3 glycosylated form
def: "A prominin-1 isoform 3 that has been post-translationally modified to include N-glycosylated residues." [PRO:HJD]
comment: Category=modification.
intersection_of: PRO:000001788 ! prominin-1 isoform 3
intersection_of: has_modification MOD:00693 ! glycosylated residue

[Term]
id: PRO:000001794
name: interleukin-6 receptor subunit alpha isoform 1
def: "An interleukin-6 receptor subunit alpha that is a translation product of a mature transcript of the IL6RA gene. Represented by the sequence UniProtKB:P22272-1." [PRO:HJD]
comment: Category=sequence.
is_a: PRO:000001394 ! interleukin-6 receptor subunit alpha

[Term]
id: PRO:000001795
name: interleukin-6 receptor subunit alpha isoform 2
def: "An interleukin-6 receptor subunit alpha that is a translation product of a mature transcript of the IL6RA gene. Represented by the sequence UniProtKB:P08887-1." [PRO:HJD]
comment: Category=sequence.
is_a: PRO:000001394 ! interleukin-6 receptor subunit alpha

[Term]
id: PRO:000001796
name: interleukin-6 receptor subunit alpha isoform 3
def: "An interleukin-6 receptor subunit alpha that is a translation product of a mature transcript of the IL6RA gene. Represented by the sequence UniProtKB:P08887-2." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000001394 ! interleukin-6 receptor subunit alpha

[Term]
id: PRO:000001797
name: interleukin-6 receptor subunit alpha isoform 1 cleaved form
def: "An interleukin-6 receptor subunit alpha isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000001794 ! interleukin-6 receptor subunit alpha isoform 1
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000001798
name: interleukin-6 receptor subunit alpha isoform 1 soluble form
def: "An interleukin-6 receptor subunit alpha isoform 1 cleaved form that has been post-translationally cleaved to release the extracellular domain into the extracellular space." [PMID:8477802, PRO:HJD]
comment: Category=modification.
synonym: "sIL-6R" EXACT []
is_a: PRO:000001797 ! interleukin-6 receptor subunit alpha isoform 1 cleaved form

[Term]
id: PRO:000001800
name: 5'-nucleotidase
def: "A protein that is a translation product of the NT5E gene." [PRO:WCB]
comment: Category=gene.
synonym: "5'-NT" EXACT []
synonym: "5'-nucleotidase" EXACT []
synonym: "CD73" EXACT []
synonym: "Ecto-5'-nucleotidase" EXACT []
synonym: "NTE" RELATED []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001801
name: C-C motif chemokine 25
def: "A protein that is a translation product of the CCL25 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CCL25" RELATED []
synonym: "Chemokine TECK" EXACT []
synonym: "Scya25" RELATED []
synonym: "Small-inducible cytokine A25" EXACT []
synonym: "Thymus-expressed chemokine" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001802
name: C-C motif chemokine 27
def: "A protein that is a translation product of the CCL27 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CC chemokine ILC" EXACT []
synonym: "CCL27" RELATED []
synonym: "CTACK" EXACT []
synonym: "Cutaneous T-cell-attracting chemokine" EXACT []
synonym: "ESkine" EXACT []
synonym: "IL-11 R-alpha-locus chemokine" EXACT []
synonym: "mILC" EXACT []
synonym: "SCYA27" RELATED []
synonym: "Skinkine" EXACT []
synonym: "Small-inducible cytokine A27" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001803
name: C-C motif chemokine 28
def: "A protein that is a translation product of the CCL28 gene." [PRO:WCB]
comment: Category=gene.
synonym: " CCL28" RELATED []
synonym: "MEC" EXACT []
synonym: "Mucosae-associated epithelial chemokine" EXACT []
synonym: "Protein CCK1" EXACT []
synonym: "Scya28" RELATED []
synonym: "Small-inducible cytokine A28" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001804
name: C-X-C motif chemokine 16
def: "A protein that is a translation product of the CXCL16 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CXCL16" RELATED []
synonym: "Scavenger receptor for phosphatidylserine and oxidized low density lipoprotein" EXACT []
synonym: "SCYB16" RELATED []
synonym: "Small-inducible cytokine B16" EXACT []
synonym: "SR-PSOX" EXACT []
synonym: "SRPSOX" RELATED []
synonym: "Transmembrane chemokine CXCL16" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001805
name: C-X-C motif chemokine 17
def: "A protein that is a translation product of the CXCL17 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CXCL17" RELATED []
synonym: "Dendritic cell and monocyte chemokine-like protein" EXACT []
synonym: "DMC" EXACT []
synonym: "Vcc1" RELATED []
synonym: "VEGF co-regulated chemokine 1" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001806
name: C-type lectin domain family 6 member A
def: "A protein that is a translation product of the CLEC6A gene." [PRO:WCB]
comment: Category=gene.
synonym: "C-type lectin superfamily member 10" EXACT []
synonym: "Clec4n" RELATED []
synonym: "CLEC6A" RELATED []
synonym: "Clecsf10" RELATED []
synonym: "DC-associated C-type lectin 2" EXACT []
synonym: "Dectin-2" EXACT []
synonym: "Dectin2" RELATED []
synonym: "Dendritic cell-associated lectin 2" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001807
name: C-type lectin domain family 7 member A
def: "A protein that is a translation product of the CLEC7A gene." [PRO:WCB]
comment: Category=gene.
synonym: "Beta-glucan receptor" EXACT []
synonym: "Bgr" RELATED []
synonym: "C-type lectin superfamily member 12" EXACT []
synonym: "CLEC7A" RELATED []
synonym: "Clecsf12" RELATED []
synonym: "DC-associated C-type lectin 1" EXACT []
synonym: "Dectin-1" EXACT []
synonym: "Dectin1" RELATED []
synonym: "Dendritic cell-associated C-type lectin 1" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001808
name: C/C-C motif small inducible chemokine
def: "A protein with core architecture consisting of a Small cytokines (intecrine/chemokine), interleukin-8 like (PF00048) domain." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF001950
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001809
name: CD59 glycoprotein
def: "A protein that is a translation product of the CD59 or closely related gene. This gene is present as a single copy in human and has undergone a lineage-specific duplication in mouse. CD59 antigen has a core architecture consisting of one UPAR/Ly-6 domain (PF00021), a small domain of about 70 amino acids and containing 5 conserved disulfide bonds. It is both N- and O-glycosylated and is a GPI-anchored protein that releases soluble forms in some tissues." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF038782
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001810
name: CSF-1/PDGF receptor-type tyrosine-protein kinase
def: "A protein with core architecture consisting of asignal sequence, 5 Ig-like domains, followed by a transmembrane sequence, followed by a Protein tyrosine kinase domain (PF07714). However, only 1-3 of the Ig domains are detected by the Pfam HMMs in most of the sequences. PF00047 is most common, but other members of the Ig domain clan, PF07679 and PF07686 can be identified instead. The fourth Ig domain lacks the disulfide-bonded cysteines." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF000615
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001811
name: DNA-binding protein ikaros
def: "An ikaros-like zinc finger transcription factor that is a translation product of the IKZF1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "IK1" RELATED []
synonym: "Ikaros family zinc finger protein 1" EXACT []
synonym: "IKZF1" RELATED []
synonym: "Lyf1" RELATED []
synonym: "Lymphoid transcription factor LyF-1" EXACT []
synonym: "Zfpn1a1" RELATED []
synonym: "Znfn1a1" RELATED []
is_a: PRO:000002986 ! ikaros-like zinc finger transcription factor

[Term]
id: PRO:000001812
name: EGF receptor type tyrosine-protein kinase
def: "A protein with core architecture consisting of a signal sequence, a Receptor L domain (PF01030), a Furin-like cysteine rich region (PF00757), another Receptor L domain, a transmembrane domain, and a Protein tyrosine kinase domain (PF07714), that may be followed by up to two YLP motifs (PF02757)." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF000619
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001813
name: EGF-like module-containing mucin-like hormone receptor-like 1
def: "A protein that is a translation product of the EMR1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Cell surface glycoprotein EMR1" EXACT []
synonym: "Cell surface glycoprotein F4/80" EXACT []
synonym: "EGF-like module-containing mucin-like hormone receptor-like 1" EXACT []
synonym: "EMR1" RELATED []
synonym: "EMR1 hormone receptor" EXACT []
synonym: "Gpf480" RELATED []
synonym: "TM7LN3" RELATED []
xref: PIRSF:PIRSF038685
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001814
name: G protein-activated inward rectifier potassium channel
def: "A protein with core architecture consisting of an Inward rectifier potassium channel domain (PF01007), which may be preceeded by an Inward rectifier potassium channel N-terminal domain (PF08466)." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF005465
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001815
name: GPI-linked NAD(P)(+)--arginine ADP-ribosyltransferase 1
def: "A NAD(P)(+)--arginine ADP-ribosyltransferase that is a translation product of the ART1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "ART1" RELATED []
synonym: "Art2" RELATED []
synonym: "CD296" EXACT []
synonym: "gpi-linked nad(p)(+)--arginine adp-ribosyltransferase 1" EXACT []
synonym: "Mono(ADP-ribosyl)transferase" EXACT []
synonym: "YAC-1" EXACT []
xref: PIRSF:PIRSF501089
is_a: PRO:000002156 ! NAD(P)+--arginine ADP-ribosyltransferase

[Term]
id: PRO:000001816
name: HGF/MSP receptor type tyrosine-protein kinase
def: "A protein with core architecture consisting of a signal sequence, followed by a Sema domain (PF01403), three IPT/TIG domains (PF01833), a transmembrane region, and a Protein tyrosine kinase domain (PF07714)." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF000617
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001817
name: LDL receptor-related protein
def: "A protein with core architecture containing 31-36 copies of Low-density lipoprotein receptor domain class A (PF0057), 34-37 copies of Low-density lipoprotein receptor repeat class B (PF00058), and 14-22 copies EGF-like domains (PF07974, PF00008, or PF07645)." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF001963
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001818
name: MHC class I histocompatibility antigen alpha chain
def: "A protein with core architecture consisting of an extracellular region with Class I Histocompatibility antigen, domains alpha 1 and alpha two (PF00129) and an Immunoglobulin C1-set domain (PF07654), a single-pass transmembrane region, and a cytoplasmic region containing the MHC_I C-terminus (PF06623). There are three major and three minor class I MHC (major histocompatability complex) alpha chain genes in humans. Designations for the MHC complex loci are species specific: HLA (human leukocyte antigen) in human, H-2 in mouse. MHC class I loci are characterized by large numbers of allelic variants. Human and mouse genes for MHC class I histocompatibility antigen alpha chains represent independent lineage-specific expansions. MHC class I histocompatibility antigen alpha chains associate with beta-2 microglobulin to form the heterodimeric MHC antigens." [PRO:WCB, Wikipedia:Human_leukocyte_antigen]
comment: Category=family.
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001819
name: MHC class I-related gene protein
def: "A protein that is a translation product of the MR1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Class I histocompatibility antigen-like protein" EXACT []
synonym: "major histocompatibility complex class i-related gene protein" EXACT []
synonym: "MHC class-I related-gene protein" EXACT []
synonym: "Mr1a" RELATED []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001820
name: MHC class II histocompatibility antigen alpha chain
def: "A protein with core architecture consisting of a signal sequence, a Class II histocompatibility antigen, an alpha domain (PF00993) and an Immunoglobulin C1-set domain (PF07654); these form the extracellular domain and are followed by a single-pass transmembrane region and a small cytoplasmic region. There are three major and two minor class II MHC (major histocompatability complex) alpha chain genes in humans. Designations for the MHC complex loci are species specific: HLA (human leukocyte antigen) in human, H-2 in mouse. MHC class II loci are characterized by large numbers of allelic variants. In contrast to MHC Class I alpha chain genes, orthologies can be seem between some human and mouse genes. MHC class II alpha chains form heterodimers with MHLC class II beta chains." [PRO:WCB, Wikipedia:Human_leukocyte_antigen]
comment: Category=family.
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001821
name: MHC class II histocompatibility antigen beta chain
def: "A protein with core architecture consisting of a signal sequence, a Class II histocompatibility antigen, a beta domain (PF00969) and an Immunoglobulin C1-set domain (PF07654); these form the extracellular domain and are followed by a single-pass transmembrane region and a small cytoplasmic region. There are three major and two minor class II MHC (major histocompatability complex) beta chain genes in humans. Designations for the MHC complex loci are species specific: HLA (human leukocyte antigen) in human, H-2 in mouse. MHC class II loci are characterized by large numbers of allelic variants." [PRO:WCB, Wikipedia:Human_leukocyte_antigen]
comment: Category=family.
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001822
name: MHC class II histocompatibility antigen gamma chain
def: "A protein that is a translation product of the CD74 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD74" RELATED []
synonym: "class II histocompatibility antigen gamma chain" EXACT []
synonym: "DHLAG" RELATED []
synonym: "HLA class II histocompatibility antigen gamma chain" EXACT []
synonym: "HLA-DR antigens-associated invariant chain" EXACT []
synonym: "Ia antigen-associated invariant chain" EXACT []
synonym: "MHC class II-associated invariant chain" EXACT []
synonym: "p33" EXACT []
xref: PIRSF:PIRSF001992
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001823
name: MHC class II transactivator
def: "A protein that is a translation product of the CIITA gene." [PRO:WCB]
comment: Category=gene.
synonym: "MHC2TA" RELATED []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001824
name: NADPH oxidase 1
def: "A protein that is a translation product of the NOX1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Mitogenic oxidase 1" EXACT []
synonym: "MOX1" EXACT []
synonym: "NADH/NADPH mitogenic oxidase subunit P65-MOX" EXACT []
synonym: "NOH-1" EXACT []
synonym: "NOH1" RELATED []
synonym: "NOX-1" EXACT []
synonym: "NOX1" RELATED []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001825
name: NADPH oxidase 3
def: "A protein that is a translation product of the NOX3 gene." [PRO:WCB]
comment: Category=gene.
synonym: "GP91-3" EXACT []
synonym: "gp91phox homolog 3" EXACT []
synonym: "Mitogenic oxidase 2" EXACT []
synonym: "MOX2" RELATED []
synonym: "NOX3" RELATED []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001826
name: NADPH oxidase 4
def: "A protein that is a translation product of the NOX4 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Kidney superoxide-producing NADPH oxidase" EXACT []
synonym: "Kox-1" EXACT []
synonym: "NOX4" RELATED []
synonym: "Renal NAD(P)H-oxidase" EXACT []
synonym: "Renox" RELATED []
synonym: "Superoxide-generating NADPH oxidase 4" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001827
name: NADPH oxidase 5
def: "A protein that is a translation product of the NOX5 gene. Though present in other mammals and even in chicken, this protein has not been found in mouse." [PRO:WCB]
comment: Category=gene.
synonym: "NOX5" RELATED []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001828
name: NKG2-D type II integral membrane protein
def: "A protein that is a translation product of the KLRK1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD314" EXACT []
synonym: "D12S2489E" RELATED []
synonym: "Killer cell lectin-like receptor subfamily K member 1" EXACT []
synonym: "KLRK1" RELATED []
synonym: "NK cell receptor D" EXACT []
synonym: "NKG2-D-activating NK receptor" EXACT []
synonym: "Nkg2d" RELATED []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001829
name: OX-2 membrane glycoprotein
def: "A protein that is a translation product of the CD200 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD200" RELATED []
synonym: "MOX1" RELATED []
synonym: "Mox2" RELATED []
synonym: "My033" RELATED []
xref: PIRSF:PIRSF001982
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001830
name: P-selectin glycoprotein ligand 1
def: "A protein that is a translation product of the SELPLG gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD162" EXACT []
synonym: "PSGL-1" EXACT []
synonym: "Selectin P ligand" EXACT []
synonym: "Selp1" RELATED []
synonym: "SELPLG" RELATED []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001831
name: PR-domain zinc finger protein 1
def: "A protein that is a translation product of the PRDM1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Beta-interferon gene positive regulatory domain I-binding factor" EXACT []
synonym: "BLIMP-1" EXACT []
synonym: "Blimp1" RELATED []
synonym: "Positive regulatory domain I-binding factor 1" EXACT []
synonym: "PR domain-containing protein 1" EXACT []
synonym: "PRDI-BF1" EXACT []
synonym: "PRDI-binding factor 1" EXACT []
synonym: "PRDM1" RELATED []
xref: PIRSF:PIRSF013212
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001832
name: SIRP/SHPS-1 family protein
def: "A protein with core architecture consisting of a signal sequence, one Immunoglobulin V-set domain (PF07686), two Immunoglobulin C1-set domains (PF07654), a single-pass transmembrane region and a very small cytoplasmic region." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF038063
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001833
name: SLAM family member 1
def: "A protein that is a translation product of the SLAMF1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD150" EXACT []
synonym: "CD150 antigen" RELATED []
synonym: "CDw150" EXACT []
synonym: "IPO-3" EXACT []
synonym: "signaling lymphocytic activation molecule" EXACT []
synonym: "SLAM" RELATED []
synonym: "SLAMF1" RELATED []
xref: PANTHER:PTHR12080\:SF1
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001834
name: SLAM family member 7
def: "A protein that is a translation product of the SLAMF7 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD2 subset 1" EXACT []
synonym: "CD2-like receptor-activating cytotoxic cells" EXACT []
synonym: "CD319" EXACT []
synonym: "CRACC" EXACT []
synonym: "CS1" RELATED []
synonym: "Leukocyte cell-surface antigen" EXACT []
synonym: "Membrane protein FOAP-12" EXACT []
synonym: "Novel Ly9" EXACT []
synonym: "Protein 19A" EXACT []
xref: PANTHER:PTHR12080\:SF17
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001835
name: T-box transcription factor TBX21
def: "A protein that is a translation product of the TBX21 gene." [PRO:WCB]
comment: Category=gene.
synonym: "T-box protein 21" EXACT []
synonym: "T-cell-specific T-box transcription factor T-bet" EXACT []
synonym: "Tbet" RELATED []
synonym: "TBX21" RELATED []
synonym: "Transcription factor TBLYM" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001836
name: T-cell antigen CD7
def: "A protein that is a translation product of the CD7 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD7" EXACT []
synonym: "GP40" EXACT []
synonym: "Leu-9" EXACT []
synonym: "T-cell leukemia antigen" EXACT []
synonym: "TP41" EXACT []
xref: PIRSF:PIRSF038791
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001837
name: T-cell differentiation antigen CD6
def: "A protein that is a translation product of the CD6 gene." [PRO:WCB]
comment: Category=gene.
synonym: "T12" EXACT []
synonym: "TP120" EXACT []
xref: PIRSF:PIRSF038792
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001838
name: T-cell surface glycoprotein CD1
def: "A protein with core architecture consisting of a signal sequence, an extracellular region with Class I Histocompatibility antigen, domains alpha 1 and alpha two (PF00129) and an Immunoglobulin C1-set domain (PF07654), a single-pass transmembrane region, and a very short cytoplasmic region. Forms a heterodimer with beta-2 microglobulin." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF038798
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001839
name: T-cell surface glycoprotein CD5
def: "A protein that is a translation product of the CD5 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD5" RELATED []
synonym: "LEU1" RELATED []
synonym: "Ly-1" EXACT []
synonym: "Lymphocyte antigen 1" EXACT []
synonym: "Lymphocyte antigen T1/Leu-1" EXACT []
synonym: "Lyt-1" EXACT []
synonym: "t-cell surface glycoprotein cd5" EXACT []
synonym: "Tcell_CD5" EXACT []
xref: PANTHER:PTHR19331\:SF6
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001840
name: T-cell surface protein tactile
def: "A protein that is a translation product of the CD96 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Cell surface antigen CD96" EXACT []
synonym: "T cell-activated increased late expression protein" EXACT []
synonym: "t-cell surface protein tactile" EXACT []
xref: PIRSF:PIRSF023955
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001841
name: T-cell-specific surface glycoprotein CD28
def: "A protein that is a translation product of the CD28 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD28" RELATED []
synonym: "T-cell surface glycoprotein CD28" EXACT []
synonym: "TP44" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001842
name: T-lymphocyte surface antigen Ly-9
def: "A protein that is a translation product of the LY9 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD229" EXACT []
synonym: "CDABP0070" RELATED []
synonym: "Cell-surface molecule Ly-9" EXACT []
synonym: "LY9" RELATED []
synonym: "Lymphocyte antigen 9" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001843
name: Thy-1 membrane glycoprotein
def: "A protein that is a translation product of the THY1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD90" EXACT []
synonym: "CDw90" EXACT []
synonym: "Thy-1 antigen" EXACT []
xref: PIRSF:PIRSF038777
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001844
name: arginase-1
def: "A protein that is a translation product of the ARG1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "ARG1" RELATED []
synonym: "Liver-type arginase" EXACT []
synonym: "Type I arginase" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001845
name: band 3-like protein
def: "A protein with core architecture consisting of a Band 3 cytoplasmic domain (PF07565) and an HCO3- transporter family domain (PF00955)." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF002468
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001846
name: basigin isoform 1
def: "A basigin that is a translation product of a mature transcript of the BSG gene. Represented by the sequence UniProtKB:P35613-1." [PRO:CNA]
comment: Category=sequence.
synonym: "5A11/basigin 2" EXACT []
synonym: "basigin long isoform" EXACT []
synonym: "Basigin-2" EXACT []
is_a: PRO:000001324 ! basigin

[Term]
id: PRO:000001847
name: basigin isoform 2
def: "A basigin that is a translation product of a mature transcript of the BSG gene. This form lacks the protein region between the signal peptide and the first Immunoglobulin domain. Represented by the sequence UniProtKB:P35613-2." [PRO:CNA]
comment: Category=sequence.
synonym: "5A11/Basigin" EXACT []
is_a: PRO:000001324 ! basigin

[Term]
id: PRO:000001848
name: butyrophilin
def: "A protein with core architecture consisting of a signal sequence,1-2 Ig-like domains (PF07686 and PF08205), a transmembrane region, and a cytoplasmic region containing one SPRY domain (PF00622)." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF038779
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001849
name: calcium-activated potassium channel subunit alpha-1
def: "A protein that is a translation product of the KCNMA1 gene." [PRO:WCB]
comment: Category=gene.
synonym: " KCNMA1" RELATED []
synonym: "BK channel" EXACT []
synonym: "BKCA alpha" EXACT []
synonym: "calcium-activated potassium channel subunit alpha-1" EXACT []
synonym: "Calcium-activated potassium channel, subfamily M subunit alpha-1" EXACT []
synonym: "hSlo" EXACT []
synonym: "K(VCA)alpha" EXACT []
synonym: "KCa1.1" EXACT []
synonym: "Maxi K channel" EXACT []
synonym: "MaxiK" EXACT []
synonym: "mSlo" EXACT []
synonym: "mSlo1" EXACT []
synonym: "Slo homolog" EXACT []
synonym: "Slo-alpha" EXACT []
synonym: "Slo1" EXACT []
synonym: "Slowpoke homolog" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001850
name: cathepsin K
def: "A protein that is a translation product of the CTSK gene." [PRO:WCB]
comment: Category=gene.
synonym: "Cathepsin O" EXACT []
synonym: "Cathepsin O2" EXACT []
synonym: "Cathepsin X" EXACT []
synonym: "CathpsnK_like" EXACT []
synonym: "CTSK" RELATED []
synonym: "CTSO" RELATED []
synonym: "CTSO2" RELATED []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001851
name: cell surface antigen 4F2 heavy chain
def: "A protein that is a translation product of the SLC3A2 gene." [PRO:WCB]
comment: Category=gene.
synonym: "4f2 cell-surface antigen heavy chain" EXACT []
synonym: "4F2 heavy chain antigen" EXACT []
synonym: "4F2hc" EXACT []
synonym: "CD98" EXACT []
synonym: "Lymphocyte activation antigen 4F2 large subunit" EXACT []
synonym: "MDU1" RELATED []
xref: PIRSF:PIRSF002024
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001852
name: cytotoxic T-lymphocyte protein 4
def: "A protein that is a translation product of the CTLA4 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD152" EXACT []
synonym: "CTLA-4" EXACT []
synonym: "CTLA4" RELATED []
synonym: "cytotoxic t-lymphocyte protein 4" EXACT []
synonym: "Cytotoxic T-lymphocyte-associated antigen 4" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001853
name: ecto-ADP-ribosyltransferase 4
def: "A NAD(P)+--arginine ADP-ribosyltransferase that is a translation product of the ART4 gene." [PRO:CNA, PRO:WCB]
comment: Category=gene.
synonym: "ART4" RELATED []
synonym: "CD297" EXACT []
synonym: "DOK1" RELATED []
synonym: "Dombrock blood group carrier molecule" EXACT []
synonym: "Mono(ADP-ribosyl)transferase 4" EXACT []
synonym: "NAD(P)(+)--arginine ADP-ribosyltransferase 4" EXACT []
xref: PIRSF:PIRSF501090
is_a: PRO:000002156 ! NAD(P)+--arginine ADP-ribosyltransferase

[Term]
id: PRO:000001854
name: ectonucleoside triphosphate diphosphohydrolase 1
def: "A protein that is a translation product of the ENTPD1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "ATPDase" EXACT []
synonym: "CD39" EXACT []
synonym: "Ecto-apyrase" EXACT []
synonym: "Ecto-ATP diphosphohydrolase" EXACT []
synonym: "ectonucleoside triphosphate diphosphohydrolase 1" EXACT []
synonym: "ENTPD1" RELATED []
synonym: "Lymphoid cell activation antigen" EXACT []
synonym: "NTPDase 1" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001855
name: fractalkine
def: "A protein that is a translation product of the CX3CL1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "C-X3-C motif chemokine 1" EXACT []
synonym: "CX3C membrane-anchored chemokine" EXACT []
synonym: "CX3CL1" RELATED []
synonym: "FKN" RELATED []
synonym: "Neurotactin" EXACT []
synonym: "NTT" RELATED []
synonym: "Processed fractalkine" EXACT []
synonym: "SCYD1" RELATED []
synonym: "Small-inducible cytokine D1" EXACT []
xref: PIRSF:PIRSF038029
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001856
name: hyaluronan mediated motility receptor
def: "A protein that is a translation product of the HMMR gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD168" EXACT []
synonym: "HMMR" RELATED []
synonym: "Ihabp" RELATED []
synonym: "Intracellular hyaluronic acid-binding protein" EXACT []
synonym: "Receptor for hyaluronan-mediated motility" EXACT []
synonym: "Rhamm" RELATED []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001857
name: immunoglobulin alpha Fc receptor
def: "A protein that is a translation product of the FCAR gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD89" EXACT []
synonym: "IgA Fc receptor" EXACT []
synonym: "immunoglobulin alpha Fc receptor" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001858
name: immunoglobulin iota chain
def: "A protein that is a translation product of the VPREB1 gene. The gene is recently and independently duplicated in mouse and rabbit, giving rise to very closely related VPREB2 genes in those species. The protein associates with the Ig-mu chain to form a molecular complex that is expressed only on the surface of pre-B-cells." [PRO:WCB]
comment: Category=gene.
synonym: "CD179 antigen-like family member A" EXACT []
synonym: "CD179a" EXACT []
synonym: "immunoglobulin iota chain isoform 1" EXACT []
synonym: "immunoglobulin iota chain isoform 2" EXACT []
synonym: "V(pre)B protein" EXACT []
synonym: "VpreB protein" EXACT []
synonym: "VPreB1 protein" EXACT []
xref: PIRSF:PIRSF038787
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001859
name: immunoglobulin lambda-like polypeptide 1
def: "A protein that is a translation product of the IGLL1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD179 antigen-like family member B" EXACT []
synonym: "CD179b" EXACT []
synonym: "Ig lambda-5" EXACT []
synonym: "Igl-5" RELATED []
synonym: "IGL1" RELATED []
synonym: "IGLL1" RELATED []
synonym: "immunoglobulin lambda-like polypeptide 1" EXACT []
synonym: "Immunoglobulin omega polypeptide" EXACT []
synonym: "Immunoglobulin-related protein 14.1" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001860
name: inducible T-cell costimulator
def: "A protein that is a translation product of the ICOS gene." [PRO:WCB]
comment: Category=gene.
synonym: "Activation-inducible lymphocyte immunomediatory molecule" EXACT []
synonym: "Ailim" RELATED []
synonym: "CCLP" EXACT []
synonym: "CD278" EXACT []
synonym: "CD28 and CTLA-4-like protein" EXACT []
synonym: "CD28-related protein 1" EXACT []
synonym: "CRP-1" EXACT []
synonym: "ICOS" RELATED []
synonym: "inducibleT-cell costimulator" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001861
name: integrin beta
def: "A protein with core architecture consisting of a large extracellular region containing one Integrin, beta chain domain (PF00362), up to four EGF-like domains (PF07974), and an Integrin beta tail domain (PF07965), followed by a single-pass transmembrane region and a small cytoplasmic region often containing an Integrin beta cytoplasmic domain (PF08725)." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF002512
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001862
name: interferon regulatory factor 1/2
def: "A protein with core architecture consisting of an Interferon regulatory factor transcription factor domain (PF00605) in the amino-terminal region." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF038196
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001863
name: interferon regulatory factor 3-9
def: "A protein with core architecture consisting of an Interferon regulatory factor transcription factor domain (PF00605) in the amino-terminal region, followed by an Interferon-regulatory factor 3 (PF10401) domain." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF005710
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001864
name: interferon-induced transmembrane protein
def: "A protein with core architecture consisting of one CD225 domain (PF04505)." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF016581
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001865
name: interleukin-3 receptor class 2 alpha chain
def: "A protein that is a translation product of the IL3RA gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD123" EXACT []
synonym: "IL-3R-alpha" EXACT []
synonym: "IL3RA" RELATED []
synonym: "Interleukin-3 receptor class II alpha chain" EXACT []
synonym: "Interleukin-3 receptor subunit alpha" EXACT []
synonym: "Sut-1" RELATED []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001866
name: interleukin-4 receptor alpha chain
def: "A protein that is a translation product of the IL4R gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD124" EXACT []
synonym: "IL-4-binding protein" EXACT []
synonym: "IL-4R-alpha" EXACT []
synonym: "IL4-BP" EXACT []
synonym: "IL4R" RELATED []
synonym: "interleukin-4 receptor alpha chain" EXACT []
synonym: "sIL4Ralpha/prot" EXACT []
synonym: "Soluble interleukin-4 receptor alpha chain" EXACT []
xref: PIRSF:PIRSF001957
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001867
name: interleukin-5 receptor subunit alpha
def: "A protein that is a translation product of the IL5RA gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD125" EXACT []
synonym: "CDw125" EXACT []
synonym: "IL-5R-alpha" EXACT []
synonym: "IL5RA" RELATED []
synonym: "interleukin-5 receptor alpha chain" EXACT []
xref: PIRSF:PIRSF018419
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001868
name: interleukin-6 receptor subunit beta
def: "A protein that is a translation product of the IL6ST gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD130" EXACT []
synonym: "CDw130" EXACT []
synonym: "gp130" EXACT []
synonym: "IL-6R-beta" EXACT []
synonym: "IL6ST" RELATED []
synonym: "interleukin-6 receptor beta chain" EXACT []
synonym: "Interleukin-6 signal transducer" EXACT []
synonym: "Membrane glycoprotein 130" EXACT []
synonym: "Oncostatin-M receptor alpha subunit" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001869
name: interleukin-7 receptor subunit alpha
def: "A protein that is a translation product of the IL7R gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD127" EXACT []
synonym: "CDw127" EXACT []
synonym: "IL-7R-alpha" EXACT []
synonym: "IL7R" RELATED []
synonym: "interleukin-7 receptor alpha chain" EXACT []
xref: PIRSF:PIRSF001960
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001870
name: islet cell autoantigen 1
def: "A protein that is a translation product of the ICA1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "69 kDa islet cell autoantigen" EXACT []
synonym: "ICA1" RELATED []
synonym: "ICAp69" EXACT []
synonym: "islet cell autoantigen 1" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001871
name: junctional adhesion molecule A
def: "A protein that is a translation product of the F11R gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD321" EXACT []
synonym: "F11R" RELATED []
synonym: "JAM-1" EXACT []
synonym: "JAM-A" EXACT []
synonym: "Jam1" RELATED []
synonym: "Jcam" RELATED []
synonym: "Jcam1" RELATED []
synonym: "Junctional adhesion molecule 1" EXACT []
synonym: "PAM-1" EXACT []
synonym: "Platelet adhesion molecule 1" EXACT []
synonym: "Platelet F11 receptor" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001872
name: junctional adhesion molecule B
def: "A protein that is a translation product of the JAM2 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD322" EXACT []
synonym: "JAM-B" EXACT []
synonym: "JAM2" RELATED []
synonym: "Junctional adhesion molecule 2" EXACT []
synonym: "Vascular endothelial junction-associated molecule" EXACT []
synonym: "VE-JAM" EXACT []
synonym: "Vejam" RELATED []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001873
name: kell blood group glycoprotein
def: "A protein that is a translation product of the KEL gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD238" EXACT []
synonym: "KEL" RELATED []
synonym: "kell blood group glycoprotein" EXACT []
synonym: "Kell blood group glycoprotein homolog" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001874
name: killer cell lectin-like receptor subfamily B member 1
def: "A protein that is a translation product of the KLRB1 gene. There are lineage-specific expansions in mouse and rat." [PRO:WCB]
comment: Category=family.
synonym: "C-type lectin domain family 5 member B" EXACT []
synonym: "CD161" EXACT []
synonym: "CLEC5B" RELATED []
synonym: "HNKR-P1a" EXACT []
synonym: "killer cell lectin-like receptor subfamily B member 1" EXACT []
synonym: "KLRB1" RELATED []
synonym: "Natural killer cell surface protein P1A" EXACT []
synonym: "NKR-P1A" EXACT []
synonym: "NKRP1A" RELATED []
xref: PIRSF:PIRSF038804
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001875
name: leptin receptor
def: "A protein that is a translation product of the LEPR gene." [PRO:WCB]
comment: Category=gene.
synonym: "B219" EXACT []
synonym: "CD295" EXACT []
synonym: "DB" RELATED []
synonym: "HuB219" EXACT []
synonym: "LEP-R" EXACT []
synonym: "Lep_receptor" EXACT []
synonym: "leptin receptor" EXACT []
synonym: "OB receptor" EXACT []
synonym: "OB-R" EXACT []
synonym: "OBR" RELATED []
xref: PANTHER:PTHR23036\:SF11
xref: PIRSF:PIRSF018116
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001876
name: leukemia inhibitory factor receptor
def: "A protein that is a translation product of the LIFR gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD118" EXACT []
synonym: "D-factor/LIF receptor" EXACT []
synonym: "LIF-R" EXACT []
synonym: "LIFR" RELATED []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001877
name: leukocyte-associated immunoglobulin-like receptor 1
def: "A protein that is a translation product of the LAIR1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD305" EXACT []
synonym: "hLAIR1" EXACT []
synonym: "LAIR-1" EXACT []
synonym: "LAIR1" RELATED []
synonym: "mLAIR1" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001878
name: leukocyte-associated immunoglobulin-like receptor 2
def: "A protein that is a translation product of the LAIR2 gene. This protein is closely related to the product of the human LAIR1 gene and is not found in mouse." [PRO:WCB]
comment: Category=gene.
synonym: "CD306" EXACT []
synonym: "LAIR-2" EXACT []
synonym: "LAIR2" RELATED []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001879
name: leukosialin
def: "A protein that is a translation product of the SPN gene." [PRO:WCB]
comment: Category=gene.
synonym: "B-cell differentiation antigen LP-3" EXACT []
synonym: "CD43" EXACT []
synonym: "Galactoglycoprotein" EXACT []
synonym: "GALGP" EXACT []
synonym: "Leukocyte sialoglycoprotein" EXACT []
synonym: "leukosialin" EXACT []
synonym: "Ly-48" EXACT []
synonym: "Sialophorin" EXACT []
xref: PIRSF:PIRSF001994
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001880
name: low affinity immunoglobulin epsilon Fc receptor
def: "A protein that is a translation product of the FCER2 gene." [PRO:WCB]
comment: Category=gene.
synonym: "BLAST-2" EXACT []
synonym: "CD23" EXACT []
synonym: "CD23A" RELATED []
synonym: "Fc-epsilon-RII" EXACT []
synonym: "FCE2" RELATED []
synonym: "FCER2" RELATED []
synonym: "Fcer2a" RELATED []
synonym: "IGEBF" RELATED []
synonym: "Immunoglobulin E-binding factor" EXACT []
synonym: "low affinity immunoglobulin epsilon Fc receptor" EXACT []
synonym: "Low affinity immunoglobulin epsilon Fc receptor membrane-bound form" EXACT []
synonym: "Low affinity immunoglobulin epsilon Fc receptor soluble form" EXACT []
synonym: "Lymphocyte IgE receptor" EXACT []
xref: PIRSF:PIRSF002426
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001881
name: lymphocyte activation gene 3 protein
def: "A protein that is a translation product of the LAG3 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD223 antigen" EXACT []
synonym: "FDC protein" EXACT []
synonym: "LAG-3" EXACT []
synonym: "lymphocyte activation gene 3 protein" EXACT []
xref: PIRSF:PIRSF011865
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001882
name: lysosome-associated membrane glycoprotein 3
def: "A protein that is a translation product of the LAMP3 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD208" EXACT []
synonym: "DC LAMP" EXACT []
synonym: "DC-lysosome-associated membrane glycoprotein" EXACT []
synonym: "DCLAMP" RELATED []
synonym: "LAMP-3" EXACT []
synonym: "LAMP3" RELATED []
synonym: "Lysosomal-associated membrane protein 3" EXACT []
synonym: "Protein TSC403" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001883
name: lysosome-associated membrane protein
def: "A protein with core architecture consisting of a Lysosome-associated membrane glycoprotein (PF01299) domain. It is a single-pass type I membrane protein that shuttles between lysosomes, endosomes, and the plasma membrane." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF002462
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001884
name: macrophage receptor MARCO
def: "A protein that is a translation product of the MARCO gene." [PRO:WCB]
comment: Category=gene.
synonym: "Macrophage receptor with collagenous structure" EXACT []
synonym: "MARCO" RELATED []
synonym: "SCARA2" RELATED []
synonym: "Scavenger receptor class A member 2" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001885
name: macrophage scavenger receptor types I and II
def: "A protein that is a translation product of the MSR1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD204" EXACT []
synonym: "Macrophage acetylated LDL receptor I and II" EXACT []
synonym: "macrophage scavenger receptor types i and ii" EXACT []
synonym: "MSR1" RELATED []
synonym: "SCARA1" RELATED []
synonym: "Scavenger receptor class A member 1" EXACT []
synonym: "Scavenger receptor type A" EXACT []
synonym: "Scvr" RELATED []
synonym: "SR-A" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001886
name: major prion protein
def: "A protein that is a translation product of the PRNP gene." [PRO:WCB]
comment: Category=gene.
synonym: "ASCR" EXACT []
synonym: "CD230" EXACT []
synonym: "major prion protein" EXACT []
synonym: "PRIP" RELATED []
synonym: "Prn-p" RELATED []
synonym: "PRNP" RELATED []
synonym: "PrP" EXACT []
synonym: "PrP27-30" EXACT []
synonym: "PrP33-35C" EXACT []
xref: PIRSF:PIRSF002380
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001887
name: melanotransferrin
def: "A protein that is a translation product of the MFI2 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD228" EXACT []
synonym: "MAP97" RELATED []
synonym: "Melanoma-associated antigen p97" EXACT []
synonym: "melanotransferrin" EXACT []
synonym: "Membrane-bound transferrin-like protein p97" EXACT []
synonym: "MFI2" RELATED []
synonym: "MTf" EXACT []
synonym: "transferrin" EXACT []
xref: PIRSF:PIRSF500685
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001888
name: membrane alanyl aminopeptidase-like metallopeptidase
def: "A protein with core architecture consisting of a Peptidase family M1 domain (PF01433)." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF005502
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001889
name: monocyte differentiation antigen CD14
def: "A protein that is a translation product of the CD14 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD14" RELATED []
synonym: "monocyte differentiation antigen cd14" EXACT []
synonym: "Monocyte differentiation antigen CD14, membrane-bound form" EXACT []
synonym: "Monocyte differentiation antigen CD14, urinary form" EXACT []
synonym: "Myeloid cell-specific leucine-rich glycoprotein" EXACT []
xref: PIRSF:PIRSF002017
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001890
name: mucin-1
def: "A protein that is a translation product of the MUC1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Breast carcinoma-associated antigen DF3" EXACT []
synonym: "Carcinoma-associated mucin" EXACT []
synonym: "CD227" EXACT []
synonym: "EMA" EXACT []
synonym: "Episialin" EXACT []
synonym: "H23AG" EXACT []
synonym: "MUC-1" EXACT []
synonym: "MUC1" RELATED []
synonym: "MUC1-alpha" EXACT []
synonym: "MUC1-beta" EXACT []
synonym: "MUC1-CT" EXACT []
synonym: "MUC1-NT" EXACT []
synonym: "Mucin-1 subunit alpha" EXACT []
synonym: "Mucin-1 subunit beta" EXACT []
synonym: "Peanut-reactive urinary mucin" EXACT []
synonym: "PEMT" EXACT []
synonym: "Polymorphic epithelial mucin" EXACT []
synonym: "PUM" EXACT []
synonym: "Tumor-associated epithelial membrane antigen" EXACT []
synonym: "Tumor-associated mucin" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001891
name: multidrug resistance protein 1
def: "A protein that is a translation product of the ABCB1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "ABCB1" RELATED []
synonym: "Abcb1a" RELATED []
synonym: "Abcb4" RELATED []
synonym: "ATP-binding cassette sub-family B member 1A" EXACT []
synonym: "CD243" EXACT []
synonym: "MDR1A" EXACT []
synonym: "Mdr3" RELATED []
synonym: "multidrug resistance protein 1" EXACT []
synonym: "Multidrug resistance protein 3" EXACT []
synonym: "P-glycoprotein 1" EXACT []
synonym: "P-glycoprotein 3" EXACT []
synonym: "Pgy-3" RELATED []
synonym: "PGY1" RELATED []
synonym: "Pgy3" RELATED []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001892
name: myeloid cell surface antigen CD33
def: "A protein that is a translation product of the CD33 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD33" RELATED []
synonym: "gp67" EXACT []
synonym: "Sialic acid-binding Ig-like lectin 3" EXACT []
synonym: "Siglec-3" EXACT []
synonym: "Siglec3" RELATED []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001893
name: natural cytotoxicity triggering receptor 1
def: "A protein that is a translation product of the NCR1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD335" EXACT []
synonym: "hNKp46" EXACT []
synonym: "LY94" RELATED []
synonym: "Lymphocyte antigen 94" EXACT []
synonym: "Lymphocyte antigen 94 homolog" EXACT []
synonym: "mAR-1" EXACT []
synonym: "mNKp46" EXACT []
synonym: "Mouse-activating receptor 1" EXACT []
synonym: "Natural killer cell p46-related protein" EXACT []
synonym: "NCR1" RELATED []
synonym: "NK cell-activating receptor" EXACT []
synonym: "NK-p46" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001894
name: natural cytotoxicity triggering receptor 2
def: "A protein that is a translation product of the NCR2 gene. Not found in mouse." [PRO:WCB]
comment: Category=gene.
synonym: "CD336" EXACT []
synonym: "LY95" RELATED []
synonym: "Lymphocyte antigen 95 homolog" EXACT []
synonym: "Natural killer cell p44-related protein" EXACT []
synonym: "NCR2" RELATED []
synonym: "NK cell-activating receptor" EXACT []
synonym: "NK-p44" EXACT []
synonym: "NKp44" EXACT []
xref: PIRSF:PIRSF037963
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001895
name: natural cytotoxicity triggering receptor 3
def: "A protein that is a translation product of the NCR3 gene." [PRO:WCB]
comment: Category=gene. Mouse sequence known but not in UniProt.
synonym: "1C7" RELATED []
synonym: "Activating natural killer receptor p30" EXACT []
synonym: "CD337" EXACT []
synonym: "LY117" RELATED []
synonym: "natural cytotoxicity triggering receptor 3" EXACT []
synonym: "Natural killer cell p30-related protein" EXACT []
synonym: "NCR3" RELATED []
synonym: "NK-p30" EXACT []
synonym: "NKp30" EXACT []
xref: PIRSF:PIRSF038040
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001896
name: natural killer cell receptor 2B4
def: "A protein that is a translation product of the CD244 gene." [PRO:WCB]
comment: Category=gene.
synonym: " CD244" RELATED []
synonym: "h2B4" EXACT []
synonym: "NAIL" EXACT []
synonym: "NK cell activation-inducing ligand" EXACT []
synonym: "NK cell type I receptor protein 2B4" EXACT []
synonym: "NKR2B4" EXACT []
synonym: "Nmrk" RELATED []
synonym: "Non-MHC restricted killing associated" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001897
name: natural killer cell receptor NKG2
def: "A protein with core architecture consisting of an as yet unnamed domain in the amino-terminal half and a carboxyl-terminal Lectin C-type domain (PF00059)." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF005558
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001898
name: neprilysin
def: "A protein that is a translation product of the MME gene." [PRO:WCB]
comment: Category=gene.
synonym: " MME" RELATED []
synonym: "Atriopeptidase" EXACT []
synonym: "CALLA" EXACT []
synonym: "CD10" EXACT []
synonym: "Common acute lymphocytic leukemia antigen" EXACT []
synonym: "Enkephalinase" EXACT []
synonym: "EPN" RELATED []
synonym: "neprilysin" EXACT []
synonym: "Neutral endopeptidase 24.11" EXACT []
xref: PIRSF:PIRSF501074
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001899
name: neural cell adhesion molecule-like protein
def: "A protein with core architecture consisting of 4-6 Ig-like domains (PF00047, PF07679, or PF07686) and 4-5 Fibronectin type III domains (PF00041)." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF002508
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001900
name: neuropilin-1
def: "A protein that is a translation product of the NRP1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "A5 protein" EXACT []
synonym: "CD304" EXACT []
synonym: "neuropilin-1" EXACT []
synonym: "NRP1" RELATED []
synonym: "Vascular endothelial cell growth factor 165 receptor" EXACT []
synonym: "VEGF165R" RELATED []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001901
name: nitric-oxide synthase, inducible
def: "A protein that is a translation product of the NOS2A gene." [PRO:WCB]
comment: Category=gene.
synonym: "HEP-NOS" EXACT []
synonym: "Hepatocyte NOS" EXACT []
synonym: "Inducible NO synthase" EXACT []
synonym: "Inducible NOS" EXACT []
synonym: "iNOS" EXACT []
synonym: "Inosl" RELATED []
synonym: "MAC-NOS" EXACT []
synonym: "Macrophage NOS" EXACT []
synonym: "nitric oxide synthase, inducible" EXACT []
synonym: "NOS type II" EXACT []
synonym: "NOS2A" RELATED []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001902
name: nuclear receptor ROR-gamma
def: "A protein that is a translation product of the RORC gene." [PRO:WCB]
comment: Category=gene.
synonym: " RORC" RELATED []
synonym: "NR1F3" RELATED []
synonym: "Nuclear receptor RZR-gamma" EXACT []
synonym: "Nuclear receptor subfamily 1 group F member 3" EXACT []
synonym: "Retinoid-related orphan receptor-gamma" EXACT []
synonym: "RORG" RELATED []
synonym: "RZRG" RELATED []
synonym: "Thor" RELATED []
synonym: "Thymus orphan receptor" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001903
name: paired box protein PAX-5
def: "A protein that is a translation product of the PAX5 gene." [PRO:WCB]
comment: Category=gene.
synonym: "B-cell-specific transcription factor" EXACT []
synonym: "BSAP" EXACT []
synonym: "paired box protein, PAX-2/PAX-8 types" EXACT []
synonym: "PAX5" RELATED []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001904
name: platelet endothelial cell adhesion molecule
def: "A protein that is a translation product of the PECAM1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD31" EXACT []
synonym: "EndoCAM" EXACT []
synonym: "GPIIA'" EXACT []
synonym: "PECAM-1" EXACT []
synonym: "PECAM1" RELATED []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001905
name: platelet glycoprotein 4
def: "A protein that is a translation product of the CD36 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD36" RELATED []
synonym: "FAT" EXACT []
synonym: "Fatty acid translocase" EXACT []
synonym: "Glycoprotein IIIb" EXACT []
synonym: "GP3B" RELATED []
synonym: "GP4" RELATED []
synonym: "GPIIIB" EXACT []
synonym: "GPIV" EXACT []
synonym: "Leukocyte differentiation antigen CD36" EXACT []
synonym: "PAS IV" EXACT []
synonym: "PAS-4" EXACT []
synonym: "Platelet collagen receptor" EXACT []
synonym: "platelet glycoprotein 4" EXACT []
synonym: "Platelet glycoprotein IV" EXACT []
synonym: "Thrombospondin receptor" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001906
name: platelet glycoprotein IX
def: "A protein that is a translation product of the GP9 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD42a antigen" EXACT []
synonym: "GPIX" EXACT []
xref: PIRSF:PIRSF038774
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001907
name: platelet glycoprotein Ib alpha chain
def: "A protein that is a translation product of the GP1BA gene." [PRO:WCB]
comment: Category=gene.
synonym: "Antigen CD42b-alpha" EXACT []
synonym: "Glycocalicin" EXACT []
synonym: "Glycoprotein Ibalpha" EXACT []
synonym: "GP-Ib alpha" EXACT []
synonym: "GP1BA" RELATED []
synonym: "GPIb-alpha" EXACT []
xref: PIRSF:PIRSF002493
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001908
name: platelet glycoprotein Ib beta chain
def: "A protein that is a translation product of the GP1BB gene." [PRO:WCB]
comment: Category=gene.
synonym: "Antigen CD42b-beta" EXACT []
synonym: "CD42c" EXACT []
synonym: "GP-Ib beta" EXACT []
synonym: "GP1BB" RELATED []
synonym: "GPIb-beta" EXACT []
synonym: "GPIbB" EXACT []
xref: PIRSF:PIRSF002494
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001909
name: platelet glycoprotein V
def: "A protein that is a translation product of the GP5 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD42D" EXACT []
synonym: "GP5" RELATED []
synonym: "GPV" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001910
name: plexin-C1
def: "A protein that is a translation product of the PLXNC1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD232" EXACT []
synonym: "PLXNC1" RELATED []
synonym: "Vespr" RELATED []
synonym: "Virus-encoded semaphorin protein receptor" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001911
name: poliovirus receptor-related protein
def: "A protein with core architecture consisting of an Immunoglobulin V-set domain (PF07686), followed by a CD80-like C2-set immunoglobulin domain (PF08205) and an Immunoglobulin domain (PF00047)." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF002016
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001912
name: potassium channel subfamily K member 10
def: "A protein that is a translation product of the KCNK10 gene." [PRO:WCB]
comment: Category=gene.
synonym: "KCNK10" RELATED []
synonym: "Outward rectifying potassium channel protein TREK-2" EXACT []
synonym: "TREK-2 K(+) channel subunit" EXACT []
synonym: "TREK2" RELATED []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001913
name: potassium channel subfamily K member 16 (human)
def: "A protein that is a translation product of the human KCNK16 gene. The mouse gene of the same name is not orthologous." [PRO:WCB]
comment: Category=gene.
synonym: "2P domain potassium channel Talk-1" EXACT []
synonym: "KCNK16" RELATED []
synonym: "TALK1" RELATED []
synonym: "TWIK-related alkaline pH-activated K(+) channel 1" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001914
name: potassium channel subfamily K member 2
def: "A protein that is a translation product of the KCNK2 gene." [PRO:WCB]
comment: Category=gene.
synonym: "KCNK2" RELATED []
synonym: "Outward rectifying potassium channel protein TREK-1" EXACT []
synonym: "TREK-1 K(+) channel subunit" EXACT []
synonym: "TREK1" RELATED []
synonym: "Two pore domain potassium channel TREK-1" EXACT []
synonym: "Two pore potassium channel TPKC1" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001915
name: potassium channel subfamily K member 5
def: "A protein that is a translation product of the KCNK5 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Acid-sensitive potassium channel protein TASK-2" EXACT []
synonym: "KCNK5" RELATED []
synonym: "TASK2" RELATED []
synonym: "TWIK-related acid-sensitive K(+) channel 2" EXACT []
xref: PIRSF:PIRSF038512
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001916
name: potassium channel subfamily T
def: "A protein with core architecture consisting of a multipass transmembrane region containing an Ion channel domain (PF07885) and a cytoplasmic region containing a Calcium-activated BK potassium channel alpha subunit domain (PF03493)." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF017686
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001917
name: potassium channel, TWIK-1-related
def: "A protein with core architecture consisting of two copies of the Ion channel (PF07885) domain." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF038061
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001918
name: pre T-cell antigen receptor alpha
def: "A protein that is a translation product of the PTCRA gene." [PRO:WCB]
comment: Category=gene.
synonym: "gp33" EXACT []
synonym: "pT-alpha" EXACT []
synonym: "pT-alpha-TCR" EXACT []
synonym: "pTa" EXACT []
synonym: "PTCRA" RELATED []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001919
name: programmed cell death protein 1
def: "A protein that is a translation product of the PDCD1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD279" EXACT []
synonym: "hPD-1" EXACT []
synonym: "mPD-1" EXACT []
synonym: "PD1" RELATED []
synonym: "programmed cell death protein 1" EXACT []
synonym: "Protein PD-1" EXACT []
xref: PIRSF:PIRSF018380
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001920
name: prostaglandin F2 receptor negative regulator
def: "A protein that is a translation product of the PTGFRN gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD315" EXACT []
synonym: "CD9 partner 1" EXACT []
synonym: "CD9P-1" EXACT []
synonym: "CD9P1" RELATED []
synonym: "Fprp" RELATED []
synonym: "Prostaglandin F2-alpha receptor regulatory protein" EXACT []
synonym: "Prostaglandin F2-alpha receptor-associated protein" EXACT []
synonym: "PTGFRN" RELATED []
xref: PIRSF:PIRSF038811
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001921
name: protein jagged-1
def: "A protein that is a translation product of the JAG1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD339" EXACT []
synonym: "hJ1" EXACT []
synonym: "JAG1" RELATED []
synonym: "Jagged1" EXACT []
synonym: "JAGL1" RELATED []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001922
name: putative mucin core protein 24
def: "A protein that is a translation product of the CD164 gene." [PRO:WCB]
comment: Category=gene. We could use CD164 as name to avoid "putative".
synonym: "CD164" RELATED []
synonym: "MGC-24" EXACT []
synonym: "MUC-24" EXACT []
synonym: "Multi-glycosylated core protein 24" EXACT []
synonym: "putative mucin core protein 24" EXACT []
xref: PANTHER:PTHR11337\:SF8
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001923
name: receptor-type tyrosine-protein kinase Tie
def: "A protein with core architecture consisting of an extracellular region containing an Ig-like domain (PF00047 or PF10430), followed by 3 EGF-like domains (PF07947 or PF00053), another Ig-like domain, and 3 Fibronectin type III domains (PF00041), and a cytoplasmic region containing the Protein tyrosine kinase domain (PF07714)." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF000630
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001924
name: receptor-type tyrosine-protein phosphatase eta
def: "A protein that is a translation product of the PTPRJ gene." [PRO:WCB]
comment: Category=gene.
synonym: "Byp" RELATED []
synonym: "CD148" EXACT []
synonym: "Density-enhanced phosphatase 1" EXACT []
synonym: "DEP-1" EXACT []
synonym: "DEP1" RELATED []
synonym: "HPTP beta-like tyrosine phosphatase" EXACT []
synonym: "HPTP eta" EXACT []
synonym: "Protein-tyrosine phosphatase eta" EXACT []
synonym: "Protein-tyrosine phosphatase receptor type J" EXACT []
synonym: "R-PTP-eta" EXACT []
synonym: "receptor-type tyrosine-protein phosphatase eta" EXACT []
synonym: "Scc1" RELATED []
synonym: "Susceptibility to colon cancer 1" EXACT []
xref: PIRSF:PIRSF001999
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001925
name: scavenger receptor cysteine-rich type 1 protein M130
def: "A protein that is a translation product of the CD163 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD163" RELATED []
synonym: "Hemoglobin scavenger receptor" EXACT []
synonym: "sCD163" EXACT []
synonym: "Soluble CD163" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001926
name: semaphorin
def: "A protein with core architecture consisting of a signal sequence,a  Sema domain (PF01403), a Plexin repeat (PF1437), and an Ig-like domain (PF00047, PF07686, or PF07679)." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF005526
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001927
name: sialic acid-binding Ig-like lectin 5
def: "A protein that is a translation product of the SIGLEC5 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD170" EXACT []
synonym: "CD33 antigen-like 2" EXACT []
synonym: "CD33L2" RELATED []
synonym: "mSiglec-F" EXACT []
synonym: "OB-binding protein 2" EXACT []
synonym: "OB-BP2" EXACT []
synonym: "OBBP2" RELATED []
synonym: "Obesity-binding protein 2" EXACT []
synonym: "Sialic acid-binding Ig-like lectin-F" EXACT []
synonym: "Siglec-5" EXACT []
synonym: "Siglecf" RELATED []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001928
name: sialic acid-binding Ig-like lectin 6
def: "A protein that is a translation product of the SIGLEC6 gene (human). There is no mouse ortholog." [PRO:WCB]
comment: Category=gene.
synonym: "CD327" EXACT []
synonym: "CD33 antigen-like 1" EXACT []
synonym: "CD33L" RELATED []
synonym: "CD33L1" RELATED []
synonym: "CDw327" EXACT []
synonym: "OB-BP1" EXACT []
synonym: "OBBP1" RELATED []
synonym: "Obesity-binding protein 1" EXACT []
synonym: "Siglec-6" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001929
name: sialic acid-binding Ig-like lectin 7
def: "A protein that is a translation product of the SIGLEC7 gene (human). There is no mouse ortholog." [PRO:WCB]
comment: Category=gene.
synonym: "Adhesion inhibitory receptor molecule 1" EXACT []
synonym: "AIRM-1" EXACT []
synonym: "AIRM1" RELATED []
synonym: "CD328" EXACT []
synonym: "CDw328" EXACT []
synonym: "D-siglec" EXACT []
synonym: "p75" EXACT []
synonym: "QA79 membrane protein" EXACT []
synonym: "Siglec-7" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001930
name: sialic acid-binding Ig-like lectin 8
def: "A protein that is a translation product of the SIGLEC8 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD329" EXACT []
synonym: "CDw329" EXACT []
synonym: "SAF-2" EXACT []
synonym: "SAF2" RELATED []
synonym: "Sialoadhesin family member 2" EXACT []
synonym: "Siglec-8" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001931
name: sialoadhesin
def: "A protein that is a translation product of the SIGLEC1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD169" EXACT []
synonym: "Sa" RELATED []
synonym: "SER" EXACT []
synonym: "Sheep erythrocyte receptor" EXACT []
synonym: "Sialic acid-binding Ig-like lectin 1" EXACT []
synonym: "Siglec-1" EXACT []
synonym: "SN" RELATED []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001932
name: signal transducer CD24
def: "A protein that is a translation product of the CD24 gene or its mouse ortholog, Cd24a." [PRO:WCB]
comment: Category=gene. Mouse protein Cd24b likely also orthologous. Currently it is not in UniProt.
synonym: "CD24" RELATED []
synonym: "CD24 antigen" RELATED []
synonym: "CD24A" RELATED []
synonym: "Ly-52" RELATED []
synonym: "Lymphocyte antigen 52" EXACT []
synonym: "M1/69-J11D heat stable antigen" EXACT []
synonym: "Nectadrin" EXACT []
synonym: "R13-Ag" EXACT []
synonym: "Small cell lung carcinoma cluster 4 antigen" EXACT []
synonym: "X62 heat stable antigen" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001933
name: signal transducer and transcription activator STAT
def: "A protein with core architecture consisting of a STAT protein, protein interaction domain (PF02865), an SH2 domain (PF01017), a STAT protein, DNA binding domain (PF02864), and a second SH2 domain." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF015568
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001934
name: sodium/potassium-transporting ATPase subunit beta-3
def: "A protein that is a translation product of the ATP1B3 gene." [PRO:WCB]
comment: Category=gene.
synonym: "ATP1B3" RELATED []
synonym: "ATPB-3" EXACT []
synonym: "CD298" EXACT []
synonym: "Sodium/potassium-dependent ATPase subunit beta-3" EXACT []
synonym: "sodium/potassium-transporting atpase subunit beta-3" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001935
name: syndecan-1
def: "A protein that is a translation product of the SDC1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD138" EXACT []
synonym: "Synd-1" RELATED []
synonym: "SYND1" EXACT []
synonym: "syndecan-1" EXACT []
xref: PIRSF:PIRSF015854
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001936
name: syndecan-3
def: "A protein that is a translation product of the SDC3 gene." [PRO:WCB]
comment: Category=gene.
synonym: "SDC3" RELATED []
synonym: "SYND3" EXACT []
xref: PIRSF:PIRSF038784
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001937
name: tartrate-resistant acid phosphatase type 5
def: "A protein that is a translation product of the ACP5 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Acid phosphatase 5, tartrate resistant" EXACT []
synonym: "T5ap" RELATED []
synonym: "Tartrate-resistant acid ATPase" EXACT []
synonym: "tartrate-resistant acid phosphatase type 5" EXACT []
synonym: "TR-AP" EXACT []
synonym: "Trap" RELATED []
synonym: "TrATPase" EXACT []
xref: PIRSF:PIRSF000898
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001938
name: thrombomodulin-like receptor
def: "A protein with core architecture consisting of a signal sequence, a Lectin C-type domain (PF00059), 5 or 6 EGF-like domains (PF00008, PF09064, or PF07645), a transmembrane region, and a small cytoplasmic region (36-51 amino acids)." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF001775
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001939
name: thrombopoietin receptor
def: "A protein that is a translation product of the MPL gene." [PRO:WCB]
comment: Category=gene.
synonym: "C-mpl" EXACT []
synonym: "CD110" EXACT []
synonym: "Myeloproliferative leukemia protein" EXACT []
synonym: "TPO-R" EXACT []
synonym: "Tpor" RELATED []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001940
name: tissue factor
def: "A protein that is a translation product of the F3 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD142" EXACT []
synonym: "Cf-3" RELATED []
synonym: "Cf3" RELATED []
synonym: "coagulation factor III" RELATED []
synonym: "TF" EXACT []
synonym: "Thromboplastin" EXACT []
synonym: "tissue factor" EXACT []
xref: PIRSF:PIRSF002498
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001941
name: trans-actingT-cell-specific transcription factor GATA-3
def: "A protein that is a translation product of the GATA3 gene." [PRO:WCB]
comment: Category=gene.
synonym: "GATA-binding factor 3" EXACT []
synonym: "GATA3" RELATED []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001942
name: transcription factor COE1
def: "A protein that is a translation product of the EBF1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Early B-cell factor" EXACT []
synonym: "EBF1" RELATED []
synonym: "O/E-1" EXACT []
synonym: "OE-1" EXACT []
synonym: "transcription factor coe1" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001943
name: transcription factor E2-alpha
def: "A protein that is a translation product of the TCF3 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Alf2" RELATED []
synonym: "Immunoglobulin enhancer-binding factor E12/E47" EXACT []
synonym: "Immunoglobulin transcription factor 1" EXACT []
synonym: "ITF1" RELATED []
synonym: "Kappa-E2-binding factor" EXACT []
synonym: "Me2" RELATED []
synonym: "TCF-3" EXACT []
synonym: "TCF3" RELATED []
synonym: "Tcfe2a" RELATED []
synonym: "transcription factor 3" EXACT []
synonym: "Transcription factor A1" EXACT []
synonym: "Transcription factor ITF-1" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001944
name: transcription factor PU.1
def: "A protein that is a translation product of the SPI1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "31 kDa-transforming protein" EXACT []
synonym: "SFFV proviral integration 1 protein" EXACT []
synonym: "Sfpi-1" RELATED []
synonym: "Sfpi1" RELATED []
synonym: "SPI1" RELATED []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001945
name: transferrin receptor protein 1
def: "A protein that is a translation product of the TFRC gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD71" EXACT []
synonym: "p90" EXACT []
synonym: "sTfR" EXACT []
synonym: "T9" EXACT []
synonym: "TfR1" EXACT []
synonym: "transferrin receptor protein 1" EXACT []
synonym: "Transferrin receptor protein 1, serum form" EXACT []
synonym: "Trfr" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001946
name: tumor necrosis factor ligand superfamily member 10/11
def: "A protein with core architecture consisting of a fairly small cytoplasmic region, a transmembrane domain, and an extracellular domain containing a TNF(Tumour Necrosis Factor) family domain (PF00229)." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF038013
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001947
name: tumor necrosis factor ligand superfamily member 13
def: "A protein that is a translation product of the TNFSF13 gene." [PRO:WCB]
comment: Category=gene.
synonym: "A proliferation-inducing ligand" EXACT []
synonym: "APRIL" EXACT []
synonym: "CD256" EXACT []
synonym: "TALL-2" EXACT []
synonym: "TALL2" RELATED []
synonym: "TNF- and APOL-related leukocyte expressed ligand 2" EXACT []
synonym: "TNF-related death ligand 1" EXACT []
synonym: "TNFSF13" RELATED []
synonym: "TRDL-1" EXACT []
synonym: "ZTNF2" RELATED []
xref: PIRSF:PIRSF038318
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001948
name: tumor necrosis factor ligand superfamily member 13B
def: "A protein that is a translation product of the TNFSF13B gene." [PRO:WCB]
comment: Category=gene.
synonym: "B cell-activating factor" EXACT []
synonym: "B lymphocyte stimulator" EXACT []
synonym: "BAFF" EXACT []
synonym: "BLyS" EXACT []
synonym: "CD257" EXACT []
synonym: "Dendritic cell-derived TNF-like molecule" EXACT []
synonym: "TALL-1" EXACT []
synonym: "TALL1" RELATED []
synonym: "TNF- and APOL-related leukocyte expressed ligand 1" EXACT []
synonym: "TNFSF13B" RELATED []
synonym: "TNFSF20" RELATED []
synonym: "tumor necrosis factor ligand superfamily member 13b" EXACT []
synonym: "Tumor necrosis factor ligand superfamily member 13b, membrane form" EXACT []
synonym: "Tumor necrosis factor ligand superfamily member 13b, soluble form" EXACT []
synonym: "ZTNF4" RELATED []
xref: PIRSF:PIRSF038318
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001949
name: tumor necrosis factor ligand superfamily member 4
def: "A protein that is a translation product of the TNFSF4 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD252" EXACT []
synonym: "Glycoprotein Gp34" EXACT []
synonym: "OX40 ligand" EXACT []
synonym: "OX40L" EXACT []
synonym: "TAX transcriptionally-activated glycoprotein 1" EXACT []
synonym: "tumor necrosis factor ligand superfamily member 4" EXACT []
synonym: "Txgp1l" RELATED []
xref: PIRSF:PIRSF009367
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001950
name: tumor necrosis factor ligand superfamily member 5
def: "A protein that is a translation product of the CD40LG gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD154" EXACT []
synonym: "cd40 ligand" EXACT []
synonym: "CD40 ligand, membrane form" EXACT []
synonym: "CD40 ligand, soluble form" EXACT []
synonym: "CD40-L" EXACT []
synonym: "CD40LG" RELATED []
synonym: "T-cell antigen Gp39" EXACT []
synonym: "TNF-related activation protein" EXACT []
synonym: "TNFSF5" RELATED []
synonym: "TRAP" EXACT []
synonym: "Tumor necrosis factor ligand superfamily member 5" EXACT []
xref: PIRSF:PIRSF016527
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001951
name: tumor necrosis factor receptor superfamily member 10A/B
def: "A protein with core architecture consisting of a signal sequence, an extracellular region containing three TNFR/NGFR cysteine-rich region domains (PF00020), a transmembrane region, and an intracellular region containing a Death domain (PF00531). There are two genes in human, TNFRSF10A and TNFRSF10B, more closely related to each other than to mouse TNFRSF10B." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF037867
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001952
name: tumor necrosis factor receptor superfamily member 10C
def: "A protein that is a translation product of the TNFRSF10C gene." [PRO:WCB]
comment: Category=gene.
synonym: "Antagonist decoy receptor for TRAIL/Apo-2L" EXACT []
synonym: "CD263" EXACT []
synonym: "DcR1" EXACT []
synonym: "Decoy receptor 1" EXACT []
synonym: "Decoy TRAIL receptor without death domain" EXACT []
synonym: "LIT" RELATED []
synonym: "Lymphocyte inhibitor of TRAIL" EXACT []
synonym: "TNF-related apoptosis-inducing ligand receptor 3" EXACT []
synonym: "TNFRSF10C" RELATED []
synonym: "TRAIL receptor 3" EXACT []
synonym: "Trail receptor without an intracellular domain" EXACT []
synonym: "TRAIL-R3" EXACT []
synonym: "TRAILR3" RELATED []
synonym: "TRID" RELATED []
xref: PIRSF:PIRSF038081
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001953
name: tumor necrosis factor receptor superfamily member 10D
def: "A protein that is a translation product of the TNFRSF10D gene. Not found in mouse." [PRO:WCB]
comment: Category=gene.
synonym: "CD264" EXACT []
synonym: "DcR2" EXACT []
synonym: "Decoy receptor 2" EXACT []
synonym: "TNF-related apoptosis-inducing ligand receptor 4" EXACT []
synonym: "TNFRSF10D" RELATED []
synonym: "TRAIL receptor 4" EXACT []
synonym: "TRAIL receptor with a truncated death domain" EXACT []
synonym: "TRAIL-R4" EXACT []
synonym: "TRAILR4" RELATED []
synonym: "TRUNDD" RELATED []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001954
name: tumor necrosis factor receptor superfamily member 11A
def: "A protein that is a translation product of the TNFRSF11A gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD265" EXACT []
synonym: "ODFR" EXACT []
synonym: "Osteoclast differentiation factor receptor" EXACT []
synonym: "Rank" RELATED []
synonym: "Receptor activator of NF-KB" EXACT []
synonym: "TNFRSF11A" RELATED []
xref: PIRSF:PIRSF038806
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001955
name: tumor necrosis factor receptor superfamily member 12A
def: "A protein that is a translation product of the TNFRSF12A gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD266" EXACT []
synonym: "FGF-inducible 14" EXACT []
synonym: "Fgfrp2" RELATED []
synonym: "Fibroblast growth factor-inducible immediate-early response protein 14" EXACT []
synonym: "Fibroblast growth factor-regulated protein 2" EXACT []
synonym: "Fn14" RELATED []
synonym: "TNFRSF12A" RELATED []
synonym: "Tweak-receptor" EXACT []
synonym: "TweakR" EXACT []
xref: PIRSF:PIRSF038807
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001956
name: tumor necrosis factor receptor superfamily member 13B
def: "A protein that is a translation product of the TNFRSF13B gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD267" EXACT []
synonym: "Taci" RELATED []
synonym: "TNFRSF13B" RELATED []
synonym: "Transmembrane activator and CAML interactor" EXACT []
xref: PIRSF:PIRSF037809
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001957
name: tumor necrosis factor receptor superfamily member 13C
def: "A protein that is a translation product of the TNFRSF13C gene." [PRO:WCB]
comment: Category=gene.
synonym: "B cell-activating factor receptor" EXACT []
synonym: "B-cell maturation defect" EXACT []
synonym: "BAFF receptor" EXACT []
synonym: "BAFF-R" EXACT []
synonym: "Baffr" RELATED []
synonym: "Bcmd" RELATED []
synonym: "BLyS receptor 3" EXACT []
synonym: "Br3" RELATED []
synonym: "CD268" EXACT []
synonym: "TNFRSF13C" RELATED []
xref: PIRSF:PIRSF038808
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001958
name: tumor necrosis factor receptor superfamily member 1A
def: "A protein that is a translation product of the TNFRSF1A gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD120a" EXACT []
synonym: "p55" EXACT []
synonym: "p60" EXACT []
synonym: "TBPI" EXACT []
synonym: "TNF-R1" EXACT []
synonym: "TNF-RI" EXACT []
synonym: "TNFAR" RELATED []
synonym: "Tnfr-1" RELATED []
synonym: "TNFR-I" EXACT []
synonym: "Tnfr1" RELATED []
synonym: "TNFRSF1A" RELATED []
synonym: "tumor necrosis factor receptor superfamily member 1a" EXACT []
synonym: "Tumor necrosis factor receptor superfamily member 1A, membrane form" EXACT []
synonym: "Tumor necrosis factor-binding protein 1" EXACT []
xref: PIRSF:PIRSF001965
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001959
name: tumor necrosis factor receptor superfamily member 1B
def: "A protein that is a translation product of the TNFRSF1B gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD120b" EXACT []
synonym: "Etanercept" EXACT []
synonym: "p75" EXACT []
synonym: "p80 TNF-alpha receptor" EXACT []
synonym: "TBP-2" EXACT []
synonym: "TBPII" EXACT []
synonym: "TNF-R2" EXACT []
synonym: "TNFBR" RELATED []
synonym: "Tnfr-2" RELATED []
synonym: "TNFR2" RELATED []
synonym: "TNFRSF1B" RELATED []
synonym: "Tumor necrosis factor receptor 2" EXACT []
synonym: "tumor necrosis factor receptor superfamily member 1b" EXACT []
synonym: "Tumor necrosis factor receptor superfamily member 1b, membrane form" EXACT []
synonym: "Tumor necrosis factor receptor type II" EXACT []
synonym: "Tumor necrosis factor-binding protein 2" EXACT []
xref: PIRSF:PIRSF001968
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001960
name: tumor necrosis factor receptor superfamily member 4
def: "A protein that is a translation product of the TNFRSF4 gene." [PRO:WCB]
comment: Category=gene.
synonym: "ACT35 antigen" EXACT []
synonym: "CD134" EXACT []
synonym: "OX40 antigen" EXACT []
synonym: "OX40L receptor" EXACT []
synonym: "TAX transcriptionally-activated glycoprotein 1 receptor" EXACT []
synonym: "TNFRSF4" RELATED []
synonym: "TXGP1L" RELATED []
xref: PIRSF:PIRSF038813
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001961
name: tumor necrosis factor receptor superfamily member 5
def: "A protein that is a translation product of the CD40 gene." [PRO:WCB]
comment: Category=gene.
synonym: "B-cell surface antigen CD40" EXACT []
synonym: "Bp50" EXACT []
synonym: "CD40" RELATED []
synonym: "CD40L receptor" EXACT []
synonym: "CDw40" EXACT []
synonym: "Tnfrsf5" RELATED []
xref: PIRSF:PIRSF038815
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001962
name: tumor necrosis factor receptor superfamily member 6
alt_id: PRO:000002232
def: "A protein that is a translation product of the FAS gene." [PRO:WCB]
comment: Category=gene.
synonym: "Apo-1 antigen" EXACT []
synonym: "Apoptosis-mediating surface antigen FAS" EXACT []
synonym: "Apt1" RELATED []
synonym: "APT1, FAS1, TNFRSF6" RELATED []
synonym: "Apt1, Tnfrsf6" RELATED []
synonym: "CD95" EXACT []
synonym: "FAS" RELATED []
synonym: "Fas" RELATED []
synonym: "FAS1" RELATED []
synonym: "FASLG receptor" EXACT []
synonym: "Tnfrsf6" RELATED []
synonym: "tumor necrosis factor receptor superfamily member 6" EXACT []
xref: PIRSF:PIRSF038809
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001963
name: tumor necrosis factor receptor superfamily member 7
def: "A protein that is a translation product of the CD27 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD27" RELATED []
synonym: "cd27 antigen" EXACT []
synonym: "CD27L receptor" EXACT []
synonym: "T-cell activation antigen CD27" EXACT []
synonym: "T14" EXACT []
synonym: "TNFRSF7" RELATED []
synonym: "Tumor necrosis factor receptor superfamily member 7" EXACT []
xref: PIRSF:PIRSF001966
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001964
name: tumor necrosis factor receptor superfamily member 8
def: "A protein that is a translation product of the TNFRSF8 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD30L receptor" EXACT []
synonym: "D1S166E" RELATED []
synonym: "KI-1 antigen" EXACT []
synonym: "Lymphocyte activation antigen CD30" EXACT []
synonym: "TNFRSF8" RELATED []
xref: PIRSF:PIRSF038810
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001965
name: tumor necrosis factor receptor superfamily member 9
def: "A protein that is a translation product of the TNFRSF9 gene." [PRO:WCB]
comment: Category=gene.
synonym: "4-1BB ligand receptor" EXACT []
synonym: "CD137" EXACT []
synonym: "CDw137" EXACT []
synonym: "Ly63" RELATED []
synonym: "T-cell antigen 4-1BB homolog" EXACT []
synonym: "T-cell antigen ILA" EXACT []
synonym: "TNFRSF9" RELATED []
xref: PIRSF:PIRSF038814
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001966
name: two pore calcium channel protein 2
def: "A protein that is a translation product of the TPCN2 gene." [PRO:WCB]
comment: Category=gene.
synonym: "TPC2" RELATED []
synonym: "TPCN2" RELATED []
synonym: "Voltage-dependent calcium channel protein TPC2" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001967
name: tyrosine-protein kinase TEC-type
def: "A protein with core architecture consisting of a PH domain (PF00169), a BTK-type zinc finger (PF00779), an SH3 domain (PF00018, an SH2 domain (PF00017), and a Protein typrosine kinase domain (PF07714)." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF000602
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001968
name: tyrosine-protein phosphatase non-receptor type substrate 1
def: "A protein that is a translation product of the SIRPA gene." [PRO:WCB]
comment: Category=gene.
synonym: "Brain Ig-like molecule with tyrosine-based activation motifs" EXACT []
synonym: "CD172 antigen-like family member A" EXACT []
synonym: "CD172a" EXACT []
synonym: "Inhibitory receptor SHPS-1" EXACT []
synonym: "Macrophage fusion receptor" EXACT []
synonym: "MFR" RELATED []
synonym: "mSIRP-alpha1" EXACT []
synonym: "MyD-1 antigen" EXACT []
synonym: "Myd1" RELATED []
synonym: "p84" EXACT []
synonym: "Ptpns1" RELATED []
synonym: "SHP substrate 1" EXACT []
synonym: "SHPS-1" EXACT []
synonym: "Shps1" RELATED []
synonym: "Signal regulatory protein alpha-1" EXACT []
synonym: "Sirp-alpha-1" EXACT []
synonym: "Sirp-alpha-2" EXACT []
synonym: "Sirp-alpha-3" EXACT []
synonym: "tyrosine-protein phosphatase non-receptor type substrate 1" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001969
name: urokinase plasminogen activator surface receptor
def: "A protein that is a translation product of the PLAUR gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD87" EXACT []
synonym: "Monocyte activation antigen Mo3" EXACT []
synonym: "U-PAR" EXACT []
synonym: "uPAR" EXACT []
synonym: "urokinase plasminogen activator surface receptor" EXACT []
xref: PIRSF:PIRSF002022
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001970
name: vascular cell adhesion protein 1
def: "A protein 1 that is a translation product of the VCAM1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD106" EXACT []
synonym: "INCAM-100" EXACT []
synonym: "L1CAM" RELATED []
synonym: "V-CAM 1" EXACT []
synonym: "vascular cell adhesion protein 1" EXACT []
synonym: "Vcam-1" RELATED []
synonym: "VCAM1" RELATED []
xref: PIRSF:PIRSF038689
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001971
name: vascular endothelial growth factor receptor
def: "A protein with core architecture consisting of a signal sequence, followed by 7 Ig-like domains (PF00047, PF07679, or PF07686), a transmembrane region, and a cytoplasmic Protein tyrosine kinase domain." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF038502
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001972
name: voltage-dependent T-type calcium channel subunit alpha-1G
def: "A protein that is a translation product of the CACNA1G gene." [PRO:WCB]
comment: Category=gene.
synonym: "CACNA1G" RELATED []
synonym: "Cav3.1c" EXACT []
synonym: "KIAA1123" RELATED []
synonym: "NBR13" EXACT []
synonym: "voltage-dependent t-type calcium channel subunit alpha-1g" EXACT []
synonym: "Voltage-gated calcium channel subunit alpha Cav3.1" EXACT []
xref: PANTHER:PTHR10037\:SF44
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001973
name: voltage-dependent T-type calcium channel subunit alpha-1I
def: "A protein that is a translation product of the CACNA1I gene." [PRO:WCB]
comment: Category=gene.
synonym: "Ca(v)3.3" EXACT []
synonym: "CACNA1I" RELATED []
synonym: "KIAA1120" RELATED []
synonym: "Voltage-gated calcium channel subunit alpha Cav3.3" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001974
name: voltage-gated calcium channel subunit alpha
def: "A protein with core architecture consisting of four similar domains (I-VI), each containing six transmembrane helices (S1-S6), with a pore loop between S5 and S6. The S4 segments contain positively charged amino acids at every third position and serve as voltage sensors. Four Ion transport protein domains (PF00520)are present. These may be followed by an IQ calmodulin-binding motif (PF00612)." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF005657
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001975
name: voltage-gated sodium channel subunit alpha
def: "A protein with core architecture consisting of four similar domains (I-VI), each containing six transmembrane helices (S1-S6), with a pore loop between S5 and S6. The S4 segments contain positively charged amino acids at every third position and serve as voltage sensors. These large proteins (about 2000 amino acids) contain a unique Sodium ion transport-associated domain (PF06512) located between two pairs of Ion transport protein domains (PF00520). An IQ calmodulin-binding motif (PF00612) may be found about 100 amino acids from the carboxyl end." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF002448
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000001976
name: zinc finger protein aiolos
def: "An ikaros-like zinc finger transcription factor that is a translation product of the IKZF3 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Ikaros family zinc finger protein 3" EXACT []
synonym: "IKZF3" RELATED []
synonym: "Zfpn1a3" RELATED []
synonym: "Znfn1a3" RELATED []
synonym: "ZNFN1A3" RELATED []
is_a: PRO:000002986 ! ikaros-like zinc finger transcription factor

[Term]
id: PRO:000001977
name: 5'-nucleotidase isoform 1
def: "A 5'-nucleotidase that is a translation product of a mature transcript of the NT5E gene. Represented by the sequence UniProtKB:P21589-1." [PRO:CNA]
comment: Category=sequence.
synonym: "5'-nucleotidase precursor" EXACT []
is_a: PRO:000001800 ! 5'-nucleotidase

[Term]
id: PRO:000001978
name: ATP-sensitive inward rectifier potassium channel 1
def: "A G protein-activated inward rectifier potassium channel that is a translation product of the KCNJ1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "ATP-regulated potassium channel ROM-K" EXACT []
synonym: "ATP-sensitive inward rectifier potassium channel 1" EXACT []
synonym: "KCNJ1" RELATED []
synonym: "Kir1.1" EXACT []
synonym: "Potassium channel, inwardly rectifying subfamily J member 1" EXACT []
synonym: "ROMK1" RELATED []
xref: PANTHER:PTHR11767\:SF6
is_a: PRO:000001814 ! G protein-activated inward rectifier potassium channel

[Term]
id: PRO:000001979
name: ATP-sensitive inward rectifier potassium channel 10
def: "A G protein-activated inward rectifier potassium channel that is a translation product of the KCNJ10 gene." [PRO:WCB]
comment: Category=gene.
synonym: "ATP-dependent inwardly rectifying potassium channel Kir4.1" EXACT []
synonym: "ATP-sensitive inward rectifier potassium channel 10" EXACT []
synonym: "Inward rectifier K(+) channel Kir1.2" EXACT []
synonym: "Inward rectifier K(+) channel Kir4.1" EXACT []
synonym: "KCNJ10" RELATED []
synonym: "Potassium channel, inwardly rectifying subfamily J member 10" EXACT []
xref: PANTHER:PTHR11767\:SF21
is_a: PRO:000001814 ! G protein-activated inward rectifier potassium channel

[Term]
id: PRO:000001980
name: ATP-sensitive inward rectifier potassium channel 11
def: "A G protein-activated inward rectifier potassium channel that is a translation product of the KCNJ11 gene." [PRO:WCB]
comment: Category=gene.
synonym: "IKATP" EXACT []
synonym: "Inward rectifier K(+) channel Kir6.2" EXACT []
synonym: "KCNJ11" RELATED []
synonym: "Potassium channel, inwardly rectifying subfamily J member 11" EXACT []
is_a: PRO:000001814 ! G protein-activated inward rectifier potassium channel

[Term]
id: PRO:000001981
name: ATP-sensitive inward rectifier potassium channel 12
def: "A G protein-activated inward rectifier potassium channel that is a translation product of the KCNJ12 gene." [PRO:WCB]
comment: Category=gene.
synonym: "ATP-sensitive inward rectifier potassium channel 12" EXACT []
synonym: "Inward rectifier K(+) channel Kir2.2" EXACT []
synonym: "IRK2" EXACT []
synonym: "KCNJ12" RELATED []
synonym: "KCNJN1" RELATED []
synonym: "Kir2.2v" EXACT []
synonym: "Potassium channel, inwardly rectifying subfamily J member 12" EXACT []
xref: PANTHER:PTHR11767\:SF14
is_a: PRO:000001814 ! G protein-activated inward rectifier potassium channel

[Term]
id: PRO:000001982
name: ATP-sensitive inward rectifier potassium channel 14
def: "A G protein-activated inward rectifier potassium channel that is a translation product of the KCNJ14 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Inward rectifier K(+) channel Kir2.4" EXACT []
synonym: "IRK4" EXACT []
synonym: "KCNJ14" RELATED []
synonym: "Potassium channel, inwardly rectifying subfamily J member 14" EXACT []
is_a: PRO:000001814 ! G protein-activated inward rectifier potassium channel

[Term]
id: PRO:000001983
name: ATP-sensitive inward rectifier potassium channel 15
def: "A G protein-activated inward rectifier potassium channel that is a translation product of the KCNJ15 gene." [PRO:WCB]
comment: Category=gene.
synonym: "ATP-sensitive inward rectifier potassium channel 15" EXACT []
synonym: "Inward rectifier K(+) channel Kir4.2" EXACT []
synonym: "KCNJ14" RELATED []
synonym: "KCNJ15" RELATED []
synonym: "Kir1.3" EXACT []
synonym: "Potassium channel, inwardly rectifying subfamily J member 15" EXACT []
xref: PANTHER:PTHR11767\:SF20
is_a: PRO:000001814 ! G protein-activated inward rectifier potassium channel

[Term]
id: PRO:000001984
name: ATP-sensitive inward rectifier potassium channel 8
def: "A G protein-activated inward rectifier potassium channel that is a translation product of the KCNJ8 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Inwardly rectifier K(+) channel Kir6.1" EXACT []
synonym: "KCNJ8" RELATED []
synonym: "Potassium channel, inwardly rectifying subfamily J member 8" EXACT []
synonym: "uKATP-1" EXACT []
is_a: PRO:000001814 ! G protein-activated inward rectifier potassium channel

[Term]
id: PRO:000001985
name: C-C motif chemokine 1
def: "A C/C-C motif small inducible chemokine that is a translation product of the CCL1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CCL1" RELATED []
synonym: "P500" EXACT []
synonym: "SCYA1" RELATED []
synonym: "SIS-epsilon" EXACT []
synonym: "Small-inducible cytokine A1" EXACT []
synonym: "T lymphocyte-secreted protein I-309" EXACT []
synonym: "T-cell activation protein TCA3" EXACT []
synonym: "TCA-3" EXACT []
is_a: PRO:000001808 ! C/C-C motif small inducible chemokine

[Term]
id: PRO:000001986
name: C-C motif chemokine 14
def: "A C/C-C motif small inducible chemokine that is a translation product of the CCL14 gene. This protein has not been found in mouse." [PRO:WCB]
comment: Category=gene.
synonym: "CCL14" RELATED []
synonym: "Chemokine CC-1/CC-3" EXACT []
synonym: "HCC-1(1-74" EXACT []
synonym: "HCC-1(3-74" EXACT []
synonym: "HCC-1(4-74" EXACT []
synonym: "HCC-1(9-74)" EXACT []
synonym: "HCC-1/HCC-3" EXACT []
synonym: "NCC-2" EXACT []
synonym: "NCC2" RELATED []
synonym: "SCYA14" RELATED []
synonym: "Small-inducible cytokine A14" EXACT []
is_a: PRO:000001808 ! C/C-C motif small inducible chemokine

[Term]
id: PRO:000001987
name: C-C motif chemokine 15
def: "A C/C-C motif small inducible chemokine that is a translation product of the CCL15 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CCL15" RELATED []
synonym: "CCL15(22-92" EXACT []
synonym: "CCL15(25-92" EXACT []
synonym: "CCL15(29-92)" EXACT []
synonym: "Chemokine CC-2" EXACT []
synonym: "HCC-2" EXACT []
synonym: "Leukotactin-1" EXACT []
synonym: "LKN-1" EXACT []
synonym: "Macrophage inflammatory protein 5" EXACT []
synonym: "MIP-1 delta" EXACT []
synonym: "MIP-5" EXACT []
synonym: "MIP5" RELATED []
synonym: "Mrp-2b" EXACT []
synonym: "NCC-3" EXACT []
synonym: "NCC3" RELATED []
synonym: "SCYA15" RELATED []
synonym: "Small-inducible cytokine A15" EXACT []
is_a: PRO:000001808 ! C/C-C motif small inducible chemokine

[Term]
id: PRO:000001988
name: C-C motif chemokine 16
def: "A C/C-C motif small inducible chemokine that is a translation product of the CCL16 gene. Not found in mouse." [PRO:WCB]
comment: Category=gene.
synonym: "CCL16" RELATED []
synonym: "Chemokine CC-4" EXACT []
synonym: "Chemokine LEC" EXACT []
synonym: "HCC-4" EXACT []
synonym: "IL-10-inducible chemokine" EXACT []
synonym: "ILINCK" RELATED []
synonym: "LCC-1" EXACT []
synonym: "Liver-expressed chemokine" EXACT []
synonym: "LMC" EXACT []
synonym: "Lymphocyte and monocyte chemoattractant" EXACT []
synonym: "Monotactin-1" EXACT []
synonym: "MTN-1" EXACT []
synonym: "NCC-4" EXACT []
synonym: "NCC4" RELATED []
synonym: "SCYA16" RELATED []
synonym: "Small-inducible cytokine A16" EXACT []
is_a: PRO:000001808 ! C/C-C motif small inducible chemokine

[Term]
id: PRO:000001989
name: C-C motif chemokine 17
def: "A C/C-C motif small inducible chemokine that is a translation product of the CCL17 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CC chemokine TARC" EXACT []
synonym: "CCL17" RELATED []
synonym: "SCYA17" RELATED []
synonym: "Small-inducible cytokine A17" EXACT []
synonym: "Thymus and activation-regulated chemokine" EXACT []
is_a: PRO:000001808 ! C/C-C motif small inducible chemokine

[Term]
id: PRO:000001990
name: C-C motif chemokine 18
def: "A C/C-C motif small inducible chemokine that is a translation product of the CCL18 gene. Not found in mouse." [PRO:WCB]
comment: Category=gene.
synonym: "Alternative macrophage activation-associated CC chemokine 1" EXACT []
synonym: "AMAC-1" EXACT []
synonym: "AMAC1" RELATED []
synonym: "CC chemokine PARC" EXACT []
synonym: "CCL18" RELATED []
synonym: "CCL18(1-68" EXACT []
synonym: "CCL18(3-69" EXACT []
synonym: "CCL18(4-69)" EXACT []
synonym: "DC-CK1" EXACT []
synonym: "DCCK1" RELATED []
synonym: "Dendritic cell chemokine 1" EXACT []
synonym: "Macrophage inflammatory protein 4" EXACT []
synonym: "MIP-4" EXACT []
synonym: "MIP4" RELATED []
synonym: "Pulmonary and activation-regulated chemokine" EXACT []
synonym: "SCYA18" RELATED []
synonym: "Small-inducible cytokine A18" EXACT []
is_a: PRO:000001808 ! C/C-C motif small inducible chemokine

[Term]
id: PRO:000001991
name: C-C motif chemokine 19
def: "A C/C-C motif small inducible chemokine that is a translation product of the CCL19 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Beta chemokine exodus-3" EXACT []
synonym: "CCL19" RELATED []
synonym: "CK beta-11" EXACT []
synonym: "EBI1-ligand chemokine" EXACT []
synonym: "ELC" EXACT []
synonym: "Epstein-Barr virus-induced molecule 1 ligand chemokine" EXACT []
synonym: "Macrophage inflammatory protein 3 beta" EXACT []
synonym: "MIP-3-beta" EXACT []
synonym: "MIP3B" RELATED []
synonym: "Scya19" RELATED []
synonym: "Small-inducible cytokine A19" EXACT []
is_a: PRO:000001808 ! C/C-C motif small inducible chemokine

[Term]
id: PRO:000001992
name: C-C motif chemokine 20
def: "A C/C-C motif small inducible chemokine that is a translation product of the CCL20 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Beta chemokine exodus-1" EXACT []
synonym: "CC chemokine LARC" EXACT []
synonym: "CC chemokine ST38" EXACT []
synonym: "CCL20" RELATED []
synonym: "CCL20(1-64" EXACT []
synonym: "CCL20(1-67" EXACT []
synonym: "CCL20(2-70)" EXACT []
synonym: "Liver and activation-regulated chemokine" EXACT []
synonym: "Macrophage inflammatory protein 3 alpha" EXACT []
synonym: "MIP-3-alpha" EXACT []
synonym: "MIP3A" RELATED []
synonym: "Scya20" RELATED []
synonym: "Small-inducible cytokine A20" EXACT []
is_a: PRO:000001808 ! C/C-C motif small inducible chemokine

[Term]
id: PRO:000001993
name: C-C motif chemokine 21
def: "A C/C-C motif small inducible chemokine that is a translation product of the CCL21 gene. Three genes code for CCL21 in mouse. Ccl21a and Ccl21c produce identical proteins while the protein produced by Ccl21b differs at only one position." [PRO:WCB]
comment: Category=gene.
synonym: "6Ckine" EXACT []
synonym: "Beta chemokine exodus-2" EXACT []
synonym: "CCL21" RELATED []
synonym: "CCL21A" RELATED []
synonym: "CCL21B" RELATED []
synonym: "CCL21C" RELATED []
synonym: "SCYA21" RELATED []
synonym: "Scya21" RELATED []
synonym: "Scya21b" RELATED []
synonym: "Secondary lymphoid-tissue chemokine" EXACT []
synonym: "SLC" EXACT []
synonym: "Small-inducible cytokine A21" EXACT []
synonym: "TCA4" EXACT []
synonym: "Thymus-derived chemotactic agent 4" EXACT []
is_a: PRO:000001808 ! C/C-C motif small inducible chemokine

[Term]
id: PRO:000001994
name: C-C motif chemokine 22
def: "A C/C-C motif small inducible chemokine that is a translation product of the CCL22 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Abcd1" RELATED []
synonym: "Activated B and dendritic cell-derived" EXACT []
synonym: "CC chemokine ABCD-1" EXACT []
synonym: "CC chemokine STCP-1" EXACT []
synonym: "CCL22" RELATED []
synonym: "Macrophage-derived chemokine" EXACT []
synonym: "Scya22" RELATED []
synonym: "Small-inducible cytokine A22" EXACT []
synonym: "Stimulated T-cell chemotactic protein 1" EXACT []
is_a: PRO:000001808 ! C/C-C motif small inducible chemokine

[Term]
id: PRO:000001995
name: C-C motif chemokine 23
def: "A C/C-C motif small inducible chemokine that is a translation product of the CCL23 gene. Not found in mouse." [PRO:WCB]
comment: Category=gene.
synonym: "CCL23" RELATED []
synonym: "CK-beta-8" EXACT []
synonym: "CKB-8" EXACT []
synonym: "Macrophage inflammatory protein 3" EXACT []
synonym: "MIP-3" EXACT []
synonym: "MIP3" RELATED []
synonym: "MPIF-1" EXACT []
synonym: "MPIF1" RELATED []
synonym: "Myeloid progenitor inhibitory factor 1" EXACT []
synonym: "SCYA23" RELATED []
synonym: "Small-inducible cytokine A23" EXACT []
is_a: PRO:000001808 ! C/C-C motif small inducible chemokine

[Term]
id: PRO:000001996
name: C-C motif chemokine 24
def: "A C/C-C motif small inducible chemokine that is a translation product of the CCL24 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CCL24" RELATED []
synonym: "CK-beta-6" EXACT []
synonym: "Eosinophil chemotactic protein 2" EXACT []
synonym: "Eotaxin-2" EXACT []
synonym: "MPIF-2" EXACT []
synonym: "MPIF2" RELATED []
synonym: "Myeloid progenitor inhibitory factor 2" EXACT []
synonym: "SCYA24" RELATED []
synonym: "Small-inducible cytokine A24" EXACT []
is_a: PRO:000001808 ! C/C-C motif small inducible chemokine

[Term]
id: PRO:000001997
name: C-C motif chemokine 26
def: "A C/C-C motif small inducible chemokine that is a translation product of the CCL26 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CC chemokine IMAC" EXACT []
synonym: "CCL26" RELATED []
synonym: "Eotaxin-3" EXACT []
synonym: "Macrophage inflammatory protein 4-alpha" EXACT []
synonym: "MIP-4-alpha" EXACT []
synonym: "SCYA26" RELATED []
synonym: "Small-inducible cytokine A26" EXACT []
synonym: "Thymic stroma chemokine-1" EXACT []
synonym: "TSC-1" EXACT []
is_a: PRO:000001808 ! C/C-C motif small inducible chemokine

[Term]
id: PRO:000001998
name: C-C motif chemokine 3/4
def: "A C/C-C motif small inducible chemokine that is a translation product of the CCL3, CCL3L1, or CCL4 gene." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF500569
is_a: PRO:000001808 ! C/C-C motif small inducible chemokine

[Term]
id: PRO:000001999
name: CD59A glycoprotein
def: "A CD59 glycoprotein that is a translation product of the mouse CD59A gene." [PRO:WCB]
comment: Category=gene.
is_a: PRO:000001809 ! CD59 glycoprotein

[Term]
id: PRO:000002000
name: CD59B glycoprotein
def: "A CD59 glycoprotein that is a translation product of the mouse CD59B gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD59 antigen" RELATED []
synonym: "MAC-inhibitory protein" EXACT []
synonym: "MAC-IP" EXACT []
synonym: "MACIF" EXACT []
synonym: "Membrane attack complex inhibition factor" EXACT []
synonym: "Protectin" EXACT []
is_a: PRO:000001809 ! CD59 glycoprotein

[Term]
id: PRO:000002001
name: FL cytokine receptor
def: "A CSF-1/PDGF receptor-type tyrosine-protein kinase that is a translation product of the FLT3 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD135" EXACT []
synonym: "Fetal liver kinase 2" EXACT []
synonym: "fl cytokine receptor" EXACT []
synonym: "Flt-3" RELATED []
synonym: "Stem cell tyrosine kinase 1" EXACT []
synonym: "STK-1" EXACT []
synonym: "STK1" RELATED []
synonym: "Tyrosine-protein kinase FLT3" EXACT []
synonym: "Tyrosine-protein kinase receptor flk-2" EXACT []
synonym: "Tyrosine-protein kinase receptor FLT3" EXACT []
xref: PIRSF:PIRSF500949
is_a: PRO:000001810 ! CSF-1/PDGF receptor-type tyrosine-protein kinase

[Term]
id: PRO:000002002
name: G protein-activated inward rectifier potassium channel 1
def: "A G protein-activated inward rectifier potassium channel that is a translation product of the KCNJ3 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Girk1" RELATED []
synonym: "Inward rectifier K(+) channel Kir3.1" EXACT []
synonym: "KCNJ3" RELATED []
synonym: "Potassium channel, inwardly rectifying subfamily J member 3" EXACT []
is_a: PRO:000001814 ! G protein-activated inward rectifier potassium channel

[Term]
id: PRO:000002003
name: G protein-activated inward rectifier potassium channel 2
def: "A G protein-activated inward rectifier potassium channel that is a translation product of the KCNJ6 gene." [PRO:WCB]
comment: Category=gene.
synonym: "BIR1" EXACT []
synonym: "G protein-activated inward rectifier potassium channel 2" EXACT []
synonym: "GIRK2" EXACT []
synonym: "Inward rectifier K(+) channel Kir3.2" EXACT []
synonym: "KATP-2" EXACT []
synonym: "KATP2" RELATED []
synonym: "KCNJ6" RELATED []
synonym: "KCNJ7" RELATED []
synonym: "Potassium channel, inwardly rectifying subfamily J member 6" EXACT []
xref: PANTHER:PTHR11767\:SF19
is_a: PRO:000001814 ! G protein-activated inward rectifier potassium channel

[Term]
id: PRO:000002004
name: G protein-activated inward rectifier potassium channel 3
def: "A G protein-activated inward rectifier potassium channel that is a translation product of the KCNJ9 gene." [PRO:WCB]
comment: Category=gene.
synonym: "G protein-activated inward rectifier potassium channel 3" EXACT []
synonym: "GIRK3" EXACT []
synonym: "Inwardly rectifier K(+) channel Kir3.3" EXACT []
synonym: "KCNJ9" RELATED []
synonym: "Potassium channel, inwardly rectifying subfamily J member 9" EXACT []
xref: PANTHER:PTHR11767\:SF17
is_a: PRO:000001814 ! G protein-activated inward rectifier potassium channel

[Term]
id: PRO:000002005
name: G protein-activated inward rectifier potassium channel 4
def: "A G protein-activated inward rectifier potassium channel that is a translation product of the KCNJ5 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Cardiac inward rectifier" EXACT []
synonym: "CIR" EXACT []
synonym: "GIRK4" RELATED []
synonym: "Heart KATP channel" EXACT []
synonym: "Inward rectifier K(+) channel Kir3.4" EXACT []
synonym: "KATP-1" EXACT []
synonym: "KCNJ5" RELATED []
synonym: "Potassium channel, inwardly rectifying subfamily J member 5" EXACT []
is_a: PRO:000001814 ! G protein-activated inward rectifier potassium channel

[Term]
id: PRO:000002006
name: H-2 class I histocompatibility antigen D alpha chain
def: "An MHC class I histocompatibility antigen alpha chain that is a translation product of the mouse H2-D1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "H-2D" EXACT []
synonym: "H2-D1" RELATED []
is_a: PRO:000001818 ! MHC class I histocompatibility antigen alpha chain

[Term]
id: PRO:000002007
name: H-2 class I histocompatibility antigen K alpha chain
def: "An MHC class I histocompatibility antigen alpha chain that is a translation product of the mouse H2-K1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "H2-K" EXACT []
synonym: "H2-K1" RELATED []
is_a: PRO:000001818 ! MHC class I histocompatibility antigen alpha chain

[Term]
id: PRO:000002008
name: H-2 class I histocompatibility antigen L alpha chain
def: "An MHC class I histocompatibility antigen alpha chain that is a translation product of the mouse H2-L gene." [PRO:WCB]
comment: Category=gene.
synonym: "H2-L" RELATED []
is_a: PRO:000001818 ! MHC class I histocompatibility antigen alpha chain

[Term]
id: PRO:000002009
name: HLA class I histocompatibility antigen A alpha chain
def: "An MHC class I histocompatibility antigen alpha chain that is a translation product of the human HLA-A gene." [PRO:WCB]
comment: Category=gene.
synonym: "HLA-A" RELATED []
synonym: "HLAA" RELATED []
synonym: "MHC class I antigen A alpha chain" EXACT []
is_a: PRO:000001818 ! MHC class I histocompatibility antigen alpha chain

[Term]
id: PRO:000002010
name: HLA class I histocompatibility antigen B alpha chain
def: "An MHC class I histocompatibility antigen alpha chain that is a translation product of the human HLA-B gene." [PRO:WCB]
comment: Category=gene.
synonym: "HLA-B" RELATED []
synonym: "HLAB" RELATED []
synonym: "MHC class I antigen B alpha chain" EXACT []
is_a: PRO:000001818 ! MHC class I histocompatibility antigen alpha chain

[Term]
id: PRO:000002011
name: HLA class I histocompatibility antigen Cw alpha chain
def: "An MHC class I histocompatibility antigen alpha chain that is a translation product of the human HLA-C gene." [PRO:WCB]
comment: Category=gene.
synonym: "HLA-C" RELATED []
synonym: "HLAC" RELATED []
synonym: "MHC class I antigen Cw alpha chain" EXACT []
is_a: PRO:000001818 ! MHC class I histocompatibility antigen alpha chain

[Term]
id: PRO:000002012
name: MHC class II histocompatibility antigen alpha chain HLA-DPA1
def: "An MHC class II histocompatibility antigen alpha chain that is a translation product of the human HLA-DPA1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "DP(W3" EXACT []
synonym: "DP(W4)" EXACT []
synonym: "HLA-DP1A" RELATED []
synonym: "HLA-SB alpha chain" EXACT []
synonym: "HLASB" RELATED []
synonym: "MHC class II DP3-alpha" EXACT []
is_a: PRO:000001820 ! MHC class II histocompatibility antigen alpha chain

[Term]
id: PRO:000002013
name: MHC class II histocompatibility antigen alpha chain HLA-DQA1/H2-AA
def: "An MHC class II histocompatibility antigen alpha chain that is a translation product of the mouse H2-AA gene, the human HLA-DQA1 gene, or orthologous genes in other species." [PRO:WCB]
comment: Category=gene.
synonym: "DC-1 alpha chain" EXACT []
synonym: "DC-alpha" EXACT []
synonym: "H-2 class II histocompatibility antigen, A-B alpha chain" EXACT []
synonym: "H-2 class II histocompatibility antigen, A-D alpha chain" EXACT []
synonym: "H-2 class II histocompatibility antigen, A-F alpha chain" EXACT []
synonym: "H-2 class II histocompatibility antigen, A-K alpha chain" EXACT []
synonym: "H-2 class II histocompatibility antigen, A-Q alpha chain" EXACT []
synonym: "H-2 class II histocompatibility antigen, A-R alpha chain" EXACT []
synonym: "H-2 class II histocompatibility antigen, A-S alpha chain" EXACT []
synonym: "H-2 class II histocompatibility antigen, I-E alpha chain" EXACT []
synonym: "HLA class II histocompatibility antigen, DQ(3) alpha chain" EXACT []
synonym: "HLA class II histocompatibility antigen, DQ(5) alpha chain" EXACT []
synonym: "HLA-DCA" EXACT []
synonym: "HLA-DQA1*05011" EXACT []
synonym: "HLA-DQA1*0502" EXACT []
synonym: "IAalpha" EXACT []
is_a: PRO:000001820 ! MHC class II histocompatibility antigen alpha chain

[Term]
id: PRO:000002014
name: MHC class II histocompatibility antigen alpha chain HLA-DQA2
def: "An MHC class II histocompatibility antigen alpha chain that is a translation product of the human HLA-DQA2 gene, which is closely related to the human HLA-DQA1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "DX alpha chain" EXACT []
synonym: "HLA-DQA1" EXACT []
synonym: "HLA-DXA" RELATED []
is_a: PRO:000001820 ! MHC class II histocompatibility antigen alpha chain

[Term]
id: PRO:000002015
name: MHC class II histocompatibility antigen alpha chain HLA-DRA/H2-EA
def: "An MHC class II histocompatibility antigen alpha chain that is a translation product of the human HLA-DRA gene, the mouse H2-EA gene, or orthologous genes in other species." [PRO:WCB]
comment: Category=gene.
synonym: "H-2 class II histocompatibility antigen, E-K alpha chain" EXACT []
synonym: "H-2 class II histocompatibility antigen, E-U alpha chain" EXACT []
synonym: "H2-IE-alpha" EXACT []
synonym: "HLA class II histocompatibility antigen, DR alpha chain" EXACT []
synonym: "HLA-DRA" RELATED []
synonym: "HLA-DRA1" RELATED []
synonym: "MHC class II antigen DRA" EXACT []
is_a: PRO:000001820 ! MHC class II histocompatibility antigen alpha chain

[Term]
id: PRO:000002016
name: MHC class II histocompatibility antigen beta chain HLA-DPB1
def: "An MHC class II histocompatibility antigen beta chain that is a translation product of the HLA-DPB1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "SB-2-beta" EXACT []
is_a: PRO:000001821 ! MHC class II histocompatibility antigen beta chain

[Term]
id: PRO:000002017
name: MHC class II histocompatibility antigen beta chain HLA-DQB1/H2-AB1
def: "An MHC class II histocompatibility antigen beta chain that is a translation product of the mouse H2-AB1 gene, the human HLA-DQB1 gene, or orthologous genes in other species." [PRO:WCB]
comment: Category=gene.
is_a: PRO:000001821 ! MHC class II histocompatibility antigen beta chain

[Term]
id: PRO:000002018
name: MHC class II histocompatibility antigen beta chain HLA-DQB2
def: "An MHC class II histocompatibility antigen beta chain that is a translation product of the HLA-DQB2 gene, which is closely related to the HLA-DQB1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "HLA-DXB" RELATED []
is_a: PRO:000001821 ! MHC class II histocompatibility antigen beta chain

[Term]
id: PRO:000002019
name: MHC class II histocompatibility antigen beta chain HLA-DRB1/H2-EB1
def: "An MHC class II histocompatibility antigen beta chain that is a translation product of the human HLA-DRB1 gene, the mouse H2-EB1 gene, or orthologous genes in other species." [PRO:WCB]
comment: Category=gene.
is_a: PRO:000001821 ! MHC class II histocompatibility antigen beta chain

[Term]
id: PRO:000002020
name: MHC class II histocompatibility antigen beta chain HLA-DRB3
def: "An MHC class II histocompatibility antigen beta chain that is a translation product of the HLA-DRB3 gene." [PRO:WCB]
comment: Category=gene.
is_a: PRO:000001821 ! MHC class II histocompatibility antigen beta chain

[Term]
id: PRO:000002021
name: MHC class II histocompatibility antigen beta chain HLA-DRB4
def: "An MHC class II histocompatibility antigen beta chain that is a translation product of the HLA-DRB4 gene." [PRO:WCB]
comment: Category=gene.
synonym: "hla class ii histocompatibility antigen, dr-w53 beta chain" EXACT []
is_a: PRO:000001821 ! MHC class II histocompatibility antigen beta chain

[Term]
id: PRO:000002022
name: MHC class II histocompatibility antigen beta chain HLA-DRB5
def: "An MHC class II histocompatibility antigen beta chain that is a translation product of the HLA-DRB5 gene." [PRO:WCB]
comment: Category=gene.
synonym: "DR beta-5" EXACT []
synonym: "DR2-beta-2" EXACT []
synonym: "Dw2" EXACT []
is_a: PRO:000001821 ! MHC class II histocompatibility antigen beta chain

[Term]
id: PRO:000002023
name: NKG2-A/NKG2-B type II integral membrane protein
def: "A natural killer cell receptor NKG2 that is a translation product of the KLRC1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD159 antigen-like family member A" EXACT []
synonym: "CD159a" EXACT []
synonym: "KLRC1" RELATED []
synonym: "NK cell receptor A" EXACT []
synonym: "NKG2-A/B-activating NK receptor" EXACT []
synonym: "NKG2A" RELATED []
is_a: PRO:000001897 ! natural killer cell receptor NKG2

[Term]
id: PRO:000002024
name: NKG2-C type II integral membrane protein
def: "A natural killer cell receptor NKG2 that is a translation product of the KLRC2 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD159 antigen-like family member C" EXACT []
synonym: "CD159c" EXACT []
synonym: "KLRC2" RELATED []
synonym: "NK cell receptor C" EXACT []
synonym: "NKG2-C-activating NK receptor" EXACT []
synonym: "NKG2C" RELATED []
is_a: PRO:000001897 ! natural killer cell receptor NKG2

[Term]
id: PRO:000002025
name: T-cell surface glycoprotein CD1a
def: "A T-cell surface glycoprotein CD1 that is a translation product of the CD1A gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD1a" EXACT []
synonym: "hTa1 thymocyte antigen" EXACT []
synonym: "T-cell surface antigen T6/Leu-6" EXACT []
is_a: PRO:000001838 ! T-cell surface glycoprotein CD1

[Term]
id: PRO:000002026
name: T-cell surface glycoprotein CD1b
def: "A T-cell surface glycoprotein CD1 that is a translation product of the CD1B gene." [PRO:WCB]
comment: Category=gene.
is_a: PRO:000001838 ! T-cell surface glycoprotein CD1

[Term]
id: PRO:000002027
name: T-cell surface glycoprotein CD1c
def: "A T-cell surface glycoprotein CD1 that is a translation product of the CD1C gene." [PRO:WCB]
comment: Category=gene.
is_a: PRO:000001838 ! T-cell surface glycoprotein CD1

[Term]
id: PRO:000002028
name: T-cell surface glycoprotein CD1d
def: "A T-cell surface glycoprotein CD1 that is a translation product of the CD1D gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD1.1" EXACT []
synonym: "R3G1" EXACT []
synonym: "T-cell surface glycoprotein CD1d1" EXACT []
is_a: PRO:000001838 ! T-cell surface glycoprotein CD1

[Term]
id: PRO:000002029
name: T-cell surface glycoprotein CD1e
def: "A T-cell surface glycoprotein CD1 that is a translation product of the CD1E gene." [PRO:WCB]
comment: Category=gene.
synonym: "R2G1" EXACT []
is_a: PRO:000001838 ! T-cell surface glycoprotein CD1

[Term]
id: PRO:000002030
name: alpha-type platelet-derived growth factor receptor
def: "A CSF-1/PDGF receptor-type tyrosine-protein kinase that is a translation product of the PDGFRA gene." [PRO:WCB]
comment: Category=gene.
synonym: "alpha-type platelet-derived growth factor receptor" EXACT []
synonym: "CD140 antigen-like family member A" EXACT []
synonym: "CD140a antigen" EXACT []
synonym: "PDGF-R-alpha" EXACT []
xref: PANTHER:PTHR23256\:SF207
xref: PIRSF:PIRSF500950
is_a: PRO:000001810 ! CSF-1/PDGF receptor-type tyrosine-protein kinase

[Term]
id: PRO:000002031
name: aminopeptidase N
def: "A membrane alanyl aminopeptidase-like metallopeptidase that is a translation product of the ANPEP gene." [PRO:WCB]
comment: Category=gene.
synonym: "Aminopeptidase M" EXACT []
synonym: "ANPEP" RELATED []
synonym: "gp150" EXACT []
synonym: "hAPN" EXACT []
synonym: "Lap-1" RELATED []
synonym: "Lap1" RELATED []
synonym: "mAPN" EXACT []
synonym: "Membrane protein p161" EXACT []
synonym: "Microsomal aminopeptidase" EXACT []
synonym: "Myeloid plasma membrane glycoprotein CD13" EXACT []
synonym: "PEPN" RELATED []
is_a: PRO:000001888 ! membrane alanyl aminopeptidase-like metallopeptidase

[Term]
id: PRO:000002032
name: angiopoietin-1 receptor
def: "A receptor-type tyrosine-protein kinase Tie that is a translation product of the TEK gene." [PRO:WCB]
comment: Category=gene.
synonym: "angiopoietin-1 receptor" EXACT []
synonym: "CD202b" EXACT []
synonym: "hTIE2" EXACT []
synonym: "HYK" EXACT []
synonym: "mTIE2" EXACT []
synonym: "p140 TEK" EXACT []
synonym: "STK1" EXACT []
synonym: "Tunica interna endothelial cell kinase" EXACT []
synonym: "Tyrosine-protein kinase receptor TEK" EXACT []
synonym: "Tyrosine-protein kinase receptor TIE-2" EXACT []
xref: PANTHER:PTHR23256\:SF90
is_a: PRO:000001923 ! receptor-type tyrosine-protein kinase Tie

[Term]
id: PRO:000002033
name: band 3 anion transport protein
def: "A band 3-likeprotein that is a translation product of the SLC4A1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "AE 1" EXACT []
synonym: "AE1" RELATED []
synonym: "Anion exchange protein 1" EXACT []
synonym: "CD233" EXACT []
synonym: "DI" RELATED []
synonym: "EPB3" RELATED []
synonym: "MEB3" EXACT []
synonym: "Solute carrier family 4 member 1" EXACT []
is_a: PRO:000001845 ! band 3-like protein

[Term]
id: PRO:000002034
name: basigin isoform 1 cleaved form
def: "A basigin isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000001846 ! basigin isoform 1
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000002035
name: beta-type platelet-derived growth factor receptor
def: "A CSF-1/PDGF receptor-type tyrosine-protein kinase that is a translation product of the PDGFRB gene." [PRO:WCB]
comment: Category=gene.
synonym: "beta-type platelet-derived growth factor receptor" EXACT []
synonym: "CD140 antigen-like family member B" EXACT []
synonym: "CD140b" EXACT []
synonym: "PDGF-R-beta" EXACT []
xref: PIRSF:PIRSF500948
is_a: PRO:000001810 ! CSF-1/PDGF receptor-type tyrosine-protein kinase

[Term]
id: PRO:000002036
name: butyrophilin subfamily 3 member A1
def: "A butyrophilin that is a translation product of the BTN3A1 gene. There is no mouse ortholog." [PRO:WCB]
comment: Category=gene.
synonym: "BTF5" RELATED []
synonym: "CD277" EXACT []
is_a: PRO:000001848 ! butyrophilin

[Term]
id: PRO:000002037
name: complement component C1q receptor
def: "A thrombomodulin-like receptor that is a translation product of the CD93 gene." [PRO:WCB]
comment: Category=gene.
synonym: "C1q/MBL/SPA receptor" EXACT []
synonym: "C1qr1" RELATED []
synonym: "C1qRp" EXACT []
synonym: "CDw93" EXACT []
synonym: "Cell surface antigen AA4" EXACT []
synonym: "Complement component 1 q subcomponent receptor 1" EXACT []
synonym: "Ly-68" EXACT []
synonym: "Ly68" RELATED []
synonym: "Lymphocyte antigen 68" EXACT []
synonym: "Matrix-remodeling-associated protein 4" EXACT []
synonym: "MXRA4" RELATED []
is_a: PRO:000001938 ! thrombomodulin-like receptor

[Term]
id: PRO:000002038
name: eotaxin-like cytokine
def: "A C/C-C motif small inducible chemokine that is a member of a subfamily that includes eotaxin." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF500572
is_a: PRO:000001808 ! C/C-C motif small inducible chemokine

[Term]
id: PRO:000002039
name: glutamyl aminopeptidase
def: "A membrane alanyl aminopeptidase-like metallopeptidase that is a translation product of the ENPEP gene." [PRO:WCB]
comment: Category=gene.
synonym: "Aminopeptidase A" EXACT []
synonym: "APA" EXACT []
synonym: "BP-1/6C3 antigen" EXACT []
synonym: "CD249" EXACT []
synonym: "Differentiation antigen gp160" EXACT []
synonym: "EAP" EXACT []
synonym: "ENPEP" RELATED []
is_a: PRO:000001888 ! membrane alanyl aminopeptidase-like metallopeptidase

[Term]
id: PRO:000002040
name: integrin beta-1
def: "An integrin beta that is a translation product of the ITGB1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD29" EXACT []
synonym: "Fibronectin receptor subunit beta" EXACT []
synonym: "FNRB" RELATED []
synonym: "integrin beta-1" EXACT []
synonym: "Integrin VLA-4 subunit beta" EXACT []
synonym: "ITGB1" RELATED []
synonym: "MDF2" RELATED []
synonym: "MSK12" RELATED []
xref: PANTHER:PTHR10082\:SF14
is_a: PRO:000001861 ! integrin beta

[Term]
id: PRO:000002041
name: integrin beta-2
def: "An integrin beta that is a translation product of the ITGB2 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD18" EXACT []
synonym: "Cell surface adhesion glycoproteins LFA-1/CR3/p150,95 subunit beta" EXACT []
synonym: "Complement receptor C3 subunit beta" EXACT []
synonym: "integrin beta-2" EXACT []
synonym: "ITGB2" RELATED []
synonym: "MFI7" RELATED []
xref: PANTHER:PTHR10082\:SF15
is_a: PRO:000001861 ! integrin beta

[Term]
id: PRO:000002042
name: integrin beta-3
def: "An integrin beta that is a translation product of the ITGB3 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD61" EXACT []
synonym: "GP3A" RELATED []
synonym: "GPIIIa" EXACT []
synonym: "integrin beta-3" EXACT []
synonym: "ITGB3" RELATED []
synonym: "Platelet membrane glycoprotein IIIa" EXACT []
xref: PANTHER:PTHR10082\:SF10
is_a: PRO:000001861 ! integrin beta

[Term]
id: PRO:000002043
name: interferon regulatory factor 1
def: "An interferon regulatory factor 1/2 that is a translation product of the IRF1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "IRF-1" EXACT []
synonym: "IRF1" RELATED []
is_a: PRO:000001862 ! interferon regulatory factor 1/2

[Term]
id: PRO:000002044
name: interferon regulatory factor 2
def: "An interferon regulatory factor 1/2 that is a translation product of the IRF2 gene." [PRO:WCB]
comment: Category=gene.
synonym: "IRF-2" EXACT []
synonym: "IRF2" RELATED []
is_a: PRO:000001862 ! interferon regulatory factor 1/2

[Term]
id: PRO:000002045
name: interferon regulatory factor 3
def: "An interferon regulatory factor 3-9 that is a translation product of the IRF3 gene." [PRO:WCB]
comment: Category=gene.
synonym: "IRF-3" EXACT []
synonym: "IRF3" RELATED []
is_a: PRO:000001863 ! interferon regulatory factor 3-9

[Term]
id: PRO:000002046
name: interferon regulatory factor 4
def: "An interferon regulatory factor 3-9 that is a translation product of the IRF4 gene." [PRO:WCB]
comment: Category=gene.
synonym: "IRF-4" EXACT []
synonym: "IRF4" RELATED []
synonym: "LSIRF" EXACT []
synonym: "Lymphocyte-specific interferon regulatory factor" EXACT []
synonym: "Multiple myeloma oncogene 1" EXACT []
synonym: "MUM1" RELATED []
synonym: "NF-EM5" EXACT []
synonym: "PU.1 interaction partner" EXACT []
synonym: "Spip" RELATED []
synonym: "Transcriptional activator PIP" EXACT []
is_a: PRO:000001863 ! interferon regulatory factor 3-9

[Term]
id: PRO:000002047
name: interferon regulatory factor 5
def: "An interferon regulatory factor 3-9 that is a translation product of the IRF5 gene." [PRO:WCB]
comment: Category=gene.
synonym: "IRF-5" EXACT []
synonym: "IRF5" RELATED []
is_a: PRO:000001863 ! interferon regulatory factor 3-9

[Term]
id: PRO:000002048
name: interferon regulatory factor 6
def: "An interferon regulatory factor 3-9 that is a translation product of the IRF6 gene." [PRO:WCB]
comment: Category=gene.
synonym: "IRF-6" EXACT []
synonym: "IRF6" RELATED []
is_a: PRO:000001863 ! interferon regulatory factor 3-9

[Term]
id: PRO:000002049
name: interferon regulatory factor 7
def: "An interferon regulatory factor 3-9 that is a translation product of the IRF7 gene." [PRO:WCB]
comment: Category=gene.
synonym: "IRF-7" EXACT []
synonym: "IRF7" RELATED []
is_a: PRO:000001863 ! interferon regulatory factor 3-9

[Term]
id: PRO:000002050
name: interferon regulatory factor 8
def: "An interferon regulatory factor 3-9 that is a translation product of the IRF8 gene." [PRO:WCB]
comment: Category=gene.
synonym: "ICSBP" EXACT []
synonym: "Icsbp1" RELATED []
synonym: "Interferon consensus sequence-binding protein" EXACT []
synonym: "IRF-8" EXACT []
synonym: "IRF8" RELATED []
is_a: PRO:000001863 ! interferon regulatory factor 3-9

[Term]
id: PRO:000002051
name: interferon regulatory factor 9
def: "An interferon regulatory factor 3-9 that is a translation product of the IRF9 gene." [PRO:WCB]
comment: Category=gene.
synonym: "IFN-alpha-responsive transcription factor subunit" EXACT []
synonym: "Interferon-stimulated gene factor 3 gamma" EXACT []
synonym: "IRF-9" EXACT []
synonym: "IRF9" RELATED []
synonym: "ISGF-3 gamma" EXACT []
synonym: "ISGF3 p48 subunit" EXACT []
synonym: "ISGF3G" RELATED []
synonym: "Transcriptional regulator ISGF3 subunit gamma" EXACT []
is_a: PRO:000001863 ! interferon regulatory factor 3-9

[Term]
id: PRO:000002052
name: interferon-induced transmembrane protein 1
def: "An interferon-induced transmembrane protein that is a translation product of the human IFITM1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD225" EXACT []
synonym: "IFI17" RELATED []
synonym: "Interferon-induced protein 17" EXACT []
synonym: "Interferon-inducible protein 9-27" EXACT []
synonym: "Leu-13 antigen" EXACT []
is_a: PRO:000001864 ! interferon-induced transmembrane protein

[Term]
id: PRO:000002053
name: interferon-induced transmembrane protein 2
def: "A protein that is a translation product of the human IFITM2 gene." [PRO:WCB]
comment: Category=gene.
synonym: "IFITM2" RELATED []
synonym: "Interferon-inducible protein 1-8D" EXACT []
is_a: PRO:000001864 ! interferon-induced transmembrane protein

[Term]
id: PRO:000002054
name: inward rectifier potassium channel 13
def: "A G protein-activated inward rectifier potassium channel that is a translation product of the KCNJ13 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Inward rectifier K(+) channel Kir7.1" EXACT []
synonym: "inward rectifier potassium channel 13" EXACT []
synonym: "KCNJ13" RELATED []
synonym: "Potassium channel, inwardly rectifying subfamily J member 13" EXACT []
xref: PANTHER:PTHR11767\:SF3
is_a: PRO:000001814 ! G protein-activated inward rectifier potassium channel

[Term]
id: PRO:000002055
name: inward rectifier potassium channel 16
def: "A G protein-activated inward rectifier potassium channel that is a translation product of the KCNJ16 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Inward rectifier K(+) channel Kir5.1" EXACT []
synonym: "inward rectifier potassium channel 16" EXACT []
synonym: "KCNJ16" RELATED []
synonym: "Potassium channel, inwardly rectifying subfamily J member 16" EXACT []
xref: PANTHER:PTHR11767\:SF24
is_a: PRO:000001814 ! G protein-activated inward rectifier potassium channel

[Term]
id: PRO:000002056
name: inward rectifier potassium channel 2
def: "A G protein-activated inward rectifier potassium channel that is a translation product of the KCNJ2 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Cardiac inward rectifier potassium channel" EXACT []
synonym: "HIRK1" RELATED []
synonym: "Inward rectifier K(+) channel Kir2.1" EXACT []
synonym: "inward rectifier potassium channel 2" EXACT []
synonym: "IRK1" EXACT []
synonym: "KCNJ2" RELATED []
synonym: "Potassium channel, inwardly rectifying subfamily J member 2" EXACT []
xref: PANTHER:PTHR11767\:SF15
is_a: PRO:000001814 ! G protein-activated inward rectifier potassium channel

[Term]
id: PRO:000002057
name: inward rectifier potassium channel 4
def: "A G protein-activated inward rectifier potassium channel that is a translation product of the KCNJ4 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Hippocampal inward rectifier" EXACT []
synonym: "HIR" EXACT []
synonym: "HIRK2" EXACT []
synonym: "HRK1" EXACT []
synonym: "Inward rectifier K(+) channel Kir2.3" EXACT []
synonym: "inward rectifier potassium channel 4" EXACT []
synonym: "IRK3" EXACT []
synonym: "KCNJ4" RELATED []
synonym: "Potassium channel, inwardly rectifying subfamily J member 4" EXACT []
xref: PANTHER:PTHR11767\:SF13
is_a: PRO:000001814 ! G protein-activated inward rectifier potassium channel

[Term]
id: PRO:000002058
name: low-density lipoprotein receptor-related protein 1
def: "An LDL receptor-related protein that is a translation product of the LRP1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "A2MR" EXACT []
synonym: "Alpha-2-macroglobulin receptor" EXACT []
synonym: "APOER" EXACT []
synonym: "Apolipoprotein E receptor" EXACT []
synonym: "APR" RELATED []
synonym: "CD91" EXACT []
synonym: "Low-density lipoprotein receptor-related protein 1 515 kDa subunit" EXACT []
synonym: "Low-density lipoprotein receptor-related protein 1 85 kDa subunit" EXACT []
synonym: "Low-density lipoprotein receptor-related protein 1 intracellular domain" EXACT []
synonym: "LRP-515" EXACT []
synonym: "LRP-85" EXACT []
synonym: "LRPICD" EXACT []
is_a: PRO:000001817 ! LDL receptor-related protein

[Term]
id: PRO:000002059
name: lymphotactin-like chemokine
def: "A C/C-C motif small inducible chemokine that is a translation product of the XCL1 or closely related XCL2 gene." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF500571
is_a: PRO:000001808 ! C/C-C motif small inducible chemokine

[Term]
id: PRO:000002060
name: lysosome-associated membrane glycoprotein 1
def: "A lysosome-associated membrane protein that is a translation product of the LAMP1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "120 kDa lysosomal membrane glycoprotein" EXACT []
synonym: "CD107 antigen-like family member A" EXACT []
synonym: "CD107a" EXACT []
synonym: "LAMP-1" EXACT []
synonym: "LAMP1" RELATED []
synonym: "LGP-120" EXACT []
synonym: "LGP-A" EXACT []
synonym: "Lysosomal membrane glycoprotein A" EXACT []
synonym: "P2B" EXACT []
is_a: PRO:000001883 ! lysosome-associated membrane protein

[Term]
id: PRO:000002061
name: lysosome-associated membrane glycoprotein 2
def: "A lysosome-associated membrane protein that is a translation product of the LAMP2 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD107 antigen-like family member B" EXACT []
synonym: "CD107b" EXACT []
synonym: "LAMP-2" EXACT []
synonym: "LAMP2" RELATED []
synonym: "LGP-B" EXACT []
synonym: "Lysosomal membrane glycoprotein type B" EXACT []
is_a: PRO:000001883 ! lysosome-associated membrane protein

[Term]
id: PRO:000002062
name: macrophage colony-stimulating factor 1 receptor
def: "A CSF-1/PDGF receptor-type tyrosine-protein kinase that is a translation product of the CSF1R gene." [PRO:WCB]
comment: Category=gene.
synonym: "c-fms" EXACT []
synonym: "CD115" EXACT []
synonym: "CSF-1-R" EXACT []
synonym: "Csfmr" RELATED []
synonym: "Fim-2" RELATED []
synonym: "Fms proto-oncogene" EXACT []
synonym: "M-CSFR " RELATED []
xref: PIRSF:PIRSF500947
is_a: PRO:000001810 ! CSF-1/PDGF receptor-type tyrosine-protein kinase

[Term]
id: PRO:000002063
name: macrophage-stimulating protein receptor
def: "A HGF/MSP receptor type tyrosine-protein kinase that is a translation product of the MST1R gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD136" EXACT []
synonym: "CDw136" EXACT []
synonym: "Macrophage-stimulating protein receptor alpha chain" EXACT []
synonym: "Macrophage-stimulating protein receptor beta chain" EXACT []
synonym: "p185-Ron" EXACT []
synonym: "PTK8" RELATED []
synonym: "Stem cell-derived tyrosine kinase" EXACT []
synonym: "Stk" RELATED []
is_a: PRO:000001816 ! HGF/MSP receptor type tyrosine-protein kinase

[Term]
id: PRO:000002064
name: macrosialin
def: "A lysosome-associated membrane protein that is a translation product of the CD68 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD68" RELATED []
synonym: "Gp110" EXACT []
is_a: PRO:000001883 ! lysosome-associated membrane protein

[Term]
id: PRO:000002065
name: mast/stem cell growth factor receptor
def: "A CSF-1/PDGF receptor-type tyrosine-protein kinase that is a translation product of the KIT gene." [PRO:WCB]
comment: Category=gene.
synonym: "c-kit" EXACT []
synonym: "CD117" EXACT []
synonym: "mast/stem cell growth factor receptor" EXACT []
synonym: "Proto-oncogene tyrosine-protein kinase Kit" EXACT []
synonym: "SCFR" EXACT []
xref: PIRSF:PIRSF500951
is_a: PRO:000001810 ! CSF-1/PDGF receptor-type tyrosine-protein kinase

[Term]
id: PRO:000002066
name: neural cell adhesion molecule L1
def: "A neural cell adhesion molecule-like protein that is a translation product of the L1CAM gene." [PRO:WCB]
comment: Category=gene.
synonym: "CAML1" RELATED []
synonym: "CD171" EXACT []
synonym: "MIC5" RELATED []
synonym: "N-CAM L1" EXACT []
is_a: PRO:000001899 ! neural cell adhesion molecule-like protein

[Term]
id: PRO:000002067
name: poliovirus receptor
def: "A poliovirus receptor-related protein that is a translation product of the PVR gene." [PRO:WCB]
comment: Category=gene.
synonym: " PVR" RELATED []
synonym: "CD155" EXACT []
synonym: "Necl-5" EXACT []
synonym: "Nectin-like protein 5" EXACT []
synonym: "PVS" RELATED []
is_a: PRO:000001911 ! poliovirus receptor-related protein

[Term]
id: PRO:000002068
name: poliovirus receptor-related protein 1
def: "A poliovirus receptor-related protein that is a translation product of the PVRL1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD111" EXACT []
synonym: "Herpes virus entry mediator C" EXACT []
synonym: "Herpesvirus Ig-like receptor" EXACT []
synonym: "HIgR" EXACT []
synonym: "HveC" EXACT []
synonym: "Nectin-1" EXACT []
synonym: "Prr1" RELATED []
synonym: "PVRL1" RELATED []
is_a: PRO:000001911 ! poliovirus receptor-related protein

[Term]
id: PRO:000002069
name: poliovirus receptor-related protein 2
def: "A poliovirus receptor-related protein that is a translation product of the PVRL2 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD112" EXACT []
synonym: "Herpes virus entry mediator B" EXACT []
synonym: "HveB" EXACT []
synonym: "mHveB" EXACT []
synonym: "Mph" RELATED []
synonym: "Murine herpesvirus entry protein B" EXACT []
synonym: "Nectin-2" EXACT []
synonym: "Poliovirus receptor homolog" EXACT []
synonym: "PRR2" RELATED []
synonym: "PVRL2" RELATED []
synonym: "Pvs" RELATED []
is_a: PRO:000001911 ! poliovirus receptor-related protein

[Term]
id: PRO:000002070
name: poliovirus receptor-related protein 3
def: "A poliovirus receptor-related protein that is a translation product of the PVRL3 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD113" EXACT []
synonym: "CDw113" EXACT []
synonym: "Cell adhesion molecule nectin-3" EXACT []
synonym: "PRR3" RELATED []
synonym: "PVRL3" RELATED []
is_a: PRO:000001911 ! poliovirus receptor-related protein

[Term]
id: PRO:000002071
name: potassium channel subfamily K member 1
def: "A potassium channel, TWIK-1-related that is a translation product of the KCNK1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "HOHO1" RELATED []
synonym: "Inward rectifying potassium channel protein TWIK-1" EXACT []
synonym: "KCNK1" RELATED []
synonym: "Potassium channel KCNO1" EXACT []
xref: PANTHER:PTHR11003\:SF27
is_a: PRO:000001917 ! potassium channel, TWIK-1-related

[Term]
id: PRO:000002072
name: potassium channel subfamily K member 12
def: "A potassium channel, TWIK-1-related that is a translation product of the KCNK12 gene." [PRO:WCB]
comment: Category=gene.
synonym: "KCNK12" RELATED []
synonym: "Tandem pore domain halothane-inhibited potassium channel 2" EXACT []
synonym: "THIK-2" EXACT []
xref: PIRSF:PIRSF501078
is_a: PRO:000001917 ! potassium channel, TWIK-1-related

[Term]
id: PRO:000002073
name: potassium channel subfamily K member 13
def: "A potassium channel, TWIK-1-related that is a translation product of the KCNK13 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Gm1570" RELATED []
synonym: "KCNK13" RELATED []
synonym: "Tandem pore domain halothane-inhibited potassium channel 1" EXACT []
synonym: "THIK-1" EXACT []
xref: PIRSF:PIRSF501077
is_a: PRO:000001917 ! potassium channel, TWIK-1-related

[Term]
id: PRO:000002074
name: potassium channel subfamily K member 15
def: "A potassium channel, TWIK-1-related that is a translation product of the KCNK15 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Acid-sensitive potassium channel protein TASK-5" EXACT []
synonym: "KCNK15" RELATED []
synonym: "TWIK-related acid-sensitive K(+) channel 5" EXACT []
synonym: "Two pore potassium channel KT3.3" EXACT []
xref: PANTHER:PTHR11003\:SF18
is_a: PRO:000001917 ! potassium channel, TWIK-1-related

[Term]
id: PRO:000002075
name: potassium channel subfamily K member 17
def: "A potassium channel, TWIK-1-related that is a translation product of the KCNK17 gene." [PRO:WCB]
comment: Category=gene.
synonym: "2P domain potassium channel Talk-2" EXACT []
synonym: "KCNK17" RELATED []
synonym: "TALK2" RELATED []
synonym: "TASK-4" EXACT []
synonym: "TASK4" RELATED []
synonym: "TWIK-related acid-sensitive K(+) channel 4" EXACT []
synonym: "TWIK-related alkaline pH-activated K(+) channel 2" EXACT []
is_a: PRO:000001917 ! potassium channel, TWIK-1-related

[Term]
id: PRO:000002076
name: potassium channel subfamily K member 3
def: "A potassium channel, TWIK-1-related that is a translation product of the KCNK3 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Acid-sensitive potassium channel protein TASK-1" EXACT []
synonym: "Cardiac two pore background K(+) channel" EXACT []
synonym: "cTBAK-1" EXACT []
synonym: "KCNK3" RELATED []
synonym: "TWIK-related acid-sensitive K(+) channel 1" EXACT []
synonym: "Two pore potassium channel KT3.1" EXACT []
xref: PANTHER:PTHR11003\:SF16
is_a: PRO:000001917 ! potassium channel, TWIK-1-related

[Term]
id: PRO:000002077
name: potassium channel subfamily K member 6
def: "A potassium channel, TWIK-1-related that is a translation product of the KCNK6 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Inward rectifying potassium channel protein TWIK-2" EXACT []
synonym: "KCNK6" RELATED []
synonym: "TOSS" RELATED []
synonym: "TWIK-originated similarity sequence" EXACT []
synonym: "TWIK2" RELATED []
is_a: PRO:000001917 ! potassium channel, TWIK-1-related

[Term]
id: PRO:000002078
name: potassium channel subfamily K member 7
def: "A potassium channel, TWIK-1-related that is a translation product of the KCNK7 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Double-pore K(+) channel 3" EXACT []
synonym: "Dpkch3" RELATED []
synonym: "Kcnk6" RELATED []
synonym: "KCNK7" RELATED []
synonym: "Kcnk8" RELATED []
synonym: "Knot1" RELATED []
synonym: "Neuromuscular two p domain potassium channel" EXACT []
synonym: "Putative potassium channel DP3" EXACT []
is_a: PRO:000001917 ! potassium channel, TWIK-1-related

[Term]
id: PRO:000002079
name: potassium channel subfamily K member 9
def: "A potassium channel, TWIK-1-related that is a translation product of the KCNK9 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Acid-sensitive potassium channel protein TASK-3" EXACT []
synonym: "KCNK9" RELATED []
synonym: "TWIK-related acid-sensitive K(+) channel 3" EXACT []
synonym: "Two pore potassium channel KT3.2" EXACT []
xref: PANTHER:PTHR11003\:SF17
is_a: PRO:000001917 ! potassium channel, TWIK-1-related

[Term]
id: PRO:000002080
name: potassium channel subfamily T member 1
def: "A potassium channel subfamily T that is a translation product of the KCNT1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "KCa4.1" EXACT []
synonym: "Kiaa1422" RELATED []
is_a: PRO:000001916 ! potassium channel subfamily T

[Term]
id: PRO:000002081
name: potassium channel subfamily T member 2
def: "A potassium channel subfamily T that is a translation product of the KCNT2 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Sequence like an intermediate conductance potassium channel subunit" EXACT []
synonym: "SLICK" RELATED []
synonym: "Sodium and chloride-activated ATP-sensitive potassium channel Slo2.1" EXACT []
is_a: PRO:000001916 ! potassium channel subfamily T

[Term]
id: PRO:000002082
name: receptor tyrosine-protein kinase erbB-2
def: "An EGF receptor type tyrosine-protein kinase that is a translation product of the ERBB2 gene." [PRO:WCB]
comment: Category=gene.
synonym: "C-erbB-2" EXACT []
synonym: "CD340" EXACT []
synonym: "Kiaa3023" RELATED []
synonym: "MLN 19" EXACT []
synonym: "NEU proto-oncogene" EXACT []
synonym: "NGL" RELATED []
synonym: "p185erbB2" EXACT []
synonym: "Tyrosine kinase-type cell surface receptor HER2" EXACT []
is_a: PRO:000001812 ! EGF receptor type tyrosine-protein kinase

[Term]
id: PRO:000002083
name: receptor-type tyrosine-protein phosphatase eta isoform 1
def: "A receptor-type tyrosine-protein phosphatase eta that is a translation product of a mature transcript of the PTPRJ gene. Represented by the sequence UniProtKB:Q64455-1." [PMID:8549806, PRO:CNA]
comment: Category=sequence.
is_a: PRO:000001924 ! receptor-type tyrosine-protein phosphatase eta

[Term]
id: PRO:000002084
name: semaphorin-4D
def: "A protein that is a translation product of the SEMA4D gene." [PRO:WCB]
comment: Category=gene.
synonym: "A8" EXACT []
synonym: "BB18" EXACT []
synonym: "CD100" EXACT []
synonym: "GR3" EXACT []
synonym: "M-Sema G" EXACT []
synonym: "Sema J" EXACT []
synonym: "Semacl2" RELATED []
synonym: "Semaj" RELATED []
synonym: "Semaphorin-C-like 2" EXACT []
synonym: "Semaphorin-J" EXACT []
is_a: PRO:000001926 ! semaphorin

[Term]
id: PRO:000002085
name: semaphorin-7A
def: "A semaphorin that is a translation product of the SEMA7A gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD108" EXACT []
synonym: "CDw108" EXACT []
synonym: "JMH blood group antigen" EXACT []
synonym: "John-Milton-Hargen human blood group Ag" EXACT []
synonym: "Sema K1" EXACT []
synonym: "Sema L" EXACT []
synonym: "Semal" RELATED []
synonym: "Semaphorin-K1" EXACT []
synonym: "Semaphorin-L" EXACT []
synonym: "Semk1" RELATED []
is_a: PRO:000001926 ! semaphorin

[Term]
id: PRO:000002086
name: signal regulatory protein beta-1
def: "A SIRP/SHPS-1 family protein that is a translation product of the SIRPB1 gene or its mouse ortholog, Sirpb1a." [PRO:WCB]
comment: Category=gene.
synonym: "CD172 antigen-like family member B" EXACT []
synonym: "CD172b" EXACT []
synonym: "SIRP-beta-1" EXACT []
synonym: "SIRPB1" RELATED []
synonym: "Sirpb1a" RELATED []
is_a: PRO:000001832 ! SIRP/SHPS-1 family protein

[Term]
id: PRO:000002087
name: signal transducer and activator of transcription 1
def: "A signal transducer and transcription activator STAT that is a translation product of the STAT1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Signal transducer and activator of transcription 1-alpha/beta" EXACT []
synonym: "STAT1" RELATED []
synonym: "Transcription factor ISGF-3 components p91/p84" EXACT []
is_a: PRO:000001933 ! signal transducer and transcription activator STAT

[Term]
id: PRO:000002088
name: signal transducer and activator of transcription 2
def: "A signal transducer and transcription activator STAT that is a translation product of the STAT2 gene." [PRO:WCB]
comment: Category=gene.
synonym: "p113" EXACT []
synonym: "STAT2" RELATED []
is_a: PRO:000001933 ! signal transducer and transcription activator STAT

[Term]
id: PRO:000002089
name: signal transducer and activator of transcription 3
def: "A signal transducer and transcription activator STAT that is a translation product of the STAT3 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Acute-phase response factor" EXACT []
synonym: "APRF" RELATED []
synonym: "STAT3" RELATED []
is_a: PRO:000001933 ! signal transducer and transcription activator STAT

[Term]
id: PRO:000002090
name: signal transducer and activator of transcription 4
def: "A signal transducer and transcription activator STAT that is a translation product of the STAT4 gene." [PRO:WCB]
comment: Category=gene.
synonym: "STAT4" RELATED []
is_a: PRO:000001933 ! signal transducer and transcription activator STAT

[Term]
id: PRO:000002091
name: signal transducer and activator of transcription 5a
def: "A signal transducer and transcription activator STAT that is a translation product of the STAT5A gene." [PRO:WCB]
comment: Category=gene.
synonym: "Mammary gland factor" EXACT []
synonym: "Mgf" RELATED []
synonym: "Mpf" RELATED []
synonym: "STAT5A" RELATED []
is_a: PRO:000001933 ! signal transducer and transcription activator STAT

[Term]
id: PRO:000002092
name: signal transducer and activator of transcription 5b
def: "A signal transducer and transcription activator STAT that is a translation product of the STAT5B gene." [PRO:WCB]
comment: Category=gene.
synonym: "STAT5B" RELATED []
is_a: PRO:000001933 ! signal transducer and transcription activator STAT

[Term]
id: PRO:000002093
name: signal transducer and activator of transcription 6
def: "A signal transducer and transcription activator STAT that is a translation product of the STAT6 gene." [PRO:WCB]
comment: Category=gene.
synonym: "IL-4 Stat" EXACT []
synonym: "Signal transducer and transcription activator 6" EXACT []
synonym: "STAT6" RELATED []
is_a: PRO:000001933 ! signal transducer and transcription activator STAT

[Term]
id: PRO:000002094
name: small inducible cytokine A5
def: "A C/C-C motif small inducible chemokine that is a translation product of the CCL5 gene." [PRO:WCB]
comment: Category=gene.
synonym: "C-C motif chemokine 5" EXACT []
synonym: "CCL5" RELATED []
synonym: "EoCP" EXACT []
synonym: "Eosinophil-chemotactic cytokine" EXACT []
synonym: "MuRantes" EXACT []
synonym: "SCYA5" RELATED []
synonym: "SIS-delta" EXACT []
synonym: "Small-inducible cytokine A5" EXACT []
synonym: "T cell-specific protein P228" EXACT []
synonym: "T-cell-specific protein RANTES" EXACT []
synonym: "TCP228" EXACT []
xref: PIRSF:PIRSF500570
is_a: PRO:000001808 ! C/C-C motif small inducible chemokine

[Term]
id: PRO:000002095
name: sodium channe type 1 subunit alpha
def: "A voltage-gated sodium channel subunit alpha that is a translation product of the SCN1A gene." [PRO:WCB]
comment: Category=gene.
synonym: "NAC1" RELATED []
synonym: "SCN1" RELATED []
synonym: "SCN1A" RELATED []
synonym: "sodium channel protein type 1 subunit alpha" EXACT []
synonym: "Sodium channel protein type I subunit alpha" EXACT []
synonym: "Sodium channel protein, brain I subunit alpha" EXACT []
synonym: "Voltage-gated sodium channel subunit alpha Nav1.1" EXACT []
xref: PANTHER:PTHR10037\:SF29
is_a: PRO:000001975 ! voltage-gated sodium channel subunit alpha

[Term]
id: PRO:000002096
name: sodium channe type 10 subunit alpha
def: "A voltage-gated sodium channel subunit alpha that is a translation product of the SCN10A gene." [PRO:WCB]
comment: Category=gene.
synonym: "hPN3" EXACT []
synonym: "Peripheral nerve sodium channel 3" EXACT []
synonym: "PN3" RELATED []
synonym: "SCN10A" RELATED []
synonym: "Sensory neuron sodium channel" EXACT []
synonym: "Sns" RELATED []
synonym: "Sodium channel protein type X subunit alpha" EXACT []
synonym: "Voltage-gated sodium channel subunit alpha Nav1.8" EXACT []
is_a: PRO:000001975 ! voltage-gated sodium channel subunit alpha

[Term]
id: PRO:000002097
name: sodium channel type 11 subunit alpha
def: "A voltage-gated sodium channel subunit alpha that is a translation product of the SCN11A gene." [PRO:WCB]
comment: Category=gene.
synonym: "hNaN" EXACT []
synonym: "NaN" EXACT []
synonym: "Nat" RELATED []
synonym: "Peripheral nerve sodium channel 5" EXACT []
synonym: "PN5" RELATED []
synonym: "SCN11A " RELATED []
synonym: "SCN12A" RELATED []
synonym: "Sensory neuron sodium channel 2" EXACT []
synonym: "SNS2" RELATED []
synonym: "Sodium channel protein type XI subunit alpha" EXACT []
synonym: "Voltage-gated sodium channel subunit alpha Nav1.9" EXACT []
is_a: PRO:000001975 ! voltage-gated sodium channel subunit alpha

[Term]
id: PRO:000002098
name: sodium channel type 2 subunit alpha
def: "A voltage-gated sodium channel subunit alpha that is a translation product of the SCN2A gene. Found in human and rat, but not in mouse." [PRO:WCB]
comment: Category=gene.
synonym: "HBSC II" EXACT []
synonym: "NAC2" RELATED []
synonym: "SCN2A" RELATED []
synonym: "SCN2A1" RELATED []
synonym: "SCN2A2" RELATED []
synonym: "Sodium channel protein type II subunit alpha" EXACT []
synonym: "Sodium channel protein, brain II subunit alpha" EXACT []
synonym: "Voltage-gated sodium channel subunit alpha Nav1.2" EXACT []
is_a: PRO:000001975 ! voltage-gated sodium channel subunit alpha

[Term]
id: PRO:000002099
name: sodium channel type 3 subunit alpha
def: "A voltage-gated sodium channel subunit alpha that is a translation product of the SCN3A gene." [PRO:WCB]
comment: Category=gene.
synonym: "KIAA1356" RELATED []
synonym: "NAC3" RELATED []
synonym: "SCN3A" RELATED []
synonym: "Sodium channel protein type III subunit alpha" EXACT []
synonym: "Sodium channel protein, brain III subunit alpha" EXACT []
synonym: "Voltage-gated sodium channel subtype III" EXACT []
synonym: "Voltage-gated sodium channel subunit alpha Nav1.3" EXACT []
is_a: PRO:000001975 ! voltage-gated sodium channel subunit alpha

[Term]
id: PRO:000002100
name: sodium channel type 4 subunit alpha
def: "A voltage-gated sodium channel subunit alpha that is a translation product of the SCN4A gene." [PRO:WCB]
comment: Category=gene.
synonym: "SCN4A" RELATED []
synonym: "SkM1" EXACT []
synonym: "Sodium channel protein skeletal muscle subunit alpha" EXACT []
synonym: "Sodium channel protein type IV subunit alpha" EXACT []
synonym: "Voltage-gated sodium channel subunit alpha Nav1.4" EXACT []
is_a: PRO:000001975 ! voltage-gated sodium channel subunit alpha

[Term]
id: PRO:000002101
name: sodium channel type 5 subunit alpha
def: "A voltage-gated sodium channel subunit alpha that is a translation product of the SCN5A gene." [PRO:WCB]
comment: Category=gene.
synonym: "HH1" EXACT []
synonym: "SCN5A" RELATED []
synonym: "Sodium channel protein cardiac muscle subunit alpha" EXACT []
synonym: "Sodium channel protein type V subunit alpha" EXACT []
synonym: "Voltage-gated sodium channel subunit alpha Nav1.5" EXACT []
is_a: PRO:000001975 ! voltage-gated sodium channel subunit alpha

[Term]
id: PRO:000002102
name: sodium channel type 7 subunit alpha
def: "A voltage-gated sodium channel subunit alpha that is a translation product of the SCN7A gene." [PRO:WCB]
comment: Category=gene.
synonym: "Putative voltage-gated sodium channel subunit alpha Nax" EXACT []
synonym: "SCN6A" RELATED []
synonym: "SCN7A" RELATED []
synonym: "Sodium channel protein cardiac and skeletal muscle subunit alpha" EXACT []
synonym: "Sodium channel protein type VII subunit alpha" EXACT []
is_a: PRO:000001975 ! voltage-gated sodium channel subunit alpha

[Term]
id: PRO:000002103
name: sodium channel type 8 subunit alpha
def: "A voltage-gated sodium channel subunit alpha that is a translation product of the SCN8A gene." [PRO:WCB]
comment: Category=gene.
synonym: "MED" RELATED []
synonym: "Nbna1" RELATED []
synonym: "SCN8A" RELATED []
synonym: "Sodium channel protein type VIII subunit alpha" EXACT []
synonym: "Voltage-gated sodium channel subunit alpha Nav1.6" EXACT []
is_a: PRO:000001975 ! voltage-gated sodium channel subunit alpha

[Term]
id: PRO:000002104
name: sodium channel type 9 subunit alpha
def: "A voltage-gated sodium channel subunit alpha that is a translation product of the SCN9A gene." [PRO:WCB]
comment: Category=gene.
synonym: "hNE-Na" EXACT []
synonym: "Kiaa4197" RELATED []
synonym: "NENA" RELATED []
synonym: "Neuroendocrine sodium channel" EXACT []
synonym: "Peripheral sodium channel 1" EXACT []
synonym: "PN1" EXACT []
synonym: "SCN9A" RELATED []
synonym: "Sodium channel protein type IX subunit alpha" EXACT []
synonym: "Voltage-gated sodium channel subunit alpha Nav1.7" EXACT []
is_a: PRO:000001975 ! voltage-gated sodium channel subunit alpha

[Term]
id: PRO:000002105
name: thrombomodulin
def: "A thrombomodulin-like receptor that is a translation product of the THBD gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD141" EXACT []
synonym: "Fetomodulin" EXACT []
synonym: "THRM" RELATED []
synonym: "TM" EXACT []
is_a: PRO:000001938 ! thrombomodulin-like receptor

[Term]
id: PRO:000002106
name: tumor necrosis factor ligand superfamily member 10
def: "A tumor necrosis factor ligand superfamily member, 10/11 that is a translation product of the TNFSF10 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Apo-2 ligand" EXACT []
synonym: "Apo-2L" EXACT []
synonym: "APO2L" RELATED []
synonym: "CD253" EXACT []
synonym: "Protein TRAIL" EXACT []
synonym: "TNF-related apoptosis-inducing ligand" EXACT []
synonym: "TNFSF10" RELATED []
is_a: PRO:000001946 ! tumor necrosis factor ligand superfamily member 10/11

[Term]
id: PRO:000002107
name: tumor necrosis factor ligand superfamily member 11
def: "A tumor necrosis factor ligand superfamily member, 10/11 that is a translation product of the TNFSF11 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD254" EXACT []
synonym: "ODF" EXACT []
synonym: "OPGL" EXACT []
synonym: "Osteoclast differentiation factor" EXACT []
synonym: "Osteoprotegerin ligand" EXACT []
synonym: "RANKL" EXACT []
synonym: "Receptor activator of nuclear factor kappa B ligand" EXACT []
synonym: "TNF-related activation-induced cytokine" EXACT []
synonym: "TNFSF11" RELATED []
synonym: "TRANCE" EXACT []
synonym: "Tumor necrosis factor ligand superfamily member 11, membrane form" EXACT []
synonym: "Tumor necrosis factor ligand superfamily member 11, soluble form" EXACT []
is_a: PRO:000001946 ! tumor necrosis factor ligand superfamily member 10/11

[Term]
id: PRO:000002108
name: tumor necrosis factor receptor superfamily member 10A
def: "A tumor necrosis factor receptor superfamily member 10A/B that is a translation product of the TNFRSF10A gene. No mouse gene has been assigned this name." [PRO:WCB]
comment: Category=gene.
synonym: "APO2" RELATED []
synonym: "CD261" EXACT []
synonym: "Death receptor 4" EXACT []
synonym: "DR4" RELATED []
synonym: "TNF-related apoptosis-inducing ligand receptor 1" EXACT []
synonym: "TNFRSF10A" RELATED []
synonym: "TRAIL receptor 1" EXACT []
synonym: "TRAIL-R1" EXACT []
synonym: "TRAILR1" RELATED []
is_a: PRO:000001951 ! tumor necrosis factor receptor superfamily member 10A/B

[Term]
id: PRO:000002109
name: tumor necrosis factor receptor superfamily member 10B
def: "A tumor necrosis factor receptor superfamily member 10A/B that is a translation product of the TNFRSF10B gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD262" EXACT []
synonym: "Death receptor 5" EXACT []
synonym: "Dr5" RELATED []
synonym: "Killer" RELATED []
synonym: "MK" EXACT []
synonym: "TNF-related apoptosis-inducing ligand receptor 2" EXACT []
synonym: "TNFRSF10B" RELATED []
synonym: "TRAIL receptor 2" EXACT []
synonym: "TRAIL-R2" EXACT []
synonym: "TRAILR2" RELATED []
synonym: "TRICK2" RELATED []
synonym: "UNQ160/PRO186" RELATED []
synonym: "ZTNFR9" RELATED []
is_a: PRO:000001951 ! tumor necrosis factor receptor superfamily member 10A/B

[Term]
id: PRO:000002110
name: tyrosine-protein kinase BTK
def: "A tyrosine-protein kinase TEC-type that is a translation product of the BTK gene." [PRO:WCB]
comment: Category=gene.
synonym: "Agammaglobulinaemia tyrosine kinase" EXACT []
synonym: "AGMX1" RELATED []
synonym: "ATK" EXACT []
synonym: "B-cell progenitor kinase" EXACT []
synonym: "BPK" EXACT []
synonym: "Bruton tyrosine kinase" EXACT []
synonym: "Kinase EMB" EXACT []
synonym: "tyrosine-protein kinase btk" EXACT []
xref: PIRSF:PIRSF500765
is_a: PRO:000001967 ! tyrosine-protein kinase TEC-type

[Term]
id: PRO:000002111
name: tyrosine-protein kinase ITK/TSK
def: "A tyrosine-protein kinase TEC-type that is a translation product of the ITK gene." [PRO:WCB]
comment: Category=gene.
synonym: "IL-2-inducible T-cell kinase" EXACT []
synonym: "Kinase EMT" EXACT []
synonym: "Kinase TLK" EXACT []
synonym: "T-cell-specific kinase" EXACT []
synonym: "tyrosine-protein kinase itk/tsk" EXACT []
synonym: "Tyrosine-protein kinase Lyk" EXACT []
xref: PIRSF:PIRSF500766
is_a: PRO:000001967 ! tyrosine-protein kinase TEC-type

[Term]
id: PRO:000002112
name: vascular endothelial growth factor receptor 2
def: "A vascular endothelial growth factor receptor that is a translation product of the KDR gene." [PRO:WCB]
comment: Category=gene.
synonym: "2.7.10.1" EXACT []
synonym: "CD309" EXACT []
synonym: "Fetal liver kinase 1" EXACT []
synonym: "FLK1" RELATED []
synonym: "Kinase insert domain receptor" EXACT []
synonym: "Kinase NYK" EXACT []
synonym: "Protein-tyrosine kinase receptor flk-1" EXACT []
synonym: "VEGFR-2" EXACT []
is_a: PRO:000001971 ! vascular endothelial growth factor receptor

[Term]
id: PRO:000002113
name: voltage-dependent L-type calcium channel subunit alpha-1C
def: "A voltage-gated calcium channel subunit alpha that is a translation product of the CACNA1C gene." [PRO:WCB]
comment: Category=gene.
synonym: "Cach2" RELATED []
synonym: "Cacn2" RELATED []
synonym: "Cacnl1a1" RELATED []
synonym: "Calcium channel, L type, alpha-1 polypeptide, isoform 1, cardiac muscle" EXACT []
synonym: "Cchl1a1" RELATED []
synonym: "MBC" EXACT []
synonym: "MELC-CC" EXACT []
synonym: "Mouse brain class C" EXACT []
synonym: "voltage-dependent l-type calcium channel subunit alpha-1c" EXACT []
synonym: "Voltage-gated calcium channel subunit alpha Cav1.2" EXACT []
xref: PANTHER:PTHR10037\:SF47
is_a: PRO:000001974 ! voltage-gated calcium channel subunit alpha

[Term]
id: PRO:000002114
name: voltage-dependent L-type calcium channel subunit alpha-1D
def: "A voltage-gated calcium channel subunit alpha that is a translation product of the CACNA1D gene." [PRO:WCB]
comment: Category=gene.
synonym: "Cach3" RELATED []
synonym: "Cacn4" RELATED []
synonym: "CACNA1D" RELATED []
synonym: "Cacnl1a2" RELATED []
synonym: "Calcium channel, L type, alpha-1 polypeptide isoform 2" EXACT []
synonym: "Calcium channel, L type, alpha-1 polypeptide, isoform 2" EXACT []
synonym: "Cchl1a2" RELATED []
synonym: "LVDCCAlpha1D" EXACT []
synonym: "Voltage-gated calcium channel subunit alpha Cav1.3" EXACT []
xref: PANTHER:PTHR10037\:SF48
is_a: PRO:000001974 ! voltage-gated calcium channel subunit alpha

[Term]
id: PRO:000002115
name: voltage-dependent L-type calcium channel subunit alpha-1F
def: "A voltage-gated calcium channel subunit alpha that is a translation product of the CACNA1F gene." [PRO:WCB]
comment: Category=gene.
synonym: "CACNAF1" RELATED []
synonym: "Voltage-gated calcium channel subunit alpha Cav1.4" EXACT []
is_a: PRO:000001974 ! voltage-gated calcium channel subunit alpha

[Term]
id: PRO:000002116
name: voltage-dependent L-type calcium channel subunit alpha-1S
def: "A voltage-gated calcium channel subunit alpha that is a translation product of the CACNA1S gene." [PRO:WCB]
comment: Category=gene.
synonym: "Cach1" RELATED []
synonym: "Cach1b" RELATED []
synonym: "Cacn1" RELATED []
synonym: "CACNA1S" RELATED []
synonym: "Cacnl1a3" RELATED []
synonym: "Calcium channel, L type, alpha-1 polypeptide, isoform 3, skeletal muscle" EXACT []
synonym: "LVDCCAlpha1S" EXACT []
synonym: "Voltage-gated calcium channel subunit alpha Cav1.1" EXACT []
xref: PANTHER:PTHR10037\:SF52
is_a: PRO:000001974 ! voltage-gated calcium channel subunit alpha

[Term]
id: PRO:000002117
name: voltage-dependent N-type calcium channel subunit alpha-1B
def: "A voltage-gated calcium channel subunit alpha that is a translation product of the CACNA1B gene." [PRO:WCB]
comment: Category=gene.
synonym: "BIII" EXACT []
synonym: "Brain calcium channel III" EXACT []
synonym: "CACH5" RELATED []
synonym: "CACNA1B" RELATED []
synonym: "CACNL1A5" RELATED []
synonym: "Calcium channel, L type, alpha-1 polypeptide isoform 5" EXACT []
synonym: "Cchn1a" RELATED []
synonym: "NVDCCAlpha1" EXACT []
synonym: "Voltage-gated calcium channel subunit alpha Cav2.2" EXACT []
xref: PANTHER:PTHR10037\:SF58
is_a: PRO:000001974 ! voltage-gated calcium channel subunit alpha

[Term]
id: PRO:000002118
name: voltage-dependent P/Q-type calcium channel subunit alpha-1A
def: "A voltage-gated calcium channel subunit alpha that is a translation product of the CACNA1A gene." [PRO:WCB]
comment: Category=gene.
synonym: "BI" EXACT []
synonym: "Brain calcium channel I" EXACT []
synonym: "Caca1a" RELATED []
synonym: "Cach4" RELATED []
synonym: "Cacn3" RELATED []
synonym: "CACNA1A" RELATED []
synonym: "Cacnl1a4" RELATED []
synonym: "Calcium channel, L type, alpha-1 polypeptide isoform 4" EXACT []
synonym: "Ccha1a" RELATED []
synonym: "PQVDCCAlpha1" EXACT []
synonym: "Voltage-gated calcium channel subunit alpha Cav2.1" EXACT []
xref: PANTHER:PTHR10037\:SF59
is_a: PRO:000001974 ! voltage-gated calcium channel subunit alpha

[Term]
id: PRO:000002119
name: voltage-dependent R-type calcium channel subunit alpha-1E
def: "A voltage-gated calcium channel subunit alpha that is a translation product of the CACNA1E gene." [PRO:WCB]
comment: Category=gene.
synonym: "BII" EXACT []
synonym: "Brain calcium channel II" EXACT []
synonym: "CACH6" RELATED []
synonym: "CACNL1A6" RELATED []
synonym: "Calcium channel, L type, alpha-1 polypeptide, isoform 6" EXACT []
synonym: "Cchra1" RELATED []
synonym: "RVDCCAlpha1" EXACT []
synonym: "Voltage-gated calcium channel subunit alpha Cav2.3" EXACT []
xref: PANTHER:PTHR10037\:SF57
is_a: PRO:000001974 ! voltage-gated calcium channel subunit alpha

[Term]
id: PRO:000002120
name: 5'-nucleotidase isoform 1 cleaved and GPI-anchored form
def: "A 5'-nucleotidase isoform 1 that has been cleaved and post-translationally modified to include a GPI-anchor." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000001977 ! 5'-nucleotidase isoform 1
intersection_of: has_modification MOD:00818 ! glycosylphosphatidylinositolated residue
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000002121
name: C-C motif chemokine 13
def: "An eotaxin-like cytokine that is a translation product of the CCL13 gene. Not found in mouse." [PRO:WCB]
comment: Category=gene.
synonym: "CCL13" RELATED []
synonym: "CK-beta-10" EXACT []
synonym: "MCP-4" EXACT []
synonym: "MCP4" RELATED []
synonym: "Monocyte chemoattractant protein 4" EXACT []
synonym: "Monocyte chemotactic protein 4" EXACT []
synonym: "NCC-1" EXACT []
synonym: "NCC1" RELATED []
synonym: "SCYA13" RELATED []
synonym: "Small-inducible cytokine A13" EXACT []
is_a: PRO:000002038 ! eotaxin-like cytokine

[Term]
id: PRO:000002122
name: C-C motif chemokine 2
def: "An eotaxin-like cytokine that is a translation product of the CCL2 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CCL2" RELATED []
synonym: "HC11" EXACT []
synonym: "MCAF" EXACT []
synonym: "MCP-1" EXACT []
synonym: "Mcp1" RELATED []
synonym: "Monocyte chemoattractant protein 1" EXACT []
synonym: "Monocyte chemotactic and activating factor" EXACT []
synonym: "Monocyte chemotactic protein 1" EXACT []
synonym: "Monocyte secretory protein JE" EXACT []
synonym: "Platelet-derived growth factor-inducible protein JE" EXACT []
synonym: "Scya2" RELATED []
synonym: "Small-inducible cytokine A2" EXACT []
is_a: PRO:000002038 ! eotaxin-like cytokine

[Term]
id: PRO:000002123
name: C-C motif chemokine 3
def: "A C-C motif chemokine 3/4 that is a translation product of the CCL3 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CCL3" RELATED []
synonym: "G0/G1 switch regulatory protein 19-1" EXACT []
synonym: "G0S19-1 protein" EXACT []
synonym: "Heparin-binding chemotaxis protein" EXACT []
synonym: "L2G25B" EXACT []
synonym: "LD78-alpha(4-69)" EXACT []
synonym: "Macrophage inflammatory protein 1-alpha" EXACT []
synonym: "MIP-1-alpha(4-69" EXACT []
synonym: "MIP1A" RELATED []
synonym: "PAT 464.1" EXACT []
synonym: "SCYA3" RELATED []
synonym: "SIS-alpha" EXACT []
synonym: "SIS-beta" EXACT []
synonym: "Small-inducible cytokine A3" EXACT []
synonym: "Tonsillar lymphocyte LD78 alpha protein" EXACT []
synonym: "TY-5" EXACT []
is_a: PRO:000001998 ! C-C motif chemokine 3/4

[Term]
id: PRO:000002124
name: C-C motif chemokine 4
def: "A C-C motif chemokine 3/4 that is a translation product of the CCL4 gene." [PRO:WCB]
comment: Category=gene.
synonym: "ACT-2" EXACT []
synonym: "ACT2" EXACT []
synonym: "CCL4" RELATED []
synonym: "G-26 T-lymphocyte-secreted protein" EXACT []
synonym: "HC21" EXACT []
synonym: "Immune activation protein 2" EXACT []
synonym: "LAG-1" EXACT []
synonym: "LAG1" RELATED []
synonym: "Lymphocyte activation gene 1 protein" EXACT []
synonym: "Macrophage inflammatory protein 1-beta" EXACT []
synonym: "MIP-1-beta" EXACT []
synonym: "MIP1B" RELATED []
synonym: "PAT 744" EXACT []
synonym: "Protein H400" EXACT []
synonym: "SCYA4" RELATED []
synonym: "SIS-gamma" EXACT []
synonym: "Small-inducible cytokine A4" EXACT []
synonym: "T-cell activation protein 2" EXACT []
is_a: PRO:000001998 ! C-C motif chemokine 3/4

[Term]
id: PRO:000002125
name: C-C motif chemokine 7
def: "An eotaxin-like cytokine that is a translation product of the CCL7 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CCL7" RELATED []
synonym: "FIC protein" EXACT []
synonym: "Intercrine/chemokine MARC" EXACT []
synonym: "MCP-3" EXACT []
synonym: "MCP3" RELATED []
synonym: "Monocyte chemoattractant protein 3" EXACT []
synonym: "Monocyte chemotactic protein 3" EXACT []
synonym: "NC28" EXACT []
synonym: "SCYA6" RELATED []
synonym: "SCYA7" RELATED []
synonym: "Small-inducible cytokine A7" EXACT []
is_a: PRO:000002038 ! eotaxin-like cytokine

[Term]
id: PRO:000002126
name: C-C motif chemokine 8
def: "An eotaxin-like cytokine that is a translation product of the CCL8 gene. Not found in mouse." [PRO:WCB]
comment: Category=gene.
synonym: "CCL8" RELATED []
synonym: "HC14" EXACT []
synonym: "MCP2" RELATED []
synonym: "Monocyte chemoattractant protein 2" EXACT []
synonym: "Monocyte chemotactic protein 2" EXACT []
synonym: "SCYA10" RELATED []
synonym: "SCYA8" RELATED []
synonym: "Small-inducible cytokine A8" EXACT []
is_a: PRO:000002038 ! eotaxin-like cytokine

[Term]
id: PRO:000002127
name: alpha-type platelet-derived growth factor receptor isoform 1
def: "An alpha-type platelet-derived growth factor receptor that is a translation product of a mature transcript of the PDGFRA gene. Represented by the sequence UniProtKB:P26618-1." [PMID:2536956, PRO:CNA]
comment: Category=sequence.
is_a: PRO:000002030 ! alpha-type platelet-derived growth factor receptor

[Term]
id: PRO:000002128
name: alpha-type platelet-derived growth factor receptor isoform 2
def: "An alpha-type platelet-derived growth factor receptor that is a translation product of a mature transcript of the PDGFRA gene. Represented by the sequence UniProtKB:P26618-2." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000002030 ! alpha-type platelet-derived growth factor receptor

[Term]
id: PRO:000002129
name: alpha-type platelet-derived growth factor receptor isoform 3
def: "An alpha-type platelet-derived growth factor receptor that is a translation product of a mature transcript of the PDGFRA gene. Represented by the sequence UniProtKB:P16234-2." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000002030 ! alpha-type platelet-derived growth factor receptor

[Term]
id: PRO:000002130
name: angiopoietin-1 receptor isoform 1
def: "An angiopoietin-1 receptor that is a translation product of a mature transcript of the TEK gene. Represented by the sequence UniProtKB:Q02763-1." [PRO:CNA]
comment: Category=sequence.
synonym: "angiopoietin-1 receptor isoform 2" EXACT []
is_a: PRO:000002032 ! angiopoietin-1 receptor

[Term]
id: PRO:000002131
name: angiopoietin-1 receptor sequence variant 1
def: "An angiopoietin-1 receptor that is a translation product of a polymorphic sequence variant of the TEK gene that has a Trp residue at the position equivalent to Arg-849 in sequence UniProtKB:Q02763-1." [PMID:8980225, PMID:99199243]
comment: Category=sequence.
is_a: PRO:000002032 ! angiopoietin-1 receptor

[Term]
id: PRO:000002132
name: angiopoietin-1 receptor sequence variant 2
def: "An angiopoietin-1 receptor that is a translation product of a polymorphic sequence variant of the TEK gene that has a Ser residue at the position equivalent to Tyr-897 in sequence UniProtKB:Q02763-1." [PMID:10369874]
comment: Category=sequence.
is_a: PRO:000002032 ! angiopoietin-1 receptor

[Term]
id: PRO:000002133
name: band 3 anion transport protein isoform 1
def: "A band 3 anion transport protein that is a translation product of a mature transcript of the SLC4A1 gene. Represented by the sequence UniProtKB:P02730-1." [PMID:2790053, PRO:CNA]
comment: Category=sequence.
is_a: PRO:000002033 ! band 3 anion transport protein

[Term]
id: PRO:000002134
name: band 3 anion transport protein isoform 2
def: "A band 3 anion transport protein that is a translation product of a mature transcript of the SLC4A1 gene. Represented by the sequence UniProtKB:P04919-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000002033 ! band 3 anion transport protein

[Term]
id: PRO:000002135
name: band 3 anion transport protein isoform 3
def: "A band 3 anion transport protein that is a translation product of a mature transcript of the SLC4A1 gene. Represented by the sequence UniProtKB:P04919-2." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000002033 ! band 3 anion transport protein

[Term]
id: PRO:000002136
name: beta-type platelet-derived growth factor receptor isoform 1
def: "A beta-type platelet-derived growth factor receptor that is a translation product of a mature transcript of the PDGFRB gene. Represented by the sequence UniProtKB:P05622-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000002035 ! beta-type platelet-derived growth factor receptor

[Term]
id: PRO:000002137
name: beta-type platelet-derived growth factor receptor isoform 2
def: "A beta-type platelet-derived growth factor receptor that is a translation product of a mature transcript of the PDGFRB gene. Represented by the sequence UniProtKB:P09619-1." [PMID:2850496, PRO:CNA]
comment: Category=sequence.
is_a: PRO:000002035 ! beta-type platelet-derived growth factor receptor

[Term]
id: PRO:000002138
name: cytokine SCM-1 beta
def: "A lymphotactin-like chemokine that is a translation product of the XCL2 gene. The human gene produces a protein that is nearly identical to lymphotactin, the product of the XCL1 gene. Not found in mouse." [PRO:WCB]
comment: Category=gene.
synonym: "C motif chemokine 2" EXACT []
synonym: "SCYC2" RELATED []
synonym: "XC chemokine ligand 2" EXACT []
synonym: "XCL2" RELATED []
is_a: PRO:000002059 ! lymphotactin-like chemokine

[Term]
id: PRO:000002139
name: eotaxin
def: "An eotaxin-like cytokine that is a translation product of the CCL11 gene." [PRO:WCB]
comment: Category=gene.
synonym: "C-C motif chemokine 11" EXACT []
synonym: "CCL11" RELATED []
synonym: "Eosinophil chemotactic protein" EXACT []
synonym: "SCYA11" RELATED []
synonym: "Small-inducible cytokine A11" EXACT []
is_a: PRO:000002038 ! eotaxin-like cytokine

[Term]
id: PRO:000002140
name: lymphotactin
def: "A lymphotactin-like chemokine that is a translation product of the XCL1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "ATAC" EXACT []
synonym: "C motif chemokine 1" EXACT []
synonym: "Cytokine SCM-1" EXACT []
synonym: "Lptn" RELATED []
synonym: "LTN" RELATED []
synonym: "Lymphotaxin" EXACT []
synonym: "SCM-1-alpha" EXACT []
synonym: "SCYC1" RELATED []
synonym: "Small-inducible cytokine C1" EXACT []
synonym: "XC chemokine ligand 1" EXACT []
synonym: "XCL1" RELATED []
is_a: PRO:000002059 ! lymphotactin-like chemokine

[Term]
id: PRO:000002141
name: 5'-nucleotidase isoform 1 cleaved and GPI-anchored 1
def: "A 5'-nucleotidase isoform 1 cleaved and GPI-anchored form that has been processed to the mature peptide by removal of the signal peptide, and the C-terminal propeptide region which has been replaced by the glycophospholipid functioning as the membrane anchor of 5'-nucleotidase." [PMID:2129526]
comment: Category=modification.
is_a: PRO:000002120 ! 5'-nucleotidase isoform 1 cleaved and GPI-anchored form

[Term]
id: PRO:000002142
name: beta-type platelet-derived growth factor receptor isoform 2 cleaved form
def: "A beta-type platelet-derived growth factor receptor isoform 2 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000002137 ! beta-type platelet-derived growth factor receptor isoform 2
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000002143
name: beta-type platelet-derived growth factor receptor isoform 2 cleaved 1
def: "A beta-type platelet-derived growth factor receptor isoform 2 cleaved form that has been processed to the mature protein by removal of the signal peptide." [PMID:15340161, PRO:CNA]
comment: Category=modification.
is_a: PRO:000002142 ! beta-type platelet-derived growth factor receptor isoform 2 cleaved form

[Term]
id: PRO:000002144
name: monocyte differentiation antigen CD14 isoform 1
def: "A monocyte differentiation antigen CD14 protein that is a translation product of a mature transcript of the CD14 gene, that is the precursor protein and it is represented by the human sequence UniProtKB:P08571-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000001889 ! monocyte differentiation antigen CD14

[Term]
id: PRO:000002145
name: monocyte differentiation antigen CD14 isoform 1 cleaved form
def: "A monocyte differentiation antigen CD14 isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000002144 ! monocyte differentiation antigen CD14 isoform 1
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000002146
name: monocyte differentiation antigen CD14 isoform 1 cleaved 1
def: "A monocyte differentiation antigen CD14 isoform 1 cleaved form that has been processed to the mature form, but lacks the GPI-anchor and contains extra C-terminal residues as compared to cleaved 2 form." [PMID:7519994]
comment: Category=modification.
synonym: "Monocyte differentiation antigen CD14, urinary form" RELATED []
synonym: "sCD14" EXACT []
synonym: "uCD14" EXACT [PMID:7519994]
is_a: PRO:000002145 ! monocyte differentiation antigen CD14 isoform 1 cleaved form

[Term]
id: PRO:000002147
name: monocyte differentiation antigen CD14 isoform 1 cleaved 2
def: "A monocyte differentiation antigen CD14 isoform 1 cleaved form that has been processed to the mature form but lacks the GPI-anchor." [PMID:2779588]
comment: Category=modification.
synonym: "sCD14" RELATED []
synonym: "Secreted form of CD14" RELATED [REACTOME:REACT_7740.1]
synonym: "uCD14" RELATED []
is_a: PRO:000002145 ! monocyte differentiation antigen CD14 isoform 1 cleaved form

[Term]
id: PRO:000002148
name: monocyte differentiation antigen CD14 isoform 1 cleaved and GPI-anchored form
def: "A monocyte differentiation antigen CD14 isoform 1 that has been cleaved and post-translationally modified to include a GPI-anchor." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000002144 ! monocyte differentiation antigen CD14 isoform 1
intersection_of: has_modification MOD:00818 ! glycosylphosphatidylinositolated residue
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000002149
name: monocyte differentiation antigen CD14 isoform 1 cleaved and GPI-anchored 1
def: "A monocyte differentiation antigen CD14 isoform 1 cleaved and GPI-anchored form that is a mature membrane-bound form of this protein." [PMID:3385210, PRO:CNA]
comment: Category=modification.
synonym: "GPI-anchored form of CD14" EXACT [REACTOME:REACT_7740.1]
synonym: "mCD14" EXACT []
synonym: "Monocyte differentiation antigen CD14, membrane-bound form" EXACT []
is_a: PRO:000002148 ! monocyte differentiation antigen CD14 isoform 1 cleaved and GPI-anchored form

[Term]
id: PRO:000002150
name: DNA-binding protein ikaros isoform 1
def: "A DNA-binding protein ikaros that is a translation product of a mature transcript of the IKZF1 gene. Represented by the sequence UniProtKB:Q03267-1." [PRO:HJD]
comment: Category=sequence.
synonym: "Isoform Ik1" EXACT []
synonym: "Isoform VI" EXACT []
is_a: PRO:000001811 ! DNA-binding protein ikaros

[Term]
id: PRO:000002151
name: DNA-binding protein Ikaros isoform 2
def: "A DNA-binding protein Ikaros that is a translation product of a mature transcript of the IKZF1 gene. This form lacks four N-terminal zinc finger domains in comparison to isoform 1, functioning as a dominant negative. Represented by the sequence UniProtKB:Q03267-2." [PMID:18623087, PMID:8895580, PRO:HJD]
comment: Category=sequence.
synonym: "Isoform Ik6" EXACT []
is_a: PRO:000001811 ! DNA-binding protein ikaros

[Term]
id: PRO:000002152
name: DNA-binding protein Ikaros isoform 3
def: "A DNA-binding protein Ikaros that is a translation product of a mature transcript of the IKZF1 gene. Represented by the sequence: UniProtKB:Q03267-3." [PRO:HJD]
comment: Category=sequence.
synonym: "Isoform II" EXACT []
is_a: PRO:000001811 ! DNA-binding protein ikaros

[Term]
id: PRO:000002153
name: DNA-binding protein Ikaros isoform 4
def: "A DNA-binding protein Ikaros that is a translation product of a mature transcript of the IKZF1 gene. This form lacks three N-terminal zinc finger domains in comparison to isoform 1. Represented by the sequence UniProtKB:Q03267-4." [PMID:11781232, PRO:HJD]
comment: Category=sequence.
synonym: "Isoform III" EXACT []
synonym: "Isoform Ik5" EXACT []
is_a: PRO:000001811 ! DNA-binding protein ikaros

[Term]
id: PRO:000002154
name: DNA-binding protein Ikaros isoform 5
def: "A DNA-binding protein Ikaros that is a translation product of a mature transcript of the IKZF1 gene. Represented by the sequence UniProtKB:Q03267-5." [PRO:HJD]
comment: Category=sequence.
synonym: "Isoform IV" EXACT []
is_a: PRO:000001811 ! DNA-binding protein ikaros

[Term]
id: PRO:000002155
name: DNA-binding protein Ikaros isoform 6
def: "A DNA-binding protein Ikaros that is a translation product of a mature transcript of the IKZF1 gene. Represented by the sequence: UniProtKB:Q03267-6." [PMID:1439790, PMID:8964602, PRO:HJD]
comment: Category=sequence.
synonym: "Isoform Ik2" EXACT []
synonym: "Isoform V" EXACT []
is_a: PRO:000001811 ! DNA-binding protein ikaros

[Term]
id: PRO:000002156
name: NAD(P)+--arginine ADP-ribosyltransferase
def: "A protein with core architecture consisting of a NAD:arginine ADP-ribosyltransferase (PF01129) domain. Mono-ADP-ribosylation is a post-translational modification of proteins in which the ADP-ribose moiety of NAD is transferred to proteins. A family of mono(ADP-ribosyl) transferases exists in vertebrates that transfer ADP-ribose to arginine." [Interpro:IPR000768, PMID:8703012]
comment: Category=family.
synonym: "ART" EXACT []
xref: PIRSF:PIRSF005506
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000002157
name: ecto-ADP-ribosyltransferase 5
def: "A NAD(P)+--arginine ADP-ribosyltransferase that is a translation product of the ART5 gene." [PRO:HJD]
comment: Category=gene.
synonym: "ART5" RELATED []
synonym: "Mono(ADP-ribosyl)transferase 5" EXACT []
synonym: "NAD(P)+-arginine ADP-ribosyltransferase 5" EXACT []
xref: PIRSF:PIRSF501088
is_a: PRO:000002156 ! NAD(P)+--arginine ADP-ribosyltransferase

[Term]
id: PRO:000002158
name: ecto-ADP-ribosyltransferase 3
def: "A NAD(P)+--arginine ADP-ribosyltransferase that is a translation product of the ART3 gene." [PRO:CNA]
comment: Category=gene.
synonym: "ART3" RELATED []
synonym: "Mono(ADP-ribosyl)transferase 3" EXACT []
synonym: "NAD(P)(+)--arginine ADP-ribosyltransferase 3 " EXACT []
xref: PIRSF:PIRSF501091
is_a: PRO:000002156 ! NAD(P)+--arginine ADP-ribosyltransferase

[Term]
id: PRO:000002159
name: T-cell ecto-ADP-ribosyltransferase
def: "A NAD(P)+--arginine ADP-ribosyltransferase that is a translation product of the ART2A or ART2B genes." [PRO:CNA, XX:<new dbxref>]
comment: Category=family.
xref: PIRSF:PIRSF501092
is_a: PRO:000002156 ! NAD(P)+--arginine ADP-ribosyltransferase

[Term]
id: PRO:000002160
name: ecto-ADP-ribosyltransferase 5 isoform 1
def: "An ecto-ADP-ribosyltransferase 5 that is a translation product of the ART5 gene. Represented by the sequence UniProtKB:P70352-1." [PRO:HJD]
comment: Category=sequence.
synonym: "NAD(P)+-arginine ADP-ribosyltransferase 5 isoform 1" EXACT []
is_a: PRO:000002157 ! ecto-ADP-ribosyltransferase 5

[Term]
id: PRO:000002161
name: ecto-ADP-ribosyltransferase 5 isoform 2
def: "An ecto-ADP-ribosyltransferase 5 that is a translation product of the ART5 gene. Represented by the sequence UniProtKB:P70352-2." [PRO:HJD]
comment: Category=sequence.
is_a: PRO:000002157 ! ecto-ADP-ribosyltransferase 5

[Term]
id: PRO:000002162
name: ecto-ADP-ribosyltransferase 5 isoform 3
def: "An ecto-ADP-ribosyltransferase 5 that is a translation product of the ART5 gene. Represented by the sequence UniProtKB:P70352-3." [PRO:HJD]
comment: Category=sequence.
synonym: "NAD(P)+-arginine ADP-ribosyltransferase 5 isoform 3" EXACT []
is_a: PRO:000002157 ! ecto-ADP-ribosyltransferase 5

[Term]
id: PRO:000002163
name: ecto-ADP-ribosyltransferase 5 isoform 4
def: "An ecto-ADP-ribosyltransferase 5 that is a translation product of the ART5 gene. Represented by the sequence UniProtKB:P70352-4." [PRO:HJD]
comment: Category=sequence.
synonym: "NAD(P)+-arginine ADP-ribosyltransferase 5 isoform 4" EXACT []
is_a: PRO:000002157 ! ecto-ADP-ribosyltransferase 5

[Term]
id: PRO:000002164
name: ecto-ADP-ribosyltransferase 5 isoform 5
def: "An ecto-ADP-ribosyltransferase 5 that is a translation product of the ART5 gene. Represented by the sequence EMBL:AAC52773." [PMID:8703012, PRO:HJD]
comment: Category=sequence.
synonym: "NAD(P)+-arginine ADP-ribosyltransferase 5 isoform 5" EXACT []
xref: EMBL:AAC52773
xref: EMBL:U60881
is_a: PRO:000002157 ! ecto-ADP-ribosyltransferase 5

[Term]
id: PRO:000002165
name: ecto-ADP-ribosyltransferase 5 isoform 6
def: "An ecto-ADP-ribosyltransferase 5 that is a translation product of the ART5 gene. Represented by the sequence UniProtKB:O54739-1." [PMID:11587854, PRO:HJD]
comment: Category=sequence.
xref: EMBL:Y08028
is_a: PRO:000002157 ! ecto-ADP-ribosyltransferase 5

[Term]
id: PRO:000002166
name: zinc finger protein aiolos isoform 1
def: "A zinc finger protein aiolos that is a translation product of a mature transcript of the IKZF3 gene. Represented by the sequence UniProtKB:O08900-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000001976 ! zinc finger protein aiolos

[Term]
id: PRO:000002167
name: zinc finger protein aiolos isoform 2
def: "A zinc finger protein aiolos that is a translation product of a mature transcript of the IKZF3 gene. Represented by the sequence UniProtKB:Q9UKT9-2." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000001976 ! zinc finger protein aiolos

[Term]
id: PRO:000002168
name: zinc finger protein aiolos isoform 3
def: "A zinc finger protein aiolos that is a translation product of a mature transcript of the IKZF3 gene. Represented by the sequence UniProtKB:Q9UKT9-3." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000001976 ! zinc finger protein aiolos

[Term]
id: PRO:000002169
name: zinc finger protein aiolos isoform 4
def: "A zinc finger protein aiolos that is a translation product of a mature transcript of the IKZF3 gene. Represented by the sequence UniProtKB:Q9UKT9-4." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000001976 ! zinc finger protein aiolos

[Term]
id: PRO:000002170
name: zinc finger protein aiolos isoform 5
def: "A zinc finger protein aiolos that is a translation product of a mature transcript of the IKZF3 gene. Represented by the sequence UniProtKB:Q9UKT9-5." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000001976 ! zinc finger protein aiolos

[Term]
id: PRO:000002171
name: zinc finger protein aiolos isoform 6
def: "A zinc finger protein aiolos that is a translation product of a mature transcript of the IKZF3 gene. Represented by the sequence UniProtKB:Q9UKT9-6." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000001976 ! zinc finger protein aiolos

[Term]
id: PRO:000002172
name: zinc finger protein helios
def: "An ikaros-like zinc finger transcription factor that is a translation product of the IKZF2 gene." [PRO:HJD]
comment: Category=sequence.
synonym: "Helios, Zfpn1a2, Znfn1a2" RELATED []
synonym: "Ikaros family zinc finger protein 2" EXACT []
is_a: PRO:000002986 ! ikaros-like zinc finger transcription factor

[Term]
id: PRO:000002173
name: zinc finger protein helios isoform 1
def: "A zinc finger protein helios that is a translation product of a mature transcript of the IKZF2 gene. Represented by the sequence UniProtKB:P81183-1." [PRO:HJD]
comment: Category=sequence.
synonym: "isoform B" RELATED []
is_a: PRO:000002172 ! zinc finger protein helios

[Term]
id: PRO:000002174
name: zinc finger protein helios isoform 2
def: "A zinc finger protein helios that is a translation product of a mature transcript of the IKZF2 gene. Represented by the sequence UniProtKB:P81183-2." [PRO:HJD]
comment: Category=sequence.
synonym: "Isoform A" RELATED []
is_a: PRO:000002172 ! zinc finger protein helios

[Term]
id: PRO:000002175
name: 14-3-3 protein beta/alpha protein
def: "A 14-3-3 protein that is a translation product of the YWHAB gene." [PRO:WCB]
comment: Category=gene.
synonym: "14-3-3 protein" RELATED []
synonym: "KCIP-1" EXACT []
synonym: "Protein 1054" EXACT []
synonym: "Protein kinase C inhibitor protein 1" EXACT []
synonym: "YWHAB" RELATED []
is_a: PRO:000003237 ! 14-3-3 protein

[Term]
id: PRO:000002176
name: 26S proteasome non-ATPase regulatory subunit 1
def: "A protein that is a translation product of the PSMD1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "26S proteasome non-ATPase regulatory subunit 1" EXACT []
synonym: "26S proteasome regulatory subunit RPN2" EXACT []
synonym: "26S proteasome regulatory subunit S1" EXACT []
synonym: "26S proteasome subunit p112" EXACT []
synonym: "PSMD1" RELATED []
synonym: "Psmd1" RELATED []
xref: PIRSF:PIRSF015947
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000002177
name: 26S proteasome non-ATPase regulatory subunit 11
def: "A protein that is a translation product of the PSMD11 gene." [PRO:WCB]
comment: Category=gene.
synonym: "26S proteasome non-ATPase regulatory subunit 11" EXACT []
synonym: "26S proteasome regulatory subunit p44.5" EXACT []
synonym: "26S proteasome regulatory subunit S9" EXACT []
synonym: "PSMD11" RELATED []
synonym: "Psmd11" RELATED []
xref: PIRSF:PIRSF006840
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000002178
name: 26S proteasome non-ATPase regulatory subunit 12
def: "A protein that is a translation product of the PSMD12 gene." [PRO:WCB]
comment: Category=gene.
synonym: "26S proteasome non-ATPase regulatory subunit 12" EXACT []
synonym: "26S proteasome regulatory subunit p55" EXACT []
synonym: "Psmd12" RELATED []
synonym: "PSMD12" RELATED []
xref: PIRSF:PIRSF006839
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000002179
name: 26S proteasome non-ATPase regulatory subunit 13
def: "A protein that is a translation product of the PSMD13 gene." [PRO:WCB]
comment: Category=gene.
synonym: "26S proteasome non-ATPase regulatory subunit 13" EXACT []
synonym: "26S proteasome regulatory subunit p40.5" EXACT []
synonym: "26S proteasome regulatory subunit S11" EXACT []
synonym: "Psmd13" RELATED []
synonym: "PSMD13" RELATED []
xref: PIRSF:PIRSF025015
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000002180
name: 26S proteasome non-ATPase regulatory subunit 2
def: "A protein that is a translation product of the PSMD2 gene." [PRO:WCB]
comment: Category=gene.
synonym: "26S proteasome non-ATPase regulatory subunit 2" EXACT []
synonym: "26S proteasome regulatory subunit RPN1" EXACT []
synonym: "26S proteasome regulatory subunit S2" EXACT []
synonym: "26S proteasome subunit p97" EXACT []
synonym: "55.11 protein" EXACT []
synonym: "PSMD2" RELATED []
synonym: "Psmd2" RELATED []
synonym: "TRAP2" RELATED []
synonym: "Tumor necrosis factor type 1 receptor-associated protein 2" EXACT []
xref: PIRSF:PIRSF015965
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000002181
name: 26S proteasome non-ATPase regulatory subunit 4
def: "A protein that is a translation product of the PSMD4 gene." [PRO:WCB]
comment: Category=gene.
synonym: "26S proteasome non-ATPase regulatory subunit 4" EXACT []
synonym: "26S proteasome regulatory subunit S5A" EXACT []
synonym: "AF" EXACT []
synonym: "Antisecretory factor 1" EXACT []
synonym: "ASF" EXACT []
synonym: "MCB1" RELATED []
synonym: "Mcb1" RELATED []
synonym: "Multiubiquitin chain-binding protein" EXACT []
synonym: "PSMD4" RELATED []
synonym: "Psmd4" RELATED []
synonym: "Rpn10" EXACT []
xref: PIRSF:PIRSF015819
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000002182
name: 26S proteasome non-ATPase regulatory subunit 6
def: "A protein that is a translation product of the PSMD6 gene." [PRO:WCB]
comment: Category=gene.
synonym: "26S proteasome non-ATPase regulatory subunit 6" EXACT []
synonym: "26S proteasome regulatory subunit S10" EXACT []
synonym: "Breast cancer-associated protein SGA-113M" EXACT []
synonym: "p42A" EXACT []
synonym: "Phosphonoformate immuno-associated protein 4" EXACT []
synonym: "Proteasome regulatory particle subunit p44S10" EXACT []
synonym: "Psmd6" RELATED []
synonym: "PSMD6" RELATED []
xref: PIRSF:PIRSF015951
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000002183
name: BH3-interacting domain death agonist
def: "A protein that is a translation product of the BID gene." [PRO:WCB]
comment: Category=gene.
synonym: "BH3-interacting domain death agonist" EXACT []
synonym: "BID" RELATED []
synonym: "p22 BID" EXACT []
xref: PIRSF:PIRSF038018
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000002184
name: Bcl2 antagonist of cell death
def: "A protein that is a translation product of the BAD gene." [PRO:WCB]
comment: Category=gene.
synonym: "BAD" RELATED []
synonym: "Bad" RELATED []
synonym: "Bbc6" RELATED []
synonym: "BBC6, BCL2L8" RELATED []
synonym: "Bcl-2-binding component 6" EXACT []
synonym: "Bcl-2-like 8 protein" EXACT []
synonym: "Bcl-xL/Bcl-2-associated death promoter" EXACT []
synonym: "Bcl-XL/Bcl-2-associated death promoter" EXACT []
synonym: "Bcl2 antagonist of cell death" EXACT []
xref: PIRSF:PIRSF023966
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000002185
name: Bcl2 homologous antagonist/killer
def: "A protein that is a translation product of the BAK1 gene. The BAK2 gene is a recent duplication in humans and gives rise to a very similar protein." [PRO:WCB]
comment: Category=gene.
synonym: "Apoptosis regulator BAK" EXACT []
synonym: "Bak" RELATED []
synonym: "BAK, BCL2L7, CDN1" RELATED []
synonym: "BAK1" RELATED []
synonym: "Bak1" RELATED []
synonym: "Bcl-2-like 7 protein" EXACT []
xref: PIRSF:PIRSF038829
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000002186
name: Bcl2-like apoptosis inhibitor
def: "A protein that is a translation product of the BCL2, BCL2L1, or BCL2L2 gene. The core domain architecture consists of an amino-terminal BH4 domain (PF02180), which confers apoptosis inhibitory activity, and a Bcl-2 domain (PF02180) common to many apoptosis regulator proteins." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF001714
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000002187
name: Bcl2-like protein 11
def: "A protein that is a translation product of the BCL2L11 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Bcl-2-like protein 11" EXACT []
synonym: "Bcl2-interacting mediator of cell death" EXACT []
synonym: "BCL2L11" RELATED []
synonym: "Bcl2l11" RELATED []
synonym: "BIM" RELATED []
synonym: "Bim" RELATED []
xref: PIRSF:PIRSF037827
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000002188
name: DNA fragmentation factor subunit alpha
def: "A protein that is a translation product of the DFFA gene." [PRO:WCB]
comment: Category=gene.
synonym: "DFF-45" EXACT []
synonym: "DFF1, DFF45" RELATED []
synonym: "Dffa" RELATED []
synonym: "DFFA" RELATED []
synonym: "DNA fragmentation factor 45 kDa subunit" EXACT []
synonym: "DNA fragmentation factor subunit alpha" EXACT []
synonym: "H13" RELATED []
synonym: "Icad" RELATED []
synonym: "ICAD" EXACT []
synonym: "Inhibitor of CAD" EXACT []
xref: PIRSF:PIRSF037865
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000002189
name: FADD protein
def: "A protein that is a translation product of the FADD gene." [PRO:WCB]
comment: Category=gene.
synonym: "Fadd" RELATED []
synonym: "FADD" RELATED []
synonym: "FAS-associated death domain protein" EXACT []
synonym: "FAS-associating death domain-containing protein" EXACT []
synonym: "Mediator of receptor induced toxicity" EXACT []
synonym: "Mort1" RELATED []
synonym: "MORT1" RELATED []
synonym: "Protein FADD" EXACT []
xref: PIRSF:PIRSF018586
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000002190
name: RAC-alpha serine/threonine-protein kinase
def: "A protein that is a translation product of the AKT1 gene. The core domain architectures consists of a PX domain (PF00787), PH domain (PF00169), protein kinase domain (PF00069) and a protein kinase C terminal domain (PF00433)." [PRO:WCB]
comment: Category=gene.
synonym: "AKT1" RELATED []
synonym: "C-AKT" EXACT []
synonym: "PKB" EXACT []
synonym: "PKB, RAC" RELATED []
synonym: "Protein kinase B" EXACT []
synonym: "RAC-alpha serine/threonine-protein kinase" EXACT []
synonym: "RAC-PK-alpha" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000002191
name: TNF receptor-associated factor
def: "A protein that is a translation product of a family of genes including the six human genes, TRAF1 to TRAF6. The core architectures of this protein consists of a zinc finger C3HC4 type (Ring finger PF00097), a TRAF-type zinc finger (PF02176) and a MATH domain (PF00917)." [PRO:WCB]
comment: Category=family.
synonym: "TRAF" EXACT []
xref: PIRSF:PIRSF015614
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000002193
name: apoptosis regulator BAX
def: "A protein that is a translation product of the BAX gene. In this class the Bcl-2 domain is characterized by the presence of the BH3, BH1, and BH2 motifs." [PRO:SY, PRO:WCB]
comment: Category=gene.
synonym: "BAX" RELATED []
synonym: "Bax" RELATED []
xref: PIRSF:PIRSF038828
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000002194
name: apoptotic protease-activating factor 1
def: "A protein that is a translation product of the APAF1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Apaf-1" EXACT []
synonym: "Apaf1" RELATED []
synonym: "APAF1" RELATED []
synonym: "Apoptotic protease-activating factor 1" EXACT []
xref: PIRSF:PIRSF037646
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000002195
name: caspase-1-like protease
def: "A protein that is a translation product of a family of genes that includes CASP1, CASP2, CASP4, CASP5, CASP9 and others. The core architecture consists of a Caspase recruitment domain (PF00619), Caspase domain (PF00656) and a PAAD/DAPIN/Pyrin domain (PF02758). Encoded as zymogens, the activated proteins are cysteine proteases typically involved in apoptosis." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF038001
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000002196
name: caspase-3-like protease
def: "A protein that is a translation product of a gene family that includes CASP3, CASP6, and CASP7 genes. The core architecture consists of a Caspase domain (PF00656). Encoded as zymogens, the activated proteins are cysteine proteases typically involved in apoptosis." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF015839
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000002197
name: caspase-8-like protease
def: "A protein that is a translation product of the CASP8, CASP10, or CFLAR gene. The core domain architecture consists of two consecutive copies of the Death effector domain (DED) domain (PF01335) in an amino-terminal propeptide followed by Peptidase_C14 domain (PF00656). Encoded as zymogens, the activated proteins are cysteine proteases typically involved in apoptosis." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF037643
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000002198
name: catenin beta-1
def: "A protein that is a translation product of the CTNNB1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Beta-catenin" EXACT []
synonym: "Catenin beta-1" EXACT []
synonym: "Catnb" RELATED []
synonym: "CTNNB" RELATED []
synonym: "Ctnnb1" RELATED []
synonym: "CTNNB1" RELATED []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000002199
name: cytochrome c
def: "A protein that is a translation product of the CYCS or closely related CYCT gene (mouse and rat) with core architecture consisting of a Cytochrome c (PF00034) domain." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF000001
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000002200
name: cytoplasmic tyrosine-protein kinase BMX
def: "A tyrosine-protein kinase, TEC-like, that is a translation product of the BMX gene." [PRO:WCB]
comment: Category=gene.
synonym: "Bmx" RELATED []
synonym: "BMX" RELATED []
synonym: "Bone marrow tyrosine kinase gene in chromosome X protein" EXACT []
synonym: "Bone marrow tyrosine kinase gene in chromosome X protein homolog" EXACT []
synonym: "Cytoplasmic tyrosine-protein kinase BMX" EXACT []
synonym: "Epithelial and endothelial tyrosine kinase" EXACT []
synonym: "ETK" EXACT []
synonym: "NTK38" EXACT []
xref: PIRSF:PIRSF500767
is_a: PRO:000001967 ! tyrosine-protein kinase TEC-type

[Term]
id: PRO:000002201
name: dynein light chain
def: "A protein that is a translation product of the DYNLL1 or DYNLL2 gene. The protein is small (89 residues in human and mouse) with core architecture consisting of a Dynein light chain type 1 domain (PF01221)." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF005695
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000002202
name: gelsolin
def: "A protein that is a translation product of the GSN gene." [PRO:WCB]
comment: Category=gene.
synonym: "Actin-depolymerizing factor" EXACT []
synonym: "ADF" EXACT []
synonym: "AGEL" EXACT []
synonym: "Brevin" EXACT []
synonym: "Gelsolin precursor" EXACT []
synonym: "Gsb" RELATED []
synonym: "Gsn" RELATED []
synonym: "GSN" RELATED []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000002203
name: glycylpeptide N-tetradecanoyltransferase 1
def: "A protein that is a translation product of the NMT1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Glycylpeptide N-tetradecanoyltransferase 1" EXACT []
synonym: "Myristoyl-CoA:protein N-myristoyltransferase 1" EXACT []
synonym: "NMT" RELATED []
synonym: "NMT 1" EXACT []
synonym: "NMT1" RELATED []
synonym: "Nmt1" RELATED []
synonym: "Peptide N-myristoyltransferase 1" EXACT []
synonym: "Type I N-myristoyltransferase" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000002204
name: lymphotoxin-alpha
def: "A tumor necrosis factor, TNF-like, that is a translation product of the LTA gene." [PRO:WCB]
comment: Category=gene.
synonym: "LT-alpha" EXACT []
synonym: "LTA" RELATED []
synonym: "TNF-beta" EXACT []
synonym: "TNFB" RELATED []
synonym: "TNFSF1" RELATED []
synonym: "Tumor necrosis factor ligand superfamily member 1" EXACT []
xref: PIRSF:PIRSF500469
is_a: PRO:000000033 ! tumor necrosis factor, TNF-like

[Term]
id: PRO:000002205
name: lymphotoxin-beta
def: "A tumor necrosis factor, TNF-like, that is a translation product of the LTB gene." [PRO:WCB]
comment: Category=gene.
synonym: "LT-beta" EXACT []
synonym: "LTB" RELATED []
synonym: "TNF-C" EXACT []
synonym: "TNFC" RELATED []
synonym: "TNFSF3" RELATED []
synonym: "Tumor necrosis factor C" EXACT []
synonym: "Tumor necrosis factor ligand superfamily member 3" EXACT []
is_a: PRO:000000033 ! tumor necrosis factor, TNF-like

[Term]
id: PRO:000002206
name: mitogen-activated protein kinase 8
def: "A protein that is a translation product of the MAPK8 gene." [PRO:WCB]
comment: Category=gene.
synonym: "c-Jun N-terminal kinase 1" EXACT []
synonym: "JNK-46" EXACT []
synonym: "JNK1, PRKM8" RELATED []
synonym: "Jnk1, Prkm8" RELATED []
synonym: "MAP kinase JNK" EXACT []
synonym: "Mapk8" RELATED []
synonym: "MAPK8" RELATED []
synonym: "Mitogen-activated protein kinase 8" EXACT []
synonym: "Stress-activated protein kinase JNK1" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000002207
name: occludin
def: "A protein that is a translation product of the OCLN gene." [PRO:WCB]
comment: Category=gene.
synonym: "Occludin" EXACT []
synonym: "Ocl" RELATED []
synonym: "Ocln" RELATED []
synonym: "OCLN" RELATED []
xref: PIRSF:PIRSF005993
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000002208
name: proteasome subunit beta type-2
def: "A protein that is a translation product of the PSMB2 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Macropain subunit C7-I" EXACT []
synonym: "Multicatalytic endopeptidase complex subunit C7-I" EXACT []
synonym: "Proteasome component C7-I" EXACT []
synonym: "Proteasome subunit beta type-2" EXACT []
synonym: "PSMB2" RELATED []
synonym: "Psmb2" RELATED []
xref: PIRSF:PIRSF006673
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000002209
name: proteasome subunit beta type-4
def: "A protein that is a translation product of the PSMB4 gene." [PRO:WCB]
comment: Category=gene.
synonym: "HsBPROS26" EXACT []
synonym: "HSN3" EXACT []
synonym: "Lmp3" RELATED []
synonym: "Macropain beta chain" EXACT []
synonym: "Multicatalytic endopeptidase complex beta chain" EXACT []
synonym: "Proteasome beta chain" EXACT []
synonym: "Proteasome chain 3" EXACT []
synonym: "Proteasome subunit beta type-4 precursor" EXACT []
synonym: "Psmb4" RELATED []
synonym: "PSMB4" RELATED []
xref: PIRSF:PIRSF001213
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000002210
name: protein kinase C, delta-like
def: "A protein that is a translation product of the PRKCD, PRKCE, PRKCH, or PRKCQ genes. The core domain architecture consists of a C2 domain (PF00168), which is not always detected, two Phorbol esters/diacylglycerol binding domains (PF00130, also called C1 domain), a Protein kinase domain (PF00069), and a Protein kinase C terminal domain (PF00433)." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF000551
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000002211
name: rho GTPase-activating protein 10
def: "A protein that is a translation product of the ARHGAP10 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Arhgap10" RELATED []
synonym: "ARHGAP10" RELATED []
synonym: "Graf-related protein 2" EXACT []
synonym: "GRAF2" RELATED []
synonym: "GTPase regulator associated with focal adhesion kinase 2" EXACT []
synonym: "PH and SH3 domain-containing rhoGAP protein" EXACT []
synonym: "PS-GAP" EXACT []
synonym: "PSGAP" EXACT []
synonym: "Rho GTPase-activating protein 10" EXACT []
synonym: "Rho-type GTPase-activating protein 10" EXACT []
xref: PIRSF:PIRSF500862
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000002212
name: serine/threonine-protein kinase, MST4-like
def: "A protein that is a translation product of a family of genes that includes STK24, STK25, or MST4. The core architecture consists of one Protein kinase domain (PF00069)." [PRO:WCB]
comment: Category=family.
xref: PIRSF:PIRSF038178
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000002214
name: tumor necrosis factor ligand superfamily member 10 isoform 1
def: "A tumor necrosis factor ligand superfamily member 10 that is a translation product of a mature transcript of the TNFSF10 gene. Represented by the mouse sequence UniProtKB:P50592-1." [PMID:8777713]
comment: Category=sequence.
is_a: PRO:000002106 ! tumor necrosis factor ligand superfamily member 10

[Term]
id: PRO:000002217
name: tumor necrosis factor ligand superfamily member 11 isoform 1
def: "A tumor necrosis factor ligand superfamily member 11 that is a translation product of a matured transcript of the TNFSF11 gene. Represented by the sequence UniProtKB:O35235-1." [PRO:JAN]
comment: Category=sequence.
synonym: "RANKL 1" RELATED []
is_a: PRO:000002107 ! tumor necrosis factor ligand superfamily member 11

[Term]
id: PRO:000002218
name: tumor necrosis factor ligand superfamily member 11 isoform 2
def: "A tumor necrosis factor ligand superfamily member 11 that is a translation product of a matured transcript of the TNFSF11 gene. Represented by the sequence UniProtKB:O35235-2." [PRO:JAN]
comment: Category=sequence.
synonym: "RANKL 2" EXACT []
is_a: PRO:000002107 ! tumor necrosis factor ligand superfamily member 11

[Term]
id: PRO:000002219
name: tumor necrosis factor ligand superfamily member 11 isoform 3
def: "A tumor necrosis factor ligand superfamily member 11 that is a translation product of a matured transcript of the TNFSF11 gene. This form lacks the transmembrane domain. Represented by the sequence UniProtKB:O35235-3." [PMID:11250921, PRO:JAN]
comment: Category=sequence.
synonym: "RANKL 3" EXACT []
is_a: PRO:000002107 ! tumor necrosis factor ligand superfamily member 11

[Term]
id: PRO:000002220
name: tumor necrosis factor ligand superfamily member 11 isoform 4
def: "A tumor necrosis factor ligand superfamily member 11 that is a translation product of a matured transcript of the TNFSF11 gene. Represented by the sequence UniProtKB:O14788-2." [PRO:JAN]
comment: Category=sequence.
synonym: "SODF" EXACT []
is_a: PRO:000002107 ! tumor necrosis factor ligand superfamily member 11

[Term]
id: PRO:000002221
name: tumor necrosis factor ligand superfamily member 11 isoform 5
def: "A tumor necrosis factor ligand superfamily member 11 that is a translation product of a matured transcript of the TNFSF11 gene. Represented by the sequence UniProtKB:O14788-3." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000002107 ! tumor necrosis factor ligand superfamily member 11

[Term]
id: PRO:000002222
name: tumor necrosis factor ligand superfamily member 14
def: "A tumor necrosis factor, TNF-like, that is a translation product of the TNFSF14 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CD258 antigen" EXACT []
synonym: "Herpesvirus entry mediator-ligand" EXACT []
synonym: "HVEM-L" EXACT []
synonym: "HVEML" RELATED []
synonym: "LIGHT" RELATED []
synonym: "TNFSF14" RELATED []
is_a: PRO:000000033 ! tumor necrosis factor, TNF-like

[Term]
id: PRO:000002223
name: tumor necrosis factor ligand superfamily member 15
def: "A tumor necrosis factor, TNF-like, that is a translation product of the TNFSF15 gene." [PRO:WCB]
comment: Category=gene.
synonym: "TL1" RELATED []
synonym: "TNF ligand-related molecule 1" EXACT []
synonym: "TNFSF15" RELATED []
synonym: "Vascular endothelial cell growth inhibitor" EXACT []
synonym: "VEGI" RELATED []
is_a: PRO:000000033 ! tumor necrosis factor, TNF-like

[Term]
id: PRO:000002225
name: tumor necrosis factor receptor superfamily member 10A isoform 1
def: "A tumor necrosis factor receptor superfamily member 10A that is a translation product of a mature transcript of the TNFRSF10A gene. Represented by the human sequence UniProtKB:O00220-1." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000002108 ! tumor necrosis factor receptor superfamily member 10A

[Term]
id: PRO:000002227
name: tumor necrosis factor receptor superfamily member 10B isoform 1
def: "A tumor necrosis factor receptor superfamily member 10B precursor that is a translation product of a mature transcript of the TNFRSF10B gene. Represented by the sequence UniProtKB:Q9QZM4-1." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000002109 ! tumor necrosis factor receptor superfamily member 10B

[Term]
id: PRO:000002228
name: tumor necrosis factor receptor superfamily member 10B isoform 2
def: "A tumor necrosis factor receptor superfamily member 10B precursor that is a translation product of a mature transcript of the TNFRSF10B gene. Represented by the sequence UniProtKB:O14763-1." [PRO:JAN]
comment: Category=sequence.
synonym: "Tumor necrosis factor receptor superfamily member 10B precursor Isoform Long" EXACT []
is_a: PRO:000002109 ! tumor necrosis factor receptor superfamily member 10B

[Term]
id: PRO:000002229
name: tumor necrosis factor receptor superfamily member 10B isoform 3
def: "A tumor necrosis factor receptor superfamily member 10B precursor that is a translation product of a mature transcript of the TNFRSF10B gene. Represented by the sequence UniProtKB:O14763-2." [PRO:JAN]
comment: Category=sequence.
synonym: "Tumor necrosis factor receptor superfamily member 10B precursor isoform Short" EXACT []
is_a: PRO:000002109 ! tumor necrosis factor receptor superfamily member 10B

[Term]
id: PRO:000002231
name: tumor necrosis factor receptor superfamily member 1A isoform 1
def: "A tumor necrosis factor receptor superfamily member 1A precursor that is a translation product of a mature transcript of the TNFRSF1A gene. Represented by the sequence UniProtKB:P19438-1." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000001958 ! tumor necrosis factor receptor superfamily member 1A

[Term]
id: PRO:000002233
name: tumor necrosis factor receptor type 1-associated DEATH domain protein
def: "A protein that is a translation product of the TRADD gene." [PRO:WCB]
comment: Category=gene.
synonym: "TNFR1-associated DEATH domain protein" EXACT []
synonym: "TNFRSF1A-associated via death domain" EXACT []
synonym: "TRADD" RELATED []
synonym: "Tradd" RELATED []
synonym: "Tumor necrosis factor receptor type 1-associated DEATH domain protein" EXACT []
xref: PIRSF:PIRSF038292
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000002236
name: tyrosine-protein kinase BTK isoform 1
def: "A tyrosine-protein kinase BTK that is a translation product of a mature transcript of the BTK gene. Represented by the sequence UniProtKB:Q06187-1." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000002110 ! tyrosine-protein kinase BTK

[Term]
id: PRO:000002238
name: tyrosine-protein kinase ITK/TSK isoform 1
def: "A tyrosine-protein kinase ITK/TSK that is a translation product of a mature transcript of the ITK gene. Represented by the sequence UniProtKB:Q03526-1." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000002111 ! tyrosine-protein kinase ITK/TSK

[Term]
id: PRO:000002239
name: tyrosine-protein kinase ITK/TSK isoform 2
def: "A tyrosine-protein kinase ITK/TSK that is a translation product of a mature transcript of the ITK gene. Represented by the mouse sequence UniProtKB:Q08881-1." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000002111 ! tyrosine-protein kinase ITK/TSK

[Term]
id: PRO:000002240
name: tyrosine-protein kinase Tec
def: "A tyrosine-protein kinase, TEC-like, that is a translation product of the TEC gene." [PRO:WCB]
comment: Category=gene.
synonym: "PSCTK4" RELATED []
synonym: "TEC" RELATED []
xref: PIRSF:PIRSF500764
is_a: PRO:000001967 ! tyrosine-protein kinase TEC-type

[Term]
id: PRO:000002242
name: 14-3-3 protein beta/alpha isoform 1
def: "A 14-3-3 protein beta/alpha that is a translation product of a mature transcript of the YWHAB gene. Represented by the sequence UniProtKB:P31946-1." [PRO:JAN]
comment: Category=sequence.
synonym: "14-3-3 protein beta/alpha isoform Long" EXACT []
is_a: PRO:000002175 ! 14-3-3 protein beta/alpha protein

[Term]
id: PRO:000002243
name: 14-3-3 protein beta/alpha isoform 2
def: "A 14-3-3 protein beta/alpha that is a translation product of a mature transcript of the YWHAB gene. Represented by the sequence UniProtKB:P31946-2." [PRO:JAN]
comment: Category=sequence.
synonym: "14-3-3 protein beta/alpha isoform Short" EXACT []
is_a: PRO:000002175 ! 14-3-3 protein beta/alpha protein

[Term]
id: PRO:000002244
name: 26S proteasome non-ATPase regulatory subunit 1 isoform 1
def: "A 26S proteasome non-ATPase regulatory subunit 1 that is a translation product of a mature transcript of the PSMD1 gene. Represented by the sequence UniProtKB:Q99460-1." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000002176 ! 26S proteasome non-ATPase regulatory subunit 1

[Term]
id: PRO:000002245
name: 26S proteasome non-ATPase regulatory subunit 1 isoform 2
def: "A 26S proteasome non-ATPase regulatory subunit 1 that is a translation product of a mature transcript of the PSMD1 gene. Represented by the sequence UniProtKB:Q99460-2." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000002176 ! 26S proteasome non-ATPase regulatory subunit 1

[Term]
id: PRO:000002246
name: 26S proteasome non-ATPase regulatory subunit 11 isoform 1
def: "A 26S proteasome non-ATPase regulatory subunit 11 that is a translation product of a mature transcript of the PSMD11 gene. Represented by the sequence UniProtKB:Q8BG32-1." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000002177 ! 26S proteasome non-ATPase regulatory subunit 11

[Term]
id: PRO:000002247
name: 26S proteasome non-ATPase regulatory subunit 12 isoform 1
def: "A 26S proteasome non-ATPase regulatory subunit 12 that is a translation product of a mature transcript of the PSMD12 gene. Represented by the sequence UniProtKB:O00232-1." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000002178 ! 26S proteasome non-ATPase regulatory subunit 12

[Term]
id: PRO:000002248
name: 26S proteasome non-ATPase regulatory subunit 13 isoform 1
def: "A 26S proteasome non-ATPase regulatory subunit 13 that is a translation product of a mature transcript of the PSMD13 gene. Represented by the sequence UniProtKB:Q9UNM6-1." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000002179 ! 26S proteasome non-ATPase regulatory subunit 13

[Term]
id: PRO:000002249
name: 26S proteasome non-ATPase regulatory subunit 13 isoform 2
def: "A 26S proteasome non-ATPase regulatory subunit 13 that is a translation product of a mature transcript of the PSMD13 gene. Represented by the sequence UniProtKB:Q9WVJ2-2." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000002179 ! 26S proteasome non-ATPase regulatory subunit 13

[Term]
id: PRO:000002250
name: 26S proteasome non-ATPase regulatory subunit 2 isoform 1
def: "A 26S proteasome non-ATPase regulatory subunit 2 that is a translation product of a mature transcript of the PSMD2 gene. Represented by the sequence UniProtKB:Q8VDM4-1." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000002180 ! 26S proteasome non-ATPase regulatory subunit 2

[Term]
id: PRO:000002251
name: 26S proteasome non-ATPase regulatory subunit 4 isoform 1
def: "A 26S proteasome non-ATPase regulatory subunit 4 that is a translation product of a mature transcript of the PSMD4 gene. Represented by the sequence UniProtKB:O35226-1." [PRO:JAN]
comment: Category=sequence.
synonym: "isoform Rpn10A" EXACT []
is_a: PRO:000002181 ! 26S proteasome non-ATPase regulatory subunit 4

[Term]
id: PRO:000002252
name: 26S proteasome non-ATPase regulatory subunit 4 isoform 2
def: "A 26S proteasome non-ATPase regulatory subunit 4 that is a translation product of a mature transcript of the PSMD4 gene. Represented by the sequence UniProtKB:O35226-2." [PRO:JAN]
comment: Category=sequence.
synonym: "isoform Rpn10B" EXACT []
is_a: PRO:000002181 ! 26S proteasome non-ATPase regulatory subunit 4

[Term]
id: PRO:000002253
name: 26S proteasome non-ATPase regulatory subunit 4 isoform 3
def: "A 26S proteasome non-ATPase regulatory subunit 4 that is a translation product of a mature transcript of the PSMD4 gene. Represented by the sequence UniProtKB:O35226-3." [PRO:JAN]
comment: Category=sequence.
synonym: "isoform Rpn10C" EXACT []
is_a: PRO:000002181 ! 26S proteasome non-ATPase regulatory subunit 4

[Term]
id: PRO:000002254
name: 26S proteasome non-ATPase regulatory subunit 4 isoform 4
def: "A 26S proteasome non-ATPase regulatory subunit 4 that is a translation product of a mature transcript of the PSMD4 gene. Represented by the sequence UniProtKB:O35226-4." [PRO:JAN]
comment: Category=sequence.
synonym: "isoform Rpn10D" EXACT []
is_a: PRO:000002181 ! 26S proteasome non-ATPase regulatory subunit 4

[Term]
id: PRO:000002255
name: 26S proteasome non-ATPase regulatory subunit 4 isoform 5
def: "A 26S proteasome non-ATPase regulatory subunit 4 that is a translation product of a mature transcript of the PSMD4 gene. Represented by the sequence UniProtKB:O35226-5." [PRO:JAN]
comment: Category=sequence.
synonym: "Isoform Rpn10E" EXACT []
is_a: PRO:000002181 ! 26S proteasome non-ATPase regulatory subunit 4

[Term]
id: PRO:000002256
name: 26S proteasome non-ATPase regulatory subunit 4 isoform 6
def: "A 26S proteasome non-ATPase regulatory subunit 4 that is a translation product of a mature transcript of the PSMD4 gene. Represented by the sequence UniProtKB:P55036-2." [PRO:JAN]
comment: Category=sequence.
synonym: "isoform Rpn10E" EXACT []
is_a: PRO:000002181 ! 26S proteasome non-ATPase regulatory subunit 4

[Term]
id: PRO:000002257
name: 26S proteasome non-ATPase regulatory subunit 6 isoform 1
def: "A 26S proteasome non-ATPase regulatory subunit 6 that is a translation product of a mature transcript of the PSMD6 gene. Represented by the sequence UniProtKB:Q99JI4-1." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000002182 ! 26S proteasome non-ATPase regulatory subunit 6

[Term]
id: PRO:000002258
name: BH3-interacting domain death agonist isoform 1
def: "A BH3-interacting domain death agonist that is a translation product of a mature transcript of the BID gene. Represented by the sequence UniProtKB:P70444-1." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000002183 ! BH3-interacting domain death agonist

[Term]
id: PRO:000002259
name: BH3-interacting domain death agonist isoform 2
def: "A BH3-interacting domain death agonist that is a translation product of a mature transcript of the BID gene. Represented by the sequence UniProtKB:P55957-2." [PRO:JAN]
comment: Category=sequence.
synonym: "BID(EL)" EXACT []
is_a: PRO:000002183 ! BH3-interacting domain death agonist

[Term]
id: PRO:000002260
name: BH3-interacting domain death agonist isoform 3
def: "A BH3-interacting domain death agonist that is a translation product of a mature transcript of the BID gene. Represented by the sequence UniProtKB:P55957-3." [PRO:JAN]
comment: Category=sequence.
synonym: " BID(S)" EXACT []
is_a: PRO:000002183 ! BH3-interacting domain death agonist

[Term]
id: PRO:000002261
name: BH3-interacting domain death agonist isoform 4
def: "A BH3-interacting domain death agonist that is a translation product of a mature transcript of the BID gene. Represented by the sequence UniProtKB:P55957-4." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000002183 ! BH3-interacting domain death agonist

[Term]
id: PRO:000002262
name: Bcl-2 homologous antagonist/killer isoform 1 (human)
def: "A Bcl-2 homologous antagonist/killer that is a translation product of a mature transcript of the BAK1 gene. Represented by the sequence UniProtKB:Q16611-1." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000002185 ! Bcl2 homologous antagonist/killer

[Term]
id: PRO:000002263
name: Bcl-2-like protein 11 isoform 1
def: "A Bcl-2-like protein 11 that is a translation product of a mature transcript of the BCL2L11 gene. Represented by the sequence UniProtKB:O43521-1." [PRO:JAN]
comment: Category=sequence.
synonym: "Isoform BimEL" EXACT []
is_a: PRO:000002187 ! Bcl2-like protein 11

[Term]
id: PRO:000002264
name: Bcl-2-like protein 11 isoform 10
def: "A Bcl-2-like protein 11 that is a translation product of a mature transcript of the BCL2L11 gene. Represented by the sequence UniProtKB:O43521-10." [PRO:JAN]
comment: Category=sequence.
synonym: "Isoform Bim-beta1" RELATED []
is_a: PRO:000002187 ! Bcl2-like protein 11

[Term]
id: PRO:000002265
name: Bcl-2-like protein 11 isoform 11
def: "A Bcl-2-like protein 11 that is a translation product of a mature transcript of the BCL2L11 gene. Represented by the sequence UniProtKB:O43521-11." [PRO:JAN]
comment: Category=sequence.
synonym: "Isoform Bim-beta2" EXACT []
is_a: PRO:000002187 ! Bcl2-like protein 11

[Term]
id: PRO:000002266
name: Bcl-2-like protein 11 isoform 12
def: "A Bcl-2-like protein 11 that is a translation product of a mature transcript of the BCL2L11 gene. Represented by the sequence UniProtKB:O43521-12." [PRO:JAN]
comment: Category=sequence.
synonym: "Isoform Bim-beta3" EXACT []
is_a: PRO:000002187 ! Bcl2-like protein 11

[Term]
id: PRO:000002267
name: Bcl-2-like protein 11 isoform 13
def: "A Bcl-2-like protein 11 that is a translation product of a mature transcript of the BCL2L11 gene. Represented by the sequence UniProtKB:O43521-13." [PRO:JAN]
comment: Category=sequence.
synonym: "Isoform Bim-beta4" EXACT []
is_a: PRO:000002187 ! Bcl2-like protein 11

[Term]
id: PRO:000002268
name: Bcl-2-like protein 11 isoform 14
def: "A Bcl-2-like protein 11 that is a translation product of a mature transcript of the BCL2L11 gene. Represented by the sequence UniProtKB:O43521-14." [PRO:JAN]
comment: Category=sequence.
synonym: "Isoform Bim-beta5" EXACT []
is_a: PRO:000002187 ! Bcl2-like protein 11

[Term]
id: PRO:000002269
name: Bcl-2-like protein 11 isoform 15
def: "A Bcl-2-like protein 11 that is a translation product of a mature transcript of the BCL2L11 gene. Represented by the sequence UniProtKB:O43521-15." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000002187 ! Bcl2-like protein 11

[Term]
id: PRO:000002270
name: Bcl-2-like protein 11 isoform 16
def: "A Bcl-2-like protein 11 that is a translation product of a mature transcript of the BCL2L11 gene. Represented by the sequence UniProtKB:O43521-16." [PRO:JAN]
comment: Category=sequence.
synonym: "Isoform Bim-beta7 " EXACT []
is_a: PRO:000002187 ! Bcl2-like protein 11

[Term]
id: PRO:000002271
name: Bcl-2-like protein 11 isoform 17
def: "A Bcl-2-like protein 11 that is a translation product of a mature transcript of the BCL2L11 gene. Represented by the sequence UniProtKB:O43521-17." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000002187 ! Bcl2-like protein 11

[Term]
id: PRO:000002272
name: Bcl-2-like protein 11 isoform 2
def: "A Bcl-2-like protein 11 that is a translation product of a mature transcript of the BCL2L11 gene. Represented by the sequence UniProtKB:O43521-2." [PRO:JAN]
comment: Category=sequence.
synonym: "Isoform BimL" EXACT []
is_a: PRO:000002187 ! Bcl2-like protein 11

[Term]
id: PRO:000002273
name: Bcl-2-like protein 11 isoform 3
def: "A Bcl-2-like protein 11 that is a translation product of a mature transcript of the BCL2L11 gene. Represented by the sequence UniProtKB:O43521-3." [PRO:JAN]
comment: Category=sequence.
synonym: "Isoform BimS" EXACT []
is_a: PRO:000002187 ! Bcl2-like protein 11

[Term]
id: PRO:000002274
name: Bcl-2-like protein 11 isoform 4
def: "A Bcl-2-like protein 11 that is a translation product of a mature transcript of the BCL2L11 gene. Represented by the sequence UniProtKB:O43521-4." [PRO:JAN]
comment: Category=sequence.
synonym: "Isoform Bim-alpha1" EXACT []
is_a: PRO:000002187 ! Bcl2-like protein 11

[Term]
id: PRO:000002275
name: Bcl-2-like protein 11 isoform 5
def: "A Bcl-2-like protein 11 that is a translation product of a mature transcript of the BCL2L11 gene. Represented by the sequence UniProtKB:O43521-5." [PMID:11734221, PRO:JAN]
comment: Category=sequence.
synonym: "Isoform Bim-alpha2" EXACT []
is_a: PRO:000002187 ! Bcl2-like protein 11

[Term]
id: PRO:000002276
name: Bcl-2-like protein 11 isoform 6
def: "A Bcl-2-like protein 11 that is a translation product of a mature transcript of the BCL2L11 gene. Represented by the sequence UniProtKB:O43521-6." [PMID:15147734, PRO:JAN]
comment: Category=sequence.
synonym: "BCL2-like 11 transcript variant 10" EXACT []
synonym: "Isoform Bim-alpha3" EXACT []
is_a: PRO:000002187 ! Bcl2-like protein 11

[Term]
id: PRO:000002277
name: Bcl-2-like protein 11 isoform 7
def: "A Bcl-2-like protein 11 that is a translation product of a mature transcript of the BCL2L11 gene. Represented by the sequence UniProtKB:O43521-7." [PRO:JAN]
comment: Category=sequence.
synonym: "Isoform Bim-alpha4" EXACT []
is_a: PRO:000002187 ! Bcl2-like protein 11

[Term]
id: PRO:000002278
name: Bcl-2-like protein 11 isoform 8
def: "A Bcl-2-like protein 11 that is a translation product of a mature transcript of the BCL2L11 gene. Represented by the sequence UniProtKB:O43521-8." [PRO:JAN]
comment: Category=sequence.
synonym: "Isoform Bim-alpha5" EXACT []
is_a: PRO:000002187 ! Bcl2-like protein 11

[Term]
id: PRO:000002279
name: Bcl-2-like protein 11 isoform 9
def: "A Bcl-2-like protein 11 that is a translation product of a mature transcript of the BCL2L11 gene. Represented by the sequence UniProtKB:O43521-9." [PRO:JAN]
comment: Category=sequence.
synonym: "Isoform Bim-alpha6" EXACT []
is_a: PRO:000002187 ! Bcl2-like protein 11

[Term]
id: PRO:000002280
name: Bcl2 antagonist of cell death isoform 1
def: "A Bcl2 antagonist of cell death that is a translation product of a mature transcript of the BAD gene. Represented by the sequence UniProtKB:Q61337-1." [PRO:JAN]
comment: Category=sequence.
synonym: "BAD" EXACT []
synonym: "BAD isoform alpha" EXACT []
synonym: "bcl-2-binding component 6 " EXACT []
synonym: "bcl-xL/Bcl-2-associated death promoter" EXACT []
is_a: PRO:000002184 ! Bcl2 antagonist of cell death

[Term]
id: PRO:000002281
name: Bcl2 antagonist of cell death isoform 2
def: "A Bcl2 antagonist of cell death that is a translation product of a mature transcript of the BAD gene. Represented by the sequence UniProtKB:Q92934-1." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000002184 ! Bcl2 antagonist of cell death

[Term]
id: PRO:000002282
name: CASP8 and FADD-like apoptosis regulator
def: "A caspase-8-like protease that is a translation product of the CFLAR gene." [PRO:WCB]
comment: Category=gene.
synonym: "c-FLIP" EXACT []
synonym: "CASH" RELATED []
synonym: "CASP8AP1" RELATED []
synonym: "Caspase homolog" EXACT []
synonym: "Caspase-eight-related protein" EXACT []
synonym: "Caspase-like apoptosis regulatory protein" EXACT []
synonym: "Casper" EXACT []
synonym: "Cellular FLICE-like inhibitory protein" EXACT []
synonym: "CFLAR" RELATED []
synonym: "CLARP" RELATED []
synonym: "FADD-like antiapoptotic molecule 1" EXACT []
synonym: "FLAME-1" EXACT []
synonym: "I-FLICE" EXACT []
synonym: "Inhibitor of FLICE" EXACT []
synonym: "MACH-related inducer of toxicity" EXACT []
synonym: "MRIT" RELATED []
synonym: "Usurpin" EXACT []
is_a: PRO:000002197 ! caspase-8-like protease

[Term]
id: PRO:000002283
name: DNA fragmentation factor subunit alpha isoform 1
def: "A DNA fragmentation factor subunit alpha that is a translation product of a mature transcript of the DFFA gene. Represented by the sequence UniProtKB:O00273-1." [PRO:JAN]
comment: Category=sequence.
synonym: "DNA fragmentation factor subunit alpha isoform DFF45 [9606]" EXACT []
synonym: "DNA fragmentation factor subunit alpha isoform ICAD-L [10090]" EXACT []
is_a: PRO:000002188 ! DNA fragmentation factor subunit alpha

[Term]
id: PRO:000002284
name: DNA fragmentation factor subunit alpha isoform 2
def: "A DNA fragmentation factor subunit alpha that is a translation product of a mature transcript of the DFFA gene. Represented by the sequence UniProtKB:O54786-2." [PRO:JAN]
comment: Category=sequence.
synonym: "DFF35" RELATED []
synonym: "isoform ICAD-S" EXACT []
is_a: PRO:000002188 ! DNA fragmentation factor subunit alpha

[Term]
id: PRO:000002285
name: FADD protein isoform 1
def: "A FADD protein that is a translation product of a mature transcript of the FADD gene. Represented by the sequence UniProtKB:Q13158-1." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000002189 ! FADD protein

[Term]
id: PRO:000002286
name: RAC-alpha serine/threonine-protein kinase isoform 1
def: "A RAC-alpha serine/threonine-protein kinase that is a translation product of a mature transcript of the AKT1 gene. Represented by the sequence UniProtKB:P31749-1." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000002190 ! RAC-alpha serine/threonine-protein kinase

[Term]
id: PRO:000002287
name: TNF receptor-associated factor 1
def: "A TNF receptor-associated factor that is a translation product of the TRAF1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "EBI6" RELATED []
synonym: "Epstein-Barr virus-induced protein 6" EXACT []
synonym: "TRAF1" RELATED []
is_a: PRO:000002191 ! TNF receptor-associated factor

[Term]
id: PRO:000002288
name: TNF receptor-associated factor 2
def: "A TNF receptor-associated factor that is a translation product of the TRAF2 gene." [PRO:WCB]
comment: Category=gene.
synonym: "TRAF2" RELATED []
synonym: "Traf2" RELATED []
synonym: "TRAP3" RELATED []
synonym: "Tumor necrosis factor type 2 receptor-associated protein 3" EXACT []
is_a: PRO:000002191 ! TNF receptor-associated factor

[Term]
id: PRO:000002289
name: TNF receptor-associated factor 3
def: "A TNF receptor-associated factor that is a translation product of the TRAF3 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CAP-1" EXACT []
synonym: "CAP1" RELATED []
synonym: "CD40 receptor-associated factor 1" EXACT []
synonym: "CD40-binding protein" EXACT []
synonym: "CD40BP" EXACT []
synonym: "CRAF1" EXACT []
synonym: "LAP1" EXACT []
synonym: "LMP1-associated protein" EXACT []
synonym: "TRAF3" RELATED []
synonym: "TRAFAMN" EXACT []
is_a: PRO:000002191 ! TNF receptor-associated factor

[Term]
id: PRO:000002290
name: TNF receptor-associated factor 4
def: "A TNF receptor-associated factor that is a translation product of the TRAF4 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CART1" RELATED []
synonym: "Cysteine-rich domain associated with RING and Traf domains protein 1" EXACT []
synonym: "Cysteine-rich motif associated to RING and Traf domains protein 1" RELATED []
synonym: "Malignant 62" EXACT []
synonym: "MLN62" RELATED []
synonym: "RING finger protein 83" EXACT []
synonym: "RNF83" RELATED []
synonym: "TRAF4" RELATED []
is_a: PRO:000002191 ! TNF receptor-associated factor

[Term]
id: PRO:000002291
name: TNF receptor-associated factor 5
def: "A TNF receptor-associated factor that is a translation product of the TRAF5 gene." [PRO:WCB]
comment: Category=gene.
synonym: "RING finger protein 84" EXACT []
synonym: "RNF84" RELATED []
synonym: "TRAF5" RELATED []
is_a: PRO:000002191 ! TNF receptor-associated factor

[Term]
id: PRO:000002292
name: TNF receptor-associated factor 6
def: "A TNF receptor-associated factor that is a translation product of the TRAF6 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Interleukin-1 signal transducer" EXACT []
synonym: "RING finger protein 85" EXACT []
synonym: "RNF85" RELATED []
synonym: "TRAF6" RELATED []
is_a: PRO:000002191 ! TNF receptor-associated factor

[Term]
id: PRO:000002293
name: apoptosis protease-activating factor 1 isoform 1
def: "An apoptosis protease-activating factor 1 that is a translation product of a mature transcript of the APAF1 gene. Represented by the sequence UniProtKB:O14727-1." [PMID:10393175, PMID:10441496, PRO:JAN]
comment: Category=sequence.
synonym: "Apaf-1L" RELATED []
synonym: "Apaf-1XL" EXACT []
is_a: PRO:000002194 ! apoptotic protease-activating factor 1

[Term]
id: PRO:000002294
name: apoptosis protease-activating factor 1 isoform 2
def: "An apoptosis protease-activating factor 1 that is a translation product of a mature transcript of the APAF1 gene. Represented by the sequence UniProtKB:O14727-2." [PRO:JAN]
comment: Category=sequence.
synonym: "Apaf-1L" EXACT []
is_a: PRO:000002194 ! apoptotic protease-activating factor 1

[Term]
id: PRO:000002295
name: apoptosis protease-activating factor 1 isoform 3
def: "An apoptosis protease-activating factor 1 that is a translation product of a mature transcript of the APAF1 gene. Represented by the sequence UniProtKB:O14727-3." [PRO:JAN]
comment: Category=sequence.
synonym: "Apaf-1S" EXACT []
is_a: PRO:000002194 ! apoptotic protease-activating factor 1

[Term]
id: PRO:000002296
name: apoptosis protease-activating factor 1 isoform 4
def: "An apoptosis protease-activating factor 1 that is a translation product of a mature transcript of the APAF1 gene. Represented by the sequence UniProtKB:O14727-4." [PRO:JAN]
comment: Category=sequence.
synonym: "Apaf-1M" EXACT []
is_a: PRO:000002194 ! apoptotic protease-activating factor 1

[Term]
id: PRO:000002297
name: apoptosis protease-activating factor 1 isoform 5
def: "An apoptosis protease-activating factor 1 that is a translation product of a mature transcript of the APAF1 gene. Represented by the sequence UniProtKB:O14727-5." [PRO:JAN]
comment: Category=sequence.
synonym: "Apaf-1XS" EXACT []
is_a: PRO:000002194 ! apoptotic protease-activating factor 1

[Term]
id: PRO:000002298
name: apoptosis protease-activating factor 1 isoform 6
def: "An apoptosis protease-activating factor 1 that is a translation product of a mature transcript of the APAF1 gene. Represented by the sequence UniProtKB:O14727-6." [PRO:JAN]
comment: Category=sequence.
synonym: "Apaf-1-ALT" EXACT []
is_a: PRO:000002194 ! apoptotic protease-activating factor 1

[Term]
id: PRO:000002299
name: apoptosis regulator BAX isoform 1
def: "An apoptosis regulator BAX that is a translation product of a mature transcript of the BAX gene. It contains one copy of the Bcl-2 domain, and a C-terminal single transmembrane domain. Represented by the sequence UniProtKB:Q07813-1." [PMID:8358790, PRO:JAN, PRO:SY]
comment: Category=sequence.
synonym: "isoform alpha" EXACT []
is_a: PRO:000002193 ! apoptosis regulator BAX

[Term]
id: PRO:000002300
name: apoptosis regulator BAX isoform 2
def: "An apoptosis regulator BAX that is a translation product of a mature transcript of the BAX gene. It lacks the transmembrane domain due to the presence of a longer and distinct C-terminal sequence compared to isoform 1. Represented by the sequence UniProtKB:Q07812-2." [PMID:8358790, PRO:JAN, PRO:SY]
comment: Category=sequence.
synonym: "isoform beta" EXACT []
is_a: PRO:000002193 ! apoptosis regulator BAX

[Term]
id: PRO:000002301
name: apoptosis regulator BAX isoform 3.
def: "An apoptosis regulator BAX that is a translation product of a mature transcript of the BAX gene. Isoform 3 is about 40 residues long comprising the first 11 N-terminal residues in common to isoform 1 and a unique C-terminal sequence. Represented by the sequence UniProtKB:Q07812-3." [PMID:8358790, PRO:JAN, PRO:SY]
comment: Category=sequence.
synonym: "Apoptosis regulator BAX isoform Gamma " EXACT []
is_a: PRO:000002193 ! apoptosis regulator BAX

[Term]
id: PRO:000002302
name: apoptosis regulator BAX isoform 4
def: "An apoptosis regulator BAX that is a translation product of a mature transcript of the BAX gene. Isoform 4 has in common with isoform 1 the N-terminal (first 30 residues) and C-terminal regions, but differs from isoform 1 in that the former lacks a region of about 50 residues, that includes the BH3 motif region, therefore isoform 4 contains a partial copy of the Bcl-2 domain. Represented by the sequence UniProtKB:Q07812-4." [PMID:7607685, PRO:JAN, PRO:SY]
comment: Category=sequence.
synonym: "Isoform Delta" EXACT []
is_a: PRO:000002193 ! apoptosis regulator BAX

[Term]
id: PRO:000002303
name: apoptosis regulator BAX isoform 5
def: "An apoptosis regulator BAX that is a translation product of a mature transcript of the BAX gene. Isoform 5 differs from isoform 1 in that the former lacks the BH2 motif region, because it contains a different C-terminal sequence Represented by the sequence UniProtKB:Q07812-5." [PMID:9920818, PRO:JAN, PRO:SY]
comment: Category=sequence.
synonym: "Apoptosis regulator BAX isoform Epsilon " EXACT []
is_a: PRO:000002193 ! apoptosis regulator BAX

[Term]
id: PRO:000002304
name: apoptosis regulator BAX isoform 6
def: "An apoptosis regulator BAX that is a translation product of a mature transcript of the BAX gene. It lacks the N-terminal region up to the end of the BH3 motif. Isoform 6 contains a partial copy of the Bcl-2 domain. Represented by the sequence UniProtKB:Q07812-6." [PRO:JAN, PRO:SY]
comment: Category=sequence.
synonym: "Apoptosis regulator BAX isoform Zeta " EXACT []
is_a: PRO:000002193 ! apoptosis regulator BAX

[Term]
id: PRO:000002305
name: apoptosis regulator BAX isoform 7
def: "An apoptosis regulator BAX that is a translation product of a mature transcript of the BAX gene. Isoform 7 is missing the N-terminal region of about 20 residues compared to isoform 1. Represented by the sequence UniProtKB:Q07812-7." [PMID:11912183, PRO:JAN, PRO:SYC]
comment: Category=sequence.
synonym: "Apoptosis regulator BAX isoform kappa" RELATED []
synonym: "Apoptosis regulator BAX isoform Psi" EXACT []
is_a: PRO:000002193 ! apoptosis regulator BAX

[Term]
id: PRO:000002306
name: apoptosis regulator BAX isoform 8
def: "An apoptosis regulator BAX that is a translation product of a mature transcript of the BAX gene. Isoform 8 differs from isoform 1 in that the former lacks the region between the BH2 motif region and the transmembrane domain. Represented by the sequence UniProtKB:Q9NYG7-1." [PMID:10200554, PRO:SY]
comment: Category=sequence.
synonym: "Isoform Sigma" EXACT []
is_a: PRO:000002193 ! apoptosis regulator BAX

[Term]
id: PRO:000002307
name: apoptosis regulator Bcl-2
def: "A Bcl2-like apoptosis inhibitor that is a translation product of the BCL2 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Bcl-2" RELATED []
synonym: "BCL2" RELATED []
synonym: "Bcl2" RELATED []
is_a: PRO:000002186 ! Bcl2-like apoptosis inhibitor

[Term]
id: PRO:000002308
name: Bcl-2-like protein 1
def: "A Bcl2-like apoptosis inhibitor that is a translation product of the BCL2L1 gene." [PRO:WCB]
comment: Category=gene.
synonym: "apoptosis regulator Bcl-X" EXACT []
synonym: "BCL2L" RELATED []
synonym: "Bcl2l" RELATED []
synonym: "Bcl2l1" RELATED []
synonym: "BCL2L1" RELATED []
synonym: "BCLX" RELATED []
synonym: "Bclx" RELATED []
is_a: PRO:000002186 ! Bcl2-like apoptosis inhibitor

[Term]
id: PRO:000002309
name: caspase-1
def: "A caspase-1-like protease that is a translation product of the CASP1 gene. The active form of this protein proteolytically cleaves pro-IL-1beta to its mature, active form. The holoenzyme is a homodimer of catalytic domains, each of which contains the cleaved products caspase-1 p20 and p10 subunits." [PMID:8044845, PRO:WCB]
comment: Category=gene.
synonym: "CASP-1" EXACT []
synonym: "CASP1" RELATED []
synonym: "ICE" EXACT []
synonym: "IL-1 beta-converting enzyme" EXACT []
synonym: "IL-1BC" EXACT []
synonym: "IL1BC" RELATED []
synonym: "IL1BCE" RELATED []
synonym: "Interleukin-1 beta convertase" EXACT []
synonym: "Interleukin-1 beta-converting enzyme" EXACT []
synonym: "p45" EXACT []
is_a: PRO:000002195 ! caspase-1-like protease

[Term]
id: PRO:000002310
name: caspase-10
def: "A caspase-8-like protease that is a translation product of the CASP10 gene. Not found in mouse." [PRO:WCB]
comment: Category=gene.
synonym: "Apoptotic protease Mch-4" EXACT []
synonym: "CASP-10" EXACT []
synonym: "CASP10" RELATED []
synonym: "Caspase-10 precursor" EXACT []
synonym: "Caspase-10 subunit p12" EXACT []
synonym: "Caspase-10 subunit p23/17" EXACT []
synonym: "FAS-associated death domain protein interleukin-1B-converting enzyme 2" EXACT []
synonym: "FLICE2" EXACT []
synonym: "ICE-like apoptotic protease 4" EXACT []
synonym: "MCH4" RELATED []
xref: PIRSF:PIRSF500655
is_a: PRO:000002197 ! caspase-8-like protease

[Term]
id: PRO:000002311
name: caspase-2
def: "A caspase-1-like protease that is a translation product of the CASP2 gene. This protein is involved in the activation cascade of caspases responsible for apoptosis execution." [PRO:WCB]
comment: Category=gene.
synonym: "CASP-2" EXACT []
synonym: "CASP2" RELATED []
synonym: "ICH-1 protease" EXACT []
synonym: "ICH1" RELATED []
synonym: "NEDD-2" EXACT []
synonym: "NEDD2" RELATED []
synonym: "Neural precursor cell expressed developmentally down-regulated protein 2" EXACT []
is_a: PRO:000002195 ! caspase-1-like protease

[Term]
id: PRO:000002312
name: caspase-3
def: "A caspase-3 like protease protein that is a translation product of the CASP3 gene." [PRO:JAN]
comment: Category=gene.
synonym: "Apopain" EXACT []
synonym: "CASP-3" EXACT []
synonym: "Casp3" RELATED []
synonym: "CASP3" RELATED []
synonym: "Caspase-3 subunit p12" EXACT []
synonym: "Caspase-3 subunit p17" EXACT []
synonym: "CPP-32" EXACT []
synonym: "CPP32" RELATED []
synonym: "Cpp32" RELATED []
synonym: "Cysteine protease CPP32" EXACT []
synonym: "LICE" EXACT []
synonym: "SCA-1" EXACT []
synonym: "SREBP cleavage activity 1" EXACT []
synonym: "Yama protein" EXACT []
xref: PANTHER:PTHR10454\:SF30
is_a: PRO:000002196 ! caspase-3-like protease

[Term]
id: PRO:000002313
name: caspase-4
def: "A caspase-1-like protease that is a translation product of the CASP4 gene." [PRO:WCB]
comment: Category=gene.
synonym: "CASP-4" EXACT []
synonym: "Casp11" RELATED []
synonym: "CASP4" RELATED []
synonym: "Caspl" RELATED []
synonym: "ICE(rel)-II" EXACT []
synonym: "ICH-2 protease" EXACT []
synonym: "ICH2" RELATED []
synonym: "Ich3" RELATED []
synonym: "TX protease" EXACT []
is_a: PRO:000002195 ! caspase-1-like protease

[Term]
id: PRO:000002314
name: caspase-5
def: "A caspase-1-like protease that is a translation product of the CASP5 gene. This gene arose from a duplication of the CASP4 gene in the human line and is not found in mouse." [PRO:WCB]
comment: Category=gene.
synonym: "CASP-5" EXACT []
synonym: "CASP5" RELATED []
synonym: "ICE(rel)-III" RELATED []
synonym: "ICH-3 protease" EXACT []
synonym: "ICH3" RELATED []
synonym: "TY protease" EXACT []
is_a: PRO:000002195 ! caspase-1-like protease

[Term]
id: PRO:000002315
name: caspase-6
def: "A caspase-3-like protease that is a translation product of the CASP6 gene." [PRO:CNA]
comment: Category=gene.
synonym: "Apoptotic protease Mch-2" EXACT []
synonym: "CASP-6" EXACT []
synonym: "CASP6" RELATED []
synonym: "Casp6" RELATED []
synonym: "Caspase-6 subunit p11" EXACT []
synonym: "Caspase-6 subunit p18" EXACT []
synonym: "MCH2" RELATED []
xref: PANTHER:PTHR10454\:SF29
is_a: PRO:000002196 ! caspase-3-like protease

[Term]
id: PRO:000002316
name: caspase-7
def: "A caspase-3-like protease that is a translation product of the CASP7 gene." [PRO:CNA]
comment: Category=gene.
synonym: "Apoptotic protease Mch-3" EXACT []
synonym: "CASP-7" EXACT []
synonym: "Casp7" RELATED []
synonym: "CASP7" RELATED []
synonym: "Caspase-7 subunit p11" EXACT []
synonym: "Caspase-7 subunit p20" EXACT []
synonym: "CMH-1" EXACT []
synonym: "ICE-LAP3" EXACT []
synonym: "ICE-like apoptotic protease 3" EXACT []
synonym: "LICE2 cysteine protease" EXACT []
synonym: "Lice2, Mch3" RELATED []
synonym: "MCH3" RELATED []
xref: PANTHER:PTHR10454\:SF31
is_a: PRO:000002196 ! caspase-3-like protease

[Term]
id: PRO:000002317
name: caspase-8
def: "A caspase-8-like protease that is a translation product of the CASP8 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Apoptotic cysteine protease" EXACT []
synonym: "Apoptotic protease Mch-5" EXACT []
synonym: "CAP4" EXACT []
synonym: "CASP-8" EXACT []
synonym: "Casp8" RELATED []
synonym: "CASP8" RELATED []
synonym: "Caspase-8 precursor" EXACT []
synonym: "Caspase-8 subunit p10" EXACT []
synonym: "Caspase-8 subunit p18" EXACT []
synonym: "FADD-homologous ICE/CED-3-like protease" EXACT []
synonym: "FADD-like ICE" EXACT []
synonym: "FLICE" EXACT []
synonym: "ICE-like apoptotic protease 5" EXACT []
synonym: "MACH" EXACT []
synonym: "MCH5" RELATED []
synonym: "MORT1-associated CED-3 homolog" EXACT []
xref: PIRSF:PIRSF500656
is_a: PRO:000002197 ! caspase-8-like protease

[Term]
id: PRO:000002318
name: caspase-9
def: "A caspase-1-like protease that is a translation product of the CASP9 gene." [PRO:WCB]
comment: Category=gene.
synonym: "APAF-3" EXACT []
synonym: "Apoptotic protease Mch-6" EXACT []
synonym: "Apoptotic protease-activating factor 3" EXACT []
synonym: "CASP-9" EXACT []
synonym: "CASP9" RELATED []
synonym: "Caspase-9 subunit p10" EXACT []
synonym: "Caspase-9 subunit p35" EXACT []
synonym: "ICE-LAP6" EXACT []
synonym: "ICE-like apoptotic protease 6" EXACT []
synonym: "MCH6" RELATED []
is_a: PRO:000002195 ! caspase-1-like protease

[Term]
id: PRO:000002319
name: catenin beta-1 isoform 1
def: "A catenin beta-1 that is a translation product of a mature transcript of the CTNNB1 gene. Represented by the sequence UniProtKB:P35222-1." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000002198 ! catenin beta-1

[Term]
id: PRO:000002320
name: catenin beta-1 isoform 2
def: "A catenin beta-1 that is a translation product of a mature transcript of the CTNNB1 gene. Represented by the sequence UniProtKB:P35222-2." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000002198 ! catenin beta-1

[Term]
id: PRO:000002321
name: cytochrome c, somatic
def: "A cytochrome c that is a translation product of the CYCS gene." [PRO:WCB]
comment: Category=gene.
synonym: "CYC" RELATED []
synonym: "CYCS" RELATED []
synonym: "Cytochrome c" EXACT []
synonym: "cytochrome c, somatic" EXACT []
xref: PIRSF:PIRSF500152
is_a: PRO:000002199 ! cytochrome c

[Term]
id: PRO:000002322
name: cytochrome c, testis-specific
def: "A cytochrome c that is a translation product of the Cyct gene. The protein is a testis-specific cytochrome c found in mouse and rat but not in human." [PRO:WCB]
comment: Category=gene.
synonym: "CYCT" RELATED []
xref: PIRSF:PIRSF500152
is_a: PRO:000002199 ! cytochrome c

[Term]
id: PRO:000002323
name: cytoplasmic tyrosine-protein kinase BMX isoform 1
def: "A cytoplasmic tyrosine-protein kinase BMX that is a translation product of a mature transcript of the BMX gene. Represented by the sequence UniProtKB:P97504-1." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000002200 ! cytoplasmic tyrosine-protein kinase BMX

[Term]
id: PRO:000002324
name: cytoplasmic tyrosine-protein kinase BMX isoform 2
def: "A cytoplasmic tyrosine-protein kinase BMX that is a translation product of a mature transcript of the BMX gene. Represented by the sequence UniProtKB:P51813-1." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000002200 ! cytoplasmic tyrosine-protein kinase BMX

[Term]
id: PRO:000002325
name: dynein light chain 1, cytoplasmic
def: "A dynein light chain that is a translation product of the DYNLL1 gene. Dynein light chain 1 is a component of the dynein motor complex." [PRO:WCB]
comment: Category=gene.
synonym: "8 kDa dynein light chain" EXACT []
synonym: "Dlc1, Dncl1, Dnclc1" RELATED []
synonym: "DLC1, DNCL1, DNCLC1, HDLC1" RELATED []
synonym: "DLC8" EXACT []
synonym: "Dynein light chain LC8-type 1" EXACT []
synonym: "Dynll1" RELATED []
synonym: "DYNLL1" RELATED []
synonym: "PIN" EXACT []
synonym: "Protein inhibitor of neuronal nitric oxide synthase" EXACT []
is_a: PRO:000002201 ! dynein light chain

[Term]
id: PRO:000002326
name: dynein light chain 2, cytoplasmic
def: "A dynein light chain that is a translation product of the DYNLL2 gene. Dynein light chain 2 is a component of the myosin V motor complex." [PRO:WCB]
comment: Category=gene.
synonym: "8 kDa dynein light chain" EXACT []
synonym: "Dlc2" RELATED []
synonym: "DLC2" RELATED []
synonym: "DLC8" EXACT []
synonym: "DLC8b" EXACT []
synonym: "Dynein light chain LC8-type 2" EXACT []
synonym: "Dynll2" RELATED []
synonym: "DYNLL2" RELATED []
is_a: PRO:000002201 ! dynein light chain

[Term]
id: PRO:000002327
name: gelsolin isoform 1
def: "A gelsolin that is a translation product of a mature transcript of the GSN gene. Represented by the sequence UniProtKB:P06396-1." [PRO:JAN]
comment: Category=sequence.
synonym: "Plasma" EXACT []
synonym: "Secreted" EXACT []
is_a: PRO:000002202 ! gelsolin

[Term]
id: PRO:000002328
name: gelsolin isoform 2
def: "A gelsolin that is a translation product of a mature transcript of the GSN gene. Represented by the sequence UniProtKB:P06396-2." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000002202 ! gelsolin

[Term]
id: PRO:000002329
name: glycylpeptide N-tetradecanoyltransferase 1 isoform 1
def: "A glycylpeptide N-tetradecanoyltransferase 1 that is a translation product of a mature transcript of the NMT1 gene. Represented by the sequence UniProtKB:P30419-1." [PRO:JAN]
comment: Category=sequence.
synonym: "Glycylpeptide N-tetradecanoyltransferase 1 isoform Long" EXACT []
is_a: PRO:000002203 ! glycylpeptide N-tetradecanoyltransferase 1

[Term]
id: PRO:000002330
name: glycylpeptide N-tetradecanoyltransferase 1 isoform 2
def: "A glycylpeptide N-tetradecanoyltransferase 1 that is a translation product of a mature transcript of the NMT1 gene. Represented by the sequence UniProtKB:P30419-2." [PRO:JAN]
comment: Category=sequence.
synonym: "Glycylpeptide N-tetradecanoyltransferase 1 isoform Short" EXACT []
is_a: PRO:000002203 ! glycylpeptide N-tetradecanoyltransferase 1

[Term]
id: PRO:000002331
name: lymphotoxin-alpha isoform 1
def: "A lymphotoxin-alpha that is a translation product of a mature transcript of the LTA gene. Represented by the sequence UniProtKB:P09225-1." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000002204 ! lymphotoxin-alpha

[Term]
id: PRO:000002332
name: lymphotoxin-beta isoform 1
def: "A lymphotoxin-beta that is a translation product of a mature transcript of the LTB gene. Represented by the sequence UniProtKB:P41155-1." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000002205 ! lymphotoxin-beta

[Term]
id: PRO:000002333
name: lymphotoxin-beta isoform 2
def: "A lymphotoxin-beta that is a translation product of a mature transcript of the LTB gene. Represented by the sequence Q06643-1." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000002205 ! lymphotoxin-beta

[Term]
id: PRO:000002334
name: mitogen-activated protein kinase 8 isoform 1
def: "A mitogen-activated protein kinase 8 that is a translation product of a mature transcript of the MAPK8 gene. Represented by the sequence UniProtKB:P45983-2." [PRO:JAN]
comment: Category=sequence.
synonym: " JNK1-alpha-1" EXACT []
is_a: PRO:000002206 ! mitogen-activated protein kinase 8

[Term]
id: PRO:000002335
name: mitogen-activated protein kinase 8 isoform 2
def: "A mitogen-activated protein kinase 8 that is a translation product of a mature transcript of the MAPK8 gene. Represented by the sequence UniProtKB:P45983-1." [PRO:JAN]
comment: Category=sequence.
synonym: "JNK1-alpha-2" EXACT []
is_a: PRO:000002206 ! mitogen-activated protein kinase 8

[Term]
id: PRO:000002336
name: mitogen-activated protein kinase 8 isoform 3
def: "A mitogen-activated protein kinase 8 that is a translation product of a mature transcript of the MAPK8 gene. Represented by the sequence UniProtKB:P45983-3." [PRO:JAN]
comment: Category=sequence.
synonym: "JNK1-beta-1" EXACT []
is_a: PRO:000002206 ! mitogen-activated protein kinase 8

[Term]
id: PRO:000002337
name: mitogen-activated protein kinase 8 isoform 4
def: "A mitogen-activated protein kinase 8 that is a translation product of a mature transcript of the MAPK8 gene. Represented by the sequence UniProtKB:P45983-4." [PRO:JAN]
comment: Category=sequence.
synonym: "JNK1-beta-2" EXACT []
is_a: PRO:000002206 ! mitogen-activated protein kinase 8

[Term]
id: PRO:000002338
name: occludin isoform 1
def: "An occludin that is a translation product of a mature transcript of the OCLN gene. Represented by the sequence UniProtKB:Q16625-1." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000002207 ! occludin

[Term]
id: PRO:000002339
name: proteasome subunit beta type-2 isoform 1
def: "A proteasome subunit beta type-2 that is a translation product of a mature transcript of the PSMB2 gene. Represented by the sequence UniProtKB:P49721-1." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000002208 ! proteasome subunit beta type-2

[Term]
id: PRO:000002340
name: proteasome subunit beta type-4 isoform 1
def: "A proteasome subunit beta type-4 that is a translation product of a mature transcript of the PSMB4 gene. Represented by the sequence UniProtKB:P28070-1." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000002209 ! proteasome subunit beta type-4

[Term]
id: PRO:000002341
name: protein kinase C delta type
def: "A protein kinase C, delta type, that is a translation product of the PRKCD gene." [PRO:WCB]
comment: Category=gene.
synonym: "nPKC-delta" EXACT []
synonym: "Pkcd" RELATED []
synonym: "PRKCD" RELATED []
synonym: "Prkcd" RELATED []
xref: PIRSF:PIRSF501104
is_a: PRO:000002210 ! protein kinase C, delta-like

[Term]
id: PRO:000002342
name: protein kinase C epsilon
def: "A protein kinase C, protein kinase C, epsilon type, that is a translation product of the PRKCE gene." [PRO:WCB]
comment: Category=gene.
synonym: "nPKC-epsilon" EXACT []
synonym: "PKCE" EXACT []
synonym: "Pkcea" EXACT []
synonym: "PRKCE" EXACT []
xref: PIRSF:PIRSF501106
is_a: PRO:000002210 ! protein kinase C, delta-like

[Term]
id: PRO:000002343
name: protein kinase C eta type
def: "A protein kinase C, eta type, that is a translation product of the PRKCH gene." [PRO:WCB]
comment: Category=gene.
synonym: "nPKC-eta" EXACT []
synonym: "PKC-L" RELATED []
synonym: "PKCL" RELATED []
synonym: "PRKCH" RELATED []
synonym: "PRKCL" RELATED []
xref: PIRSF:PIRSF501107
is_a: PRO:000002210 ! protein kinase C, delta-like

[Term]
id: PRO:000002344
name: protein kinase C theta type
def: "A protein kinase C, theta type, that is a translation product of the PRKCQ gene." [PRO:WCB]
comment: Category=gene.
synonym: "nPKC-theta" EXACT []
synonym: "Pkcq" RELATED []
synonym: "PRKCQ" RELATED []
synonym: "Prkcq" RELATED []
synonym: "PRKCT" RELATED []
xref: PIRSF:PIRSF501105
is_a: PRO:000002210 ! protein kinase C, delta-like

[Term]
id: PRO:000002345
name: rho GTPase-activating protein 10 isoform 1
def: "A Rho GTPase-activating protein 10 that is a translation product of a mature transcript of the ARHGAP10 gene. Represented by the sequence UniProtKB:A1A4S6-1." [PRO:JAN]
comment: Category=sequence.
synonym: "PS-GAP-a" EXACT []
synonym: "PSGAP-m" EXACT []
is_a: PRO:000002211 ! rho GTPase-activating protein 10

[Term]
id: PRO:000002346
name: rho GTPase-activating protein 10 isoform 2
def: "A rho GTPase-activating protein 10 that is a translation product of a mature transcript of the ARHGAP10 gene. Represented by the sequence UniProtKB:Q6Y5D8-2." [PRO:JAN]
comment: Category=sequence.
synonym: " PS-GAP-b" EXACT []
is_a: PRO:000002211 ! rho GTPase-activating protein 10

[Term]
id: PRO:000002347
name: rho GTPase-activating protein 10 isoform 3
def: "A rho GTPase-activating protein 10 that is a translation product of a mature transcript of the ARHGAP10 gene. Represented by the sequence UniProtKB:Q6Y5D8-3." [PRO:JAN]
comment: Category=sequence.
synonym: " PS-GAP-c" EXACT []
is_a: PRO:000002211 ! rho GTPase-activating protein 10

[Term]
id: PRO:000002348
name: rho GTPase-activating protein 10 isoform 4
def: "A rho GTPase-activating protein 10 that is a translation product of a mature transcript of the ARHGAP10 gene. Represented by the sequence UniProtKB:Q6Y5D8-4." [PRO:JAN]
comment: Category=sequence.
synonym: "PS-GAP-s" EXACT []
synonym: "PSGAP-s" EXACT []
is_a: PRO:000002211 ! rho GTPase-activating protein 10

[Term]
id: PRO:000002349
name: serine/threonine-protein kinase 24
def: "A serine/threonine-protein kinase 24, that is a translation product of the STK24 gene." [PRO:WCB]
comment: Category=gene.
synonym: "Mammalian STE20-like protein kinase 3" EXACT []
synonym: "MST-3" EXACT []
synonym: "MST3, STK3" RELATED []
synonym: "Serine/threonine-protein kinase 24" EXACT []
synonym: "STE20-like kinase MST3" EXACT []
synonym: "STK24" RELATED []
synonym: "Stk24" RELATED []
xref: PIRSF:PIRSF500761
is_a: PRO:000002212 ! serine/threonine-protein kinase, MST4-like

[Term]
id: PRO:000002350
name: serine/threonine-protein kinase 25
def: "A serine/threonine-protein kinase 25 type, that is a translation product of the STK25 gene." [PRO:WCB]
comment: Category=gene.
synonym: "SOK-1" EXACT []
synonym: "SOK1" RELATED []
synonym: "Ste20-like kinase" EXACT []
synonym: "Ste20/oxidant stress response kinase 1" EXACT []
synonym: "Sterile 20/oxidant stress-response kinase 1" EXACT []
synonym: "STK25" RELATED []
synonym: "YSK1" RELATED []
xref: PIRSF:PIRSF500760
is_a: PRO:000002212 ! serine/threonine-protein kinase, MST4-like

[Term]
id: PRO:000002351
name: serine/threonine-protein kinase MST4
def: "A serine/threonine-protein kinase MST4 type, that is a translation product of the MST4 gene." [PRO:WCB]
comment: Category=gene.\nProtein is present in human but not found in HGNC.
synonym: "Mammalian STE20-like protein kinase 4" EXACT []
synonym: "MASK" RELATED []
synonym: "MST-4" EXACT []
synonym: "Mst3 and SOK1-related kinase" EXACT []
synonym: "Mst4" RELATED []
synonym: "MST4" RELATED []
synonym: "Serine/threonine-protein kinase MASK" EXACT []
synonym: "Serine/threonine-protein kinase MST4" EXACT []
synonym: "STE20-like kinase MST4" EXACT []
xref: PIRSF:PIRSF500759
is_a: PRO:000002212 ! serine/threonine-protein kinase, MST4-like

[Term]
id: PRO:000002352
name: tumor necrosis factor ligand superfamily member 11 isoform 1 cleaved form
def: "A tumor necrosis factor ligand superfamily member 11 isoform 1 That has been processed by proteolytic cleavage." [PRO:JAN]
comment: Category=modification.
intersection_of: PRO:000002217 ! tumor necrosis factor ligand superfamily member 11 isoform 1
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000002353
name: tumor necrosis factor ligand superfamily member 14 isoform 1
def: "A tumor necrosis factor ligand superfamily member 14 that is a translation product of a mature transcript of the TNFSF14 gene. Represented by the sequence UniProtKB:O43557-1." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000002222 ! tumor necrosis factor ligand superfamily member 14

[Term]
id: PRO:000002354
name: tumor necrosis factor ligand superfamily member 14 isoform 2
def: "A tumor necrosis factor ligand superfamily member 14 that is a translation product of a mature transcript of the TNFSF14 gene. Represented by the sequence UniProtKB:O43557-2." [PRO:JAN]
comment: Category=sequence.
synonym: " LIGHT delta-TM" EXACT []
is_a: PRO:000002222 ! tumor necrosis factor ligand superfamily member 14

[Term]
id: PRO:000002355
name: tumor necrosis factor ligand superfamily member 15 isoform 1
def: "A tumor necrosis factor ligand superfamily member 15 that is a translation product of a mature transcript of the Tnfsf15 gene. Represented by the mouse sequence UniProtKB:Q5UBV8-1." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000002223 ! tumor necrosis factor ligand superfamily member 15

[Term]
id: PRO:000002356
name: tumor necrosis factor ligand superfamily member 15 isoform 2
def: "A tumor necrosis factor ligand superfamily member 15 that is a translation product of a mature transcript of the TNFSF15 gene. Represented by the human sequence UniProtKB:O95150-2." [PRO:JAN]
comment: Category=sequence.
synonym: "VEGI-192" EXACT []
is_a: PRO:000002223 ! tumor necrosis factor ligand superfamily member 15

[Term]
id: PRO:000002357
name: tumor necrosis factor ligand superfamily member 15 isoform 3
def: "A tumor necrosis factor ligand superfamily member 15 that is a translation product of a mature transcript of the TNFSF15 gene. Represented by the human sequence UniProtKB:O95150-3." [PRO:JAN]
comment: Category=sequence.
synonym: "VEGI-174" EXACT []
is_a: PRO:000002223 ! tumor necrosis factor ligand superfamily member 15

[Term]
id: PRO:000002358
name: tumor necrosis factor receptor superfamily member 6 isoform 1
def: "A tumor necrosis factor receptor superfamily member 6 that is a translation product of a mature transcript of the FAS gene. Represented by the sequence UniProtKB:P25445-1." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000001962 ! tumor necrosis factor receptor superfamily member 6

[Term]
id: PRO:000002359
name: tumor necrosis factor receptor superfamily member 6 isoform 2
def: "A tumor necrosis factor receptor superfamily member 6 precursor that is a translation product of a mature transcript of the FAS gene. Represented by the sequence UniProtKB:P25445-2." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000001962 ! tumor necrosis factor receptor superfamily member 6

[Term]
id: PRO:000002360
name: tumor necrosis factor receptor superfamily member 6 isoform 3
def: "A tumor necrosis factor receptor superfamily member 6 precursor that is a translation product of a mature transcript of the FAS gene. Represented by the sequence UniProtKB:P25445-3." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000001962 ! tumor necrosis factor receptor superfamily member 6

[Term]
id: PRO:000002361
name: tumor necrosis factor receptor superfamily member 6 isoform 4
def: "A tumor necrosis factor receptor superfamily member 6 precursor that is a translation product of a mature transcript of the FAS gene. Represented by the sequence UniProtKB:P25445-4." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000001962 ! tumor necrosis factor receptor superfamily member 6

[Term]
id: PRO:000002362
name: tumor necrosis factor receptor superfamily member 6 isoform 5
def: "A tumor necrosis factor receptor superfamily member 6 precursor that is a translation product of a mature transcript of the FAS gene. Represented by the sequence UniProtKB:P25445-5." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000001962 ! tumor necrosis factor receptor superfamily member 6

[Term]
id: PRO:000002363
name: tumor necrosis factor receptor superfamily member 6 isoform 6
def: "A tumor necrosis factor receptor superfamily member 6 precursor that is a translation product of a mature transcript of the FAS gene. Represented by the sequence UniProtKB:P25445-6." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000001962 ! tumor necrosis factor receptor superfamily member 6

[Term]
id: PRO:000002364
name: tumor necrosis factor receptor superfamily member 6 isoform 7
def: "A tumor necrosis factor receptor superfamily member 6 precursor that is a translation product of a mature transcript of the FAS gene. Represented by the sequence UniProtKB:P25446-7." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000001962 ! tumor necrosis factor receptor superfamily member 6

[Term]
id: PRO:000002365
name: tumor necrosis factor receptor type 1-associated DEATH domain protein isoform 1
def: "A tumor necrosis factor receptor type 1-associated DEATH domain protein that is a translation product of a mature transcript of the TRADD gene. Represented by the sequence UniProtKB:Q15628-1." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000002233 ! tumor necrosis factor receptor type 1-associated DEATH domain protein

[Term]
id: PRO:000002366
name: tyrosine-protein kinase Tec isoform 1
def: "A tyrosine-protein kinase Tec that is a translation product of a mature transcript of the TEC gene. Represented by the sequence UniProtKB:P24604-1. Tec is a cytoplasmic protein tyrosine kinase that participates in the signalling pathways of a broad range of cytokines." [PMID:10343129, PRO:JAN]
comment: Category=sequence.
synonym: "TecIV" EXACT []
is_a: PRO:000002240 ! tyrosine-protein kinase Tec

[Term]
id: PRO:000002367
name: tyrosine-protein kinase Tec isoform 2
def: "A tyrosine-protein kinase Tec that is a translation product of a mature transcript of the TEC gene. Represented by the sequence UniProtKB:P24604-2." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000002240 ! tyrosine-protein kinase Tec

[Term]
id: PRO:000002368
name: tyrosine-protein kinase Tec isoform 3
def: "A tyrosine-protein kinase Tec that is a translation product of a mature transcript of the TEC gene. Represented by the sequence UniProtKB:P24604-3." [PRO:JAN]
comment: Category=sequence.
synonym: "TecIIb" EXACT []
is_a: PRO:000002240 ! tyrosine-protein kinase Tec

[Term]
id: PRO:000002369
name: tyrosine-protein kinase Tec isoform 4
def: "A tyrosine-protein kinase Tec that is a translation product of a mature transcript of the TEC gene. Represented by the sequence UniProtKB:P24604-4." [PRO:JAN]
comment: Category=sequence.
synonym: "TecIIa" EXACT []
is_a: PRO:000002240 ! tyrosine-protein kinase Tec

[Term]
id: PRO:000002370
name: tyrosine-protein kinase Tec isoform 5
def: "A tyrosine-protein kinase Tec that is a translation product of a mature transcript of the TEC gene. Represented by the sequence UniProtKB:P24604-5." [PRO:JAN]
comment: Category=sequence.
synonym: "TecIII" EXACT []
is_a: PRO:000002240 ! tyrosine-protein kinase Tec

[Term]
id: PRO:000002371
name: tyrosine-protein kinase Tec isoform 6
def: "A tyrosine-protein kinase Tec that is a translation product of a mature transcript of the TEC gene. Represented by the sequence UniProtKB:P24604-6." [PRO:JAN]
comment: Category=sequence.
synonym: " TecI" EXACT []
is_a: PRO:000002240 ! tyrosine-protein kinase Tec

[Term]
id: PRO:000002372
name: BH3-interacting domain death agonist isoform 1 cleaved form
def: "A BH3-interacting domain death agonist isoform 1 that has been processed by proteolytic cleavage." [PRO:JAN]
comment: Category=modification.
intersection_of: PRO:000002258 ! BH3-interacting domain death agonist isoform 1
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000002373
name: TNF receptor-associated factor 1 isoform 1
def: "A TNF receptor-associated factor 1 that is a translation product of a matured transcript of TRAF1 gene. Represented by the sequence UniProtKB:Q13077-1." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000002287 ! TNF receptor-associated factor 1

[Term]
id: PRO:000002374
name: TNF receptor-associated factor 2 isoform 1
def: "A TNF receptor-associated factor 2 that is a translation product of a mature transcript of the TRAF2 gene. Represented by the sequence UniProtKB:Q12933-1." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000002288 ! TNF receptor-associated factor 2

[Term]
id: PRO:000002375
name: TNF receptor-associated factor 2 isoform 2
def: "A TNF receptor-associated factor 2 that is a translation product of a mature transcript of the TRAF2 gene. Represented by the sequence UniProtKB:P39429-2." [PRO:JAN]
comment: Category=sequence.
synonym: "TRAF2A" EXACT []
is_a: PRO:000002288 ! TNF receptor-associated factor 2

[Term]
id: PRO:000002376
name: TNF receptor-associated factor 2 isoform 3
def: "A TNF receptor-associated factor 2 that is a translation product of a mature transcript of the TRAF2 gene. Represented by the sequence UniProtKB:Q12933-2." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000002288 ! TNF receptor-associated factor 2

[Term]
id: PRO:000002377
name: TNF receptor-associated factor 3 isoform 1
def: "A TNF receptor-associated factor 3 that is a translation product of a matured transcript of the TRAF3 gene. Represented by the sequence UniProtKB:Q13114-1." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000002289 ! TNF receptor-associated factor 3

[Term]
id: PRO:000002378
name: TNF receptor-associated factor 4 isoform 1
def: "A TNF receptor-associated factor 4 that is a translation product of a matured transcript of the TRAF4 gene. Represented by the sequence UniProtKB:Q9BUZ4-1." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000002290 ! TNF receptor-associated factor 4

[Term]
id: PRO:000002379
name: TNF receptor-associated factor 4 isoform 2
def: "A TNF receptor-associated factor 4 that is a translation product of a matured transcript of the TRAF4 gene. Represented by the sequence UniProtKB:Q9BUZ4-2." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000002290 ! TNF receptor-associated factor 4

[Term]
id: PRO:000002380
name: TNF receptor-associated factor 5 isoform 1
def: "A TNF receptor-associated factor 5 that is a translation product of a matured transcript of the TRAF5 gene. Represented by the sequence UniProtKB:O00463-1." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000002291 ! TNF receptor-associated factor 5

[Term]
id: PRO:000002381
name: TNF receptor-associated factor 6 isoform 1
def: "A TNF receptor-associated factor 6 that is a translation product of a matured transcript of the TRAF6 gene. Represented by the sequence UniProtKB:Q9Y4K3-1." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000002292 ! TNF receptor-associated factor 6

[Term]
id: PRO:000002382
name: TNF receptor-associated factor 6 isoform 2
def: "A TNF receptor-associated factor 6 that is a translation product of a matured transcript of the TRAF6 gene. Represented by the sequence UniProtKB:P70196-2." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000002292 ! TNF receptor-associated factor 6

[Term]
id: PRO:000002383
name: apoptosis regulator Bcl-2 isoform 1
def: "An apoptosis regulator Bcl-2 that is a translation product of a mature transcript of the BCL2 gene. Represented by the sequence UniProtKB:P10417-1." [PMID:2834197, PMID:2875799, PRO:JAN]
comment: Category=sequence.
synonym: "Bcl2 isoform alpha" EXACT []
is_a: PRO:000002307 ! apoptosis regulator Bcl-2

[Term]
id: PRO:000002384
name: apoptosis regulator Bcl-2 isoform 2
def: "An apoptosis regulator Bcl-2 that is a translation product of a mature transcript of the BCL2 gene. It lacks the predicted C-terminal transmembrane domain as compared to isoform 1. Represented by the sequence UniProtKB:P10415-2." [PMID:3523487, PRO:JAN, PRO:SY]
comment: Category=sequence.
synonym: "isoform Beta" EXACT []
is_a: PRO:000002307 ! apoptosis regulator Bcl-2

[Term]
id: PRO:000002385
name: Bcl-2-like protein 1 isoform 1
def: "A Bcl-2-like protein 1 that is a translation product of a mature transcript of the BCL2L1 gene. Represented by the sequence UniProtKB:Q64373-1." [PRO:JAN]
comment: Category=sequence.
synonym: "apoptosis regulator Bcl-X isoform 1" RELATED []
synonym: "Isoform Bcl-X(L)" EXACT []
is_a: PRO:000002308 ! Bcl-2-like protein 1

[Term]
id: PRO:000002386
name: Bcl-2-like protein 1 isoform 2
def: "A Bcl-2-like protein 1 that is a translation product of a mature transcript of the BCL2L1 gene. Represented by the sequence UniProtKB:Q64373-2." [PRO:JAN]
comment: Category=sequence.
synonym: " isoform Bcl-X(S)" EXACT []
synonym: "apoptosis regulator Bcl-X isoform 2" EXACT []
is_a: PRO:000002308 ! Bcl-2-like protein 1

[Term]
id: PRO:000002387
name: Bcl-2-like protein 1 isoform 3
def: "An Bcl-2-like protein 1 that is a translation product of a mature transcript of the BCL2L1 gene. Represented by the sequence UniProtKB:Q07817-3." [PRO:JAN]
comment: Category=sequence.
synonym: "apoptosis regulator Bcl-X isoform 3" EXACT []
synonym: "isoform Bcl-X(beta)" EXACT []
is_a: PRO:000002308 ! Bcl-2-like protein 1

[Term]
id: PRO:000002388
name: Bcl-2-like protein 1 isoform 4
def: "A Bcl-2-like protein 1 that is a translation product of a mature transcript of the BCL2L1 gene. Represented by the sequence UniProtKB:Q64373-3." [PRO:JAN]
comment: Category=sequence.
synonym: "apoptosis regulator Bcl-X isoform 4" EXACT []
synonym: "isoform Bcl-X(beta)" EXACT []
is_a: PRO:000002308 ! Bcl-2-like protein 1

[Term]
id: PRO:000002389
name: Bcl-2-like protein 1 isoform 5
def: "A Bcl-2-like protein 1 that is a translation product of a mature transcript of the BCL2L1 gene. Represented by the sequence UniProtKB:Q64373-4." [PRO:JAN]
comment: Category=sequence.
synonym: "apoptosis regulator Bcl-X isoform 5" EXACT []
synonym: "isoform Bcl-X(delta-TM)" EXACT []
is_a: PRO:000002308 ! Bcl-2-like protein 1

[Term]
id: PRO:000002390
name: caspase-1 isoform 1
def: "A caspase-1 that is a translation product of a matured transcript of the CASP1 gene. Represented by the sequence UniProtKB:P29466-1." [PRO:JAN]
comment: Category=sequence.
synonym: "Isoform Alpha" EXACT []
is_a: PRO:000002309 ! caspase-1

[Term]
id: PRO:000002391
name: caspase-1 isoform 2
def: "A caspase-1 that is a translation product of a matured transcript of the CASP1 gene. Represented by the sequence UniProtKB:P29466-2." [PMID:15489334, PRO:JAN]
comment: Category=sequence.
synonym: "Isoform Beta" EXACT []
is_a: PRO:000002309 ! caspase-1

[Term]
id: PRO:000002392
name: caspase-1 isoform 3
def: "A caspase-1 that is a translation product of a matured transcript of the CASP1 gene. Represented by the sequence UniProtKB:P29466-3." [PMID:15489334, PRO:JAN]
comment: Category=sequence.
synonym: "Isoform Gamma" EXACT []
is_a: PRO:000002309 ! caspase-1

[Term]
id: PRO:000002393
name: caspase-1 isoform 4
def: "A caspase-1 that is a translation product of a matured transcript of the CASP1 gene. Represented by the sequence UniProtKB:P29466-4." [PRO:JAN]
comment: Category=sequence.
synonym: "Isoform Delta" EXACT []
is_a: PRO:000002309 ! caspase-1

[Term]
id: PRO:000002394
name: caspase-1 isoform 5
def: "A caspase-1 that is a translation product of a matured transcript of the CASP1 gene. Represented by the sequence UniProtKB:P29466-5." [PRO:JAN]
comment: Category=sequence.
synonym: "Isoform Epsilon" EXACT []
is_a: PRO:000002309 ! caspase-1

[Term]
id: PRO:000002395
name: caspase-1 isoform 6
def: "A caspase-1 that is a translation product of a matured transcript of the CASP1 gene. Represented by the sequence UniProtKB:P29466-6." [PMID:15498465, PRO:JAN]
comment: Category=sequence.
synonym: "Isoform Zeta " EXACT []
is_a: PRO:000002309 ! caspase-1

[Term]
id: PRO:000002396
name: caspase-10 isoform 1
def: "A caspase-10 that is a translation product of a mature transcript of the CASP10 gene. Represented by the sequence UniProtKB:Q92851-1." [PRO:JAN]
comment: Category=sequence.
synonym: "10-A" EXACT []
synonym: "Caspase-10 isoform A" EXACT []
is_a: PRO:000002310 ! caspase-10

[Term]
id: PRO:000002397
name: caspase-10 isoform 2
def: "A caspase-10 that is a translation product of a mature transcript of the CASP10 gene. Represented by the sequence UniProtKB:Q92851-2." [PRO:JAN]
comment: Category=sequence.
synonym: "10-B" EXACT []
synonym: "10-S" EXACT []
synonym: "Caspase-10 isoform B" EXACT []
is_a: PRO:000002310 ! caspase-10

[Term]
id: PRO:000002398
name: caspase-10 isoform 3
def: "A caspase-10 that is a translation product of a mature transcript of the CASP10 gene. Represented by the sequence UniProtKB:Q92851-3." [PRO:JAN]
comment: Category=sequence.
synonym: "10-C" EXACT []
synonym: "Caspase-10 precursor isoform C" EXACT []
is_a: PRO:000002310 ! caspase-10

[Term]
id: PRO:000002399
name: caspase-10 isoform 4
def: "A caspase-10 that is a translation product of a mature transcript of the CASP10 gene. Represented by the sequence UniProtKB:Q92851-4." [PRO:JAN]
comment: Category=sequence.
synonym: "10-D" EXACT []
synonym: "10-L" EXACT []
synonym: "Caspase-10 precursor isoform D" EXACT []
is_a: PRO:000002310 ! caspase-10

[Term]
id: PRO:000002400
name: caspase-2 isoform 1
def: "A caspase-2 protein that is a translation product of a matured transcript of the CASP2 gene. Represented by the sequence UniProtKB:P42575-1. This isoform acts as a positive regulator of apoptosis." [PRO:JAN]
comment: Category=sequence.
synonym: "Isoform ICH-1L" EXACT []
is_a: PRO:000002311 ! caspase-2

[Term]
id: PRO:000002401
name: caspase-2 isoform 2
def: "A caspase-2 that is a translation product of a matured transcript of the CASP2 gene. Represented by the sequence UniProtKB:P42575-2. This isoform acts as a negative regulator of apoptosis." [PRO:JAN]
comment: Category=sequence.
synonym: "Isoform ICH-1S" EXACT []
is_a: PRO:000002311 ! caspase-2

[Term]
id: PRO:000002402
name: caspase-3 isoform 1
def: "A caspase-3 that is a translation product of a mature transcript of the CASP3 gene. Represented by the sequence UniProtKB:P70677-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000002312 ! caspase-3

[Term]
id: PRO:000002403
name: caspase-4 isoform 1
def: "A caspase-4 that is a translation product of a mature transcript of the CASP4 gene. Represented by the sequence UniProtKB:P49662-1." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000002313 ! caspase-4

[Term]
id: PRO:000002404
name: caspase-4 isoform 2
def: "A caspase-4 that is a translation product of a mature transcript of the CASP4 gene. Represented by the mouse sequence UniProtKB:P70343-1." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000002313 ! caspase-4

[Term]
id: PRO:000002405
name: caspase-5 isoform 1
def: "A caspase-5 that is a translation product of a mature transcript of the CASP5 gene. Represented by the human sequence UniProtKB:P51878-1." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000002314 ! caspase-5

[Term]
id: PRO:000002406
name: caspase-6 isoform 1
def: "A caspase-6 that is a translation product of a mature transcript of the CASP6 gene. Represented by the human sequence UniProtKB:P55212-1." [PMID:7796396]
comment: Category=sequence.
synonym: "Isoform Alpha" EXACT []
is_a: PRO:000002315 ! caspase-6

[Term]
id: PRO:000002407
name: caspase-6 isoform 2
def: "A caspase-6 that is a translation product of a mature transcript of the CASP6 gene. This form is missing the first 19 residues in comparison to isoform 1. Represented by the mouse sequence UniProtKB:O08738-1." [PRO:JAN]
comment: Category=sequence.
synonym: "Isoform alpha" EXACT []
is_a: PRO:000002315 ! caspase-6

[Term]
id: PRO:000002408
name: caspase-6 isoform 3
def: "A caspase-6 that is a translation product of a mature transcript of the CASP6 gene. Represented by the sequence UniProtKB:P55212-2." [PRO:CNA]
comment: Category=sequence.
synonym: "Isoform Beta" EXACT []
is_a: PRO:000002315 ! caspase-6

[Term]
id: PRO:000002409
name: caspase-7 isoform 1
def: "A caspase-7 that is a translation product of a mature transcript of the CASP7 gene. Represented by the sequence UniProtKB:P55210-1." [PRO:JAN]
comment: Category=sequence.
synonym: "Caspase-7 isoform Alpha " EXACT []
is_a: PRO:000002316 ! caspase-7

[Term]
id: PRO:000002410
name: caspase-7 isoform 2
def: "A caspase-7 that is a translation product of a mature transcript of the CASP7 gene. Represented by the sequence UniProtKB:P55210-2." [PRO:JAN]
comment: Category=sequence.
synonym: "Beta" EXACT []
synonym: "Caspase-7 isoform Beta" EXACT []
is_a: PRO:000002316 ! caspase-7

[Term]
id: PRO:000002411
name: caspase-7 isoform 3
def: "A caspase-7 that is a translation product of a mature transcript of the CASP7 gene. Represented by the sequence UniProtKB:P55210-3." [PRO:JAN]
comment: Category=sequence.
synonym: "Caspase-7 isoform Alpha'" EXACT []
is_a: PRO:000002316 ! caspase-7

[Term]
id: PRO:000002412
name: caspase-8 isoform 1
def: "A caspase-8 that is a translation product of a mature transcript of the CASP8 gene. Represented by the sequence UniProtKB:Q14790-1." [PRO:JAN]
comment: Category=sequence.
synonym: "Alpha-1" EXACT []
is_a: PRO:000002317 ! caspase-8

[Term]
id: PRO:000002413
name: caspase-8 isoform 2
def: "A caspase-8 that is a translation product of a mature transcript of the CASP8 gene. Represented by the sequence UniProtKB:Q14790-2." [PRO:JAN]
comment: Category=sequence.
synonym: "Alpha-2" EXACT []
synonym: "MCH5-beta" EXACT []
is_a: PRO:000002317 ! caspase-8

[Term]
id: PRO:000002414
name: caspase-8 isoform 3
def: "A caspase-8 that is a translation product of a mature transcript of the CASP8 gene. Represented by the sequence UniProtKB:Q14790-3." [PRO:JAN]
comment: Category=sequence.
synonym: " Alpha-3" EXACT []
is_a: PRO:000002317 ! caspase-8

[Term]
id: PRO:000002415
name: caspase-8 isoform 4
def: "A caspase-8 that is a translation product of a mature transcript of the CASP8 gene. Represented by the sequence UniProtKB:Q14790-4." [PRO:JAN]
comment: Category=sequence.
synonym: "Alpha-4" EXACT []
is_a: PRO:000002317 ! caspase-8

[Term]
id: PRO:000002416
name: caspase-8 isoform 5
def: "A caspase-8 that is a translation product of a mature transcript of the CASP8 gene. Represented by the sequence UniProtKB:Q14790-5." [PRO:JAN]
comment: Category=sequence.
synonym: "Beta-1" EXACT []
is_a: PRO:000002317 ! caspase-8

[Term]
id: PRO:000002417
name: caspase-8 isoform 6
def: "A caspase-8 that is a translation product of a mature transcript of the CASP8 gene. Represented by the sequence UniProtKB:Q14790-6." [PRO:JAN]
comment: Category=sequence.
synonym: "Beta-2" EXACT []
is_a: PRO:000002317 ! caspase-8

[Term]
id: PRO:000002418
name: caspase-8 isoform 7
def: "A caspase-8 that is a translation product of a mature transcript of the CASP8 gene. Represented by the sequence UniProtKB:Q14790-7." [PRO:JAN]
comment: Category=sequence.
synonym: "8L" EXACT []
synonym: "Beta-3" EXACT []
is_a: PRO:000002317 ! caspase-8

[Term]
id: PRO:000002419
name: caspase-8 isoform 8
def: "A caspase-8 that is a translation product of a mature transcript of the CASP8 gene. Represented by the sequence UniProtKB:Q14790-8." [PRO:JAN]
comment: Category=sequence.
synonym: "Beta-4" EXACT []
is_a: PRO:000002317 ! caspase-8

[Term]
id: PRO:000002420
name: caspase-8 isoform 9
def: "A caspase-8 that is a translation product of a mature transcript of the CASP8 gene. Represented by the sequence UniProtKB:Q14790-9." [PRO:JAN]
comment: Category=sequence.
synonym: "8L" EXACT []
is_a: PRO:000002317 ! caspase-8

[Term]
id: PRO:000002421
name: caspase-9 isoform 1
def: "A caspase-9 that is a translation product of a mature transcript of the CASP9 gene. Represented by the sequence UniProtKB:P55211-1." [PRO:JAN]
comment: Category=sequence.
synonym: "9L" EXACT []
synonym: "Alpha" EXACT []
is_a: PRO:000002318 ! caspase-9

[Term]
id: PRO:000002422
name: caspase-9 isoform 2
def: "A caspase-9 that is a translation product of a mature transcript of the CASP9 gene. This form is missing most of the large subunit of caspase-9, including the catalytic site, but has the intact small subunit. Represented by the sequence UniProtKB:P55211-2." [PMID:9890966, PRO:JAN]
comment: Category=sequence.
synonym: "Beta" EXACT []
synonym: "caspase-9S" EXACT []
is_a: PRO:000002318 ! caspase-9

[Term]
id: PRO:000002423
name: cytochrome c, somatic isoform 1
def: "A cytochrome c, somatic protein that is a translation product of a matured transcript of the CYCS gene. Represented by the sequence UniProtKB:P99999-1." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000002321 ! cytochrome c, somatic

[Term]
id: PRO:000002424
name: cytochrome c, testis-specific isoform 1
def: "A cytochrome c, testis-specific that is a translation product of a mature transcript of the CYCS gene. Represented by the sequence UniProtKB:P00015-1." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000002322 ! cytochrome c, testis-specific

[Term]
id: PRO:000002425
name: dynein light chain 1, cytoplasmic isoform 1
def: "A dynein light chain 1, cytoplasmic that is a translation product of a mature transcript of the DYNLL1 gene. Represented by the sequence UniProtKB:P63168-1." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000002325 ! dynein light chain 1, cytoplasmic

[Term]
id: PRO:000002426
name: dynein light chain 2, cytoplasmic isoform 1
def: "A dynein light chain 2, cytoplasmic that is a translation product of a mature transcript of the DYNLL2 gene. Represented by the sequence UniProtKB:Q96FJ2-1." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000002326 ! dynein light chain 2, cytoplasmic

[Term]
id: PRO:000002427
name: protein kinase C delta type isoform 1
def: "A protein kinase C delta type that is a translation product of a mature transcript of the PRKCD gene. Represented by the sequence UniProtKB:Q05655-1." [PRO:JAN]
comment: Category=sequence.
synonym: " PKC-delta-I" EXACT []
is_a: PRO:000002341 ! protein kinase C delta type

[Term]
id: PRO:000002428
name: protein kinase C delta type isoform 2
def: "A Protein kinase C delta type that is a translation product of a mature transcript of the PRKCD gene. Represented by the mouse sequence UniProtKB:P28867-2." [PRO:JAN]
comment: Category=sequence.
synonym: " PKC-delta-II" EXACT []
is_a: PRO:000002341 ! protein kinase C delta type

[Term]
id: PRO:000002429
name: protein kinase C epsilon isoform 1
def: "A protein kinase C epsilon that is a translation product of a matured transcript of the PKCE gene. Represented by the sequence UniProtKB:Q02156-1." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000002342 ! protein kinase C epsilon

[Term]
id: PRO:000002430
name: protein kinase C eta type isoform 1
def: "A protein kinase C eta type that is a translation product of a matured transcript of the PRKCH gene. Represented by the sequence UniProtKB:P24723-1." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000002343 ! protein kinase C eta type

[Term]
id: PRO:000002431
name: protein kinase C theta type isoform 1
def: "A protein kinase C theta type that is a translation product of a mature transcript of the PRKCQ gene. Represented by the sequence UniProtKB:Q04759-1." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000002344 ! protein kinase C theta type

[Term]
id: PRO:000002432
name: protein kinase C theta type isoform 2
def: "A protein kinase C theta type that is a translation product of a mature transcript of the PRKCQ gene. Represented by the sequence UniProtKB:Q04759-2." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000002344 ! protein kinase C theta type

[Term]
id: PRO:000002433
name: serine/threonine-protein kinase 24 isoform 1
def: "A serine/threonine-protein kinase 24 that is a translation product of a mature transcript of the STK24 gene. Represented by the sequence UniProtKB:Q9Y6E0-1." [PRO:JAN]
comment: Category=sequence.
synonym: "Isoform B" EXACT []
is_a: PRO:000002349 ! serine/threonine-protein kinase 24

[Term]
id: PRO:000002434
name: serine/threonine-protein kinase 24 isoform 2
def: "A serine/threonine-protein kinase 24 that is a translation product of a mature transcript of the STK24 gene. Represented by the sequence UniProtKB:Q9Y6E0-2." [PRO:JAN]
comment: Category=sequence.
synonym: "Isoform A" EXACT []
is_a: PRO:000002349 ! serine/threonine-protein kinase 24

[Term]
id: PRO:000002435
name: serine/threonine-protein kinase 25 isoform 1
def: "A serine/threonine-protein kinase 25 type that is a translation product of a matured transcript of the STK25 gene. Represented by the sequence UniProtKB:O00506-1." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000002350 ! serine/threonine-protein kinase 25

[Term]
id: PRO:000002436
name: serine/threonine-protein kinase MST4 isoform 1
def: "A serine/threonine-protein kinase MST4 type that is a translation product of a mature transcript of the MST4 gene. Represented by the sequence UniProtKB:Q9P289-1." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000002351 ! serine/threonine-protein kinase MST4

[Term]
id: PRO:000002437
name: tumor necrosis factor ligand superfamily member 11 isoform 1 cleaved 1
def: "A tumor necrosis factor ligand superfamily member 11 isoform 1 cleaved form that has been processed by a metalloprotease-disintegrin TNF-alpha convertase (TACE) to yield the tumor necrosis factor ligand superfamily member 11, soluble form." [PMID:10196481]
comment: Category=modification.
synonym: "soluble form" EXACT []
is_a: PRO:000002352 ! tumor necrosis factor ligand superfamily member 11 isoform 1 cleaved form

[Term]
id: PRO:000002438
name: tumor necrosis factor ligand superfamily member 11 isoform 1 cleaved 2
def: "A tumor necrosis factor ligand superfamily member 11 isoform 1 cleaved form that has been processed by a metalloprotease-disintegrin TNF-alpha convertase (TACE) to yield the tumor necrosis factor ligand superfamily member 11, membrane form." [PMID:10196481]
comment: Category=modification.
synonym: "membrane form" EXACT []
is_a: PRO:000002352 ! tumor necrosis factor ligand superfamily member 11 isoform 1 cleaved form

[Term]
id: PRO:000002439
name: BH3-interacting domain death agonist isoform 1 cleaved 1
def: "A BH3-interacting domain death agonist isoform 1 cleaved form that has been processed by proteolytic cleavage mediated by a caspase to yield the matured peptide BH3-interacting domain death agonist p15." [PMID:9873064, RECTOME:REACT_3925.1]
comment: Category=modification.
synonym: " BH3-interacting domain death agonist p15" EXACT []
synonym: "p15 BID" EXACT []
is_a: PRO:000002372 ! BH3-interacting domain death agonist isoform 1 cleaved form

[Term]
id: PRO:000002440
name: BH3-interacting domain death agonist isoform 1 cleaved 2
def: "A BH3-interacting domain death agonist that has been processed by proteolytic cleavage mediated by a caspase to yield the matured peptide BH3-interacting domain death agonist p13." [PMID:9873064]
comment: Category=modification.
synonym: "BH3-interacting domain death agonist p13" EXACT []
synonym: "p13 BID" EXACT []
is_a: PRO:000002372 ! BH3-interacting domain death agonist isoform 1 cleaved form

[Term]
id: PRO:000002441
name: BH3-interacting domain death agonist isoform 1 cleaved 3
def: "A BH3-interacting domain death agonist that has been processed by proteolytic cleavage mediated by a caspase to yield the matured peptide BH3-interacting domain death agonist p11." [PMID:9873064]
comment: Category=modification.
synonym: " BH3-interacting domain death agonist p11" EXACT []
synonym: "p11 BID" EXACT []
is_a: PRO:000002372 ! BH3-interacting domain death agonist isoform 1 cleaved form

[Term]
id: PRO:000002442
name: caspase-1 isoform 1 cleaved form
def: "A caspase-1 isoform 1 that has been processed by proteolytic cleavage." [PRO:JAN]
comment: Category=modification.
intersection_of: PRO:000002390 ! caspase-1 isoform 1
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000002443
name: caspase-2 isoform 1 cleaved form
def: "A caspase-2 isoform 1 protein that has been processed by proteolytic cleavage." [PRO:JAN]
comment: Category=modification.
intersection_of: PRO:000002400 ! caspase-2 isoform 1
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000002444
name: caspase-3 isoform 1 cleaved form
def: "A caspase-3 isoform 1 cleaved form that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000002402 ! caspase-3 isoform 1
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000002445
name: caspase-6 isoform 1 cleaved form
def: "A caspase-6 isoform 1 that has been processed by proteolytic cleavage." [PRO:JAN]
comment: Category=modification.
intersection_of: PRO:000002406 ! caspase-6 isoform 1
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000002446
name: caspase-7 isoform 1 cleaved form
def: "A caspase-7 isoform 1 that has been processed by proteolytic cleavage." [PRO:JAN]
comment: Category=modification.
intersection_of: PRO:000002409 ! caspase-7 isoform 1
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000002447
name: caspase-9 isoform 1 cleaved form
def: "A caspase-9 isoform 1 that has been processed by proteolytic cleavage." [PRO:JAN]
comment: Category=modification.
intersection_of: PRO:000002421 ! caspase-9 isoform 1
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000002448
name: serine/threonine-protein kinase 24 isoform 2 phosphorylated form
comment: Category=modification.
intersection_of: PRO:000002434 ! serine/threonine-protein kinase 24 isoform 2
intersection_of: has_modification MOD:00696 ! phosphorylated residue

[Term]
id: PRO:000002449
name: caspase-1 isoform 1 cleaved 1
def: "A caspase-1 isoform 1 cleaved form that has been processed by proteolytic cleavage to yield the mature caspase-1 subunit p20 subunit." [PMID:8044845, PRO:JAN]
comment: Category=modification.
synonym: "caspase-1 subunit p20" EXACT []
is_a: PRO:000002442 ! caspase-1 isoform 1 cleaved form

[Term]
id: PRO:000002450
name: caspase-1 isoform 1 cleaved 2
def: "A caspase-1 isoform 1 cleaved form that has been processed by proteolytic cleavage to yield the mature caspase-1 subunit p10 subunit." [PMID:8044845, PRO:JAN]
comment: Category=modification.
synonym: "caspase-1 subunit p10" EXACT []
is_a: PRO:000002442 ! caspase-1 isoform 1 cleaved form

[Term]
id: PRO:000002451
name: caspase-2 isoform 1 cleaved 1
def: "A caspase-2 isoform 1 cleaved form that has been processed by proteolytic cleavage to yield the mature caspase-2 subunit p18 protein." [PMID:8654923, PRO:JAN]
comment: Category=modification.
synonym: "caspase-2 subunit p18" EXACT []
is_a: PRO:000002443 ! caspase-2 isoform 1 cleaved form

[Term]
id: PRO:000002452
name: caspase-2 isoform 1 cleaved 2
def: "A caspase-2 isoform 1 cleaved form that has been processed by proteolytic cleavage to yield the mature caspase-2 subunit p13 protein." [PMID:8654923, PRO:JAN]
comment: Category=modification.
synonym: "caspase-2 subunit p13" EXACT []
is_a: PRO:000002443 ! caspase-2 isoform 1 cleaved form

[Term]
id: PRO:000002453
name: caspase-2 isoform 1 cleaved 3
def: "A caspase-2 isoform 1 cleaved form that has been processed by proteolytic cleavage to yield the mature caspase-2 subunit p12 protein." [PMID:8654923, PRO:JAN]
comment: Category=modification.
synonym: "caspase-2 subunit p12" EXACT []
is_a: PRO:000002443 ! caspase-2 isoform 1 cleaved form

[Term]
id: PRO:000002454
name: caspase-3 cleaved 1
def: "A caspase-3 isoform 1 cleaved form that has been processed by proteolytic cleavage to yield the mature caspase-3 subunit p12 protein." [PRO:CNA]
comment: Category=modification.
synonym: "caspase-3 subunit p12" EXACT []
is_a: PRO:000002444 ! caspase-3 isoform 1 cleaved form

[Term]
id: PRO:000002455
name: caspase-3 cleaved 2
def: "A caspase-3 isoform 1 cleaved form that has been processed by proteolytic cleavage to yield the mature caspase-3 subunit p17 protein." [PRO:CNA]
comment: Category=modification.
synonym: "caspase-3 subunit p17" EXACT []
is_a: PRO:000002444 ! caspase-3 isoform 1 cleaved form

[Term]
id: PRO:000002456
name: caspase-6 isoform cleaved 1
def: "A caspase-6 isoform 1 cleaved form that has been processed by proteolytic cleavage to yield the mature caspase-6 subunit p11." [PMID:8900201, PRO:CNA]
comment: Category=modification.
synonym: "caspase-6 small subunit" EXACT []
synonym: "caspase-6 subunit p11" EXACT []
synonym: "Mch2alpha p11" EXACT []
is_a: PRO:000002445 ! caspase-6 isoform 1 cleaved form

[Term]
id: PRO:000002457
name: caspase-6 isoform cleaved 2
def: "A caspase-6 isoform 1 cleaved form that has been processed by proteolytic cleavage to yield the mature caspase-6 subunit p18." [PMID:8900201, PRO:CNA]
comment: Category=modification.
synonym: "caspase-6 large subunit" EXACT []
synonym: "caspase-6 subunit p18" EXACT []
synonym: "Mch2alpha p18" EXACT []
is_a: PRO:000002445 ! caspase-6 isoform 1 cleaved form

[Term]
id: PRO:000002458
name: caspase-7 isoform 1 cleaved 1
def: "A caspase-7 isoform 1 cleaved form that has been processed by proteolytic cleavage to yield the mature caspase-7 subunit p11." [PMID:8755496, PRO:CNA]
comment: Category=modification.
synonym: "caspase-7 subunit p11" EXACT []
synonym: "Mch3 small subunit" EXACT []
is_a: PRO:000002446 ! caspase-7 isoform 1 cleaved form

[Term]
id: PRO:000002459
name: caspase-7 isoform 2 cleaved 2
def: "A caspase-7 isoform 1 cleaved form that has been processed by proteolytic cleavage to yield the mature caspase-7 subunit p20." [PMID:8755496, PRO:CNA]
comment: Category=modification.
synonym: "caspase-7 subunit p20" EXACT []
synonym: "Mch3 large subunit" EXACT []
is_a: PRO:000002446 ! caspase-7 isoform 1 cleaved form

[Term]
id: PRO:000002460
name: caspase-9 isoform 1 cleaved 1
def: "A caspase-9 isoform 1 cleaved form that has been processed by proteolytic cleavage to yield the mature caspase-9 subunit p35." [PMID:8900201]
comment: Category=modification.
synonym: "caspase-9 subunit p35" EXACT []
is_a: PRO:000002447 ! caspase-9 isoform 1 cleaved form

[Term]
id: PRO:000002461
name: caspase-9 isoform 1 cleaved 2
def: "A caspase-9 precursor that has been processed by proteolytic cleavage to yield the mature caspase-9 subunit p10." [PMID:8900201]
comment: Category=modification.
synonym: "caspase-9 subunit p10" EXACT []
is_a: PRO:000002447 ! caspase-9 isoform 1 cleaved form

[Term]
id: PRO:000002462
name: serine/threonine-protein kinase 24 isoform 2 phosphorylated 1
def: "A serine/threonine-protein kinase 24 isoform 2 phosphorylated form that has been phosphorylated at the most N-terminal Ser residue." [PMID:17242355, PMID:18691976]
comment: Category=modification.
is_a: PRO:000002448 ! serine/threonine-protein kinase 24 isoform 2 phosphorylated form

[Term]
id: PRO:000002463
name: TGF-beta receptor type-2 isoform 1 unmodified form
def: "A TGF-beta receptor type-2 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000048 ! TGF-beta receptor type-2 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002464
name: TGF-beta receptor type-2 isoform 2 unmodified form
def: "A TGF-beta receptor type-2 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000049 ! TGF-beta receptor type-2 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002465
name: anti-Muellerian hormone type-2 receptor isoform 1 unmodified form
def: "An anti-Muellerian hormone type-2 receptor isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000074 ! anti-Muellerian hormone type-2 receptor isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002466
name: chordin isoform 1 unmodified form
def: "A chordin isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000086 ! chordin isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002467
name: chordin isoform 2 unmodified form
def: "A chordin isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000087 ! chordin isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002468
name: chordin isoform 3 unmodified form
def: "A chordin isoform 3 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000088 ! chordin isoform 3
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002469
name: chordin isoform 4 unmodified form
def: "A chordin isoform 4 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000089 ! chordin isoform 4
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002470
name: follistatin isoform 1 unmodified form
def: "A follistatin isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000096 ! follistatin isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002471
name: follistatin isoform 2 unmodified form
def: "A follistatin isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000097 ! follistatin isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002472
name: interferon gamma isoform 1 unmodified form
def: "An interferon gamma isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000100 ! interferon gamma isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002473
name: noggin isoform 1 unmodified form
def: "A noggin isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000106 ! noggin isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002474
name: BMP receptor type-1A isoform 1 unmodified form
def: "A BMP receptor type-1A isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000136 ! BMP receptor type-1A isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002475
name: BMP receptor type-1B isoform 1 unmodified form
def: "A BMP receptor type-1B isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000145 ! BMP receptor type-1B isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002476
name: BMP receptor type-2 isoform 1 unmodified form
def: "A BMP receptor type-2 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000148 ! BMP receptor type-2 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002477
name: DNA-binding protein inhibitor ID-1 isoform 1 unmodified form
def: "A DNA-binding protein inhibitor ID-1 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000171 ! DNA-binding protein inhibitor ID-1 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002478
name: DNA-binding protein inhibitor ID-1 isoform 2 unmodified form
def: "A DNA-binding protein inhibitor ID-1 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000172 ! DNA-binding protein inhibitor ID-1 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002479
name: DNA-binding protein inhibitor ID-2 isoform 1 unmodified form
def: "A DNA-binding protein inhibitor ID-2 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000173 ! DNA-binding protein inhibitor ID-2 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002480
name: DNA-binding protein inhibitor ID-3 isoform 1 unmodified form
def: "A DNA-binding protein inhibitor ID-3 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000174 ! DNA-binding protein inhibitor ID-3 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002481
name: DNA-binding protein inhibitor ID-4 isoform 1 unmodified form
def: "A DNA-binding protein inhibitor ID-4 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000175 ! DNA-binding protein inhibitor ID-4 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002482
name: RING-box protein 1 isoform 1 unmodified form
def: "A RING-box protein 1 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000177 ! RING-box protein 1 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002483
name: RING-box protein 2 isoform 1 unmodified form
def: "A RING-box protein 2 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000178 ! RING-box protein 2 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002484
name: RING-box protein 2 isoform 2 unmodified form
def: "A RING-box protein 2 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000179 ! RING-box protein 2 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002485
name: S-phase kinase-associated protein 1A isoform 1 unmodified form
def: "A S-phase kinase-associated protein 1A isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000180 ! S-phase kinase-associated protein 1A isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002486
name: S-phase kinase-associated protein 1A isoform 2 unmodified form
def: "A S-phase kinase-associated protein 1A isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000181 ! S-phase kinase-associated protein 1A isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002487
name: TGF-beta receptor type-1 isoform 1 unmodified form
def: "A TGF-beta receptor type-1 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000185 ! TGF-beta receptor type-1 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002488
name: activin receptor type-1 isoform 1 unmodified form
def: "An activin receptor type-1 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000199 ! activin receptor type-1 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002489
name: activin receptor type-1B isoform 1 unmodified form
def: "An activin receptor type-1B isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000201 ! activin receptor type-1B isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002490
name: activin receptor type-1B isoform 2 unmodified form
def: "An activin receptor type-1B isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000202 ! activin receptor type-1B isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002491
name: activin receptor type-1B isoform 3 unmodified form
def: "An activin receptor type-1B isoform 3 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000203 ! activin receptor type-1B isoform 3
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002492
name: activin receptor type-1C isoform 1 unmodified form
def: "An activin receptor type-1C isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000204 ! activin receptor type-1C isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002493
name: activin receptor type-1C isoform 2 unmodified form
def: "An activin receptor type-1C isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000205 ! activin receptor type-1C isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002494
name: activin receptor type-1C isoform 3 unmodified form
def: "An activin receptor type-1C isoform 3 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000206 ! activin receptor type-1C isoform 3
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002495
name: activin receptor type-1C isoform 4 unmodified form
def: "An activin receptor type-1C isoform 4 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000207 ! activin receptor type-1C isoform 4
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002496
name: activin receptor type-2A isoform 1 unmodified form
def: "An activin receptor type-2A isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000208 ! activin receptor type-2A isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002497
name: activin receptor type-2B isoform 1 unmodified form
def: "An activin receptor type-2B isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000209 ! activin receptor type-2B isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002498
name: activin receptor type-2B isoform 2 unmodified form
def: "An activin receptor type-2B isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000210 ! activin receptor type-2B isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002499
name: activin receptor type-2B isoform 3 unmodified form
def: "An activin receptor type-2B isoform 3 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000211 ! activin receptor type-2B isoform 3
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002500
name: activin receptor type-2B isoform 4 unmodified form
def: "An activin receptor type-2B isoform 4 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000212 ! activin receptor type-2B isoform 4
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002501
name: activin receptor type-2B isoform 5 unmodified form
def: "An activin receptor type-2B isoform 5 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000213 ! activin receptor type-2B isoform 5
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002502
name: anti-Muellerian hormone isoform 1 unmodified form
def: "An anti-Muellerian hormone isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000220 ! anti-Muellerian hormone isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002503
name: c-myc protein isoform 1 unmodified form
def: "A c-myc protein isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000228 ! c-myc protein isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002504
name: c-myc protein isoform 2 unmodified form
def: "A c-myc protein isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000229 ! c-myc protein isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002505
name: cartilage oligomeric matrix protein isoform 1 unmodified form
def: "A cartilage oligomeric matrix protein isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000230 ! cartilage oligomeric matrix protein isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002506
name: creb-binding protein isoform 1 unmodified form
def: "A creb-binding protein isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000265 ! creb-binding protein isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002507
name: cullin 1 isoform 1 unmodified form
def: "A cullin 1 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000267 ! cullin 1 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002508
name: cyclin-dependent kinase 4 inhibitor B isoform 1 unmodified form
def: "A cyclin-dependent kinase 4 inhibitor B isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000268 ! cyclin-dependent kinase 4 inhibitor B isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002509
name: decorin isoform 1 unmodified form
def: "A decorin isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000271 ! decorin isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002510
name: decorin isoform 2 unmodified form
def: "A decorin isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000272 ! decorin isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002511
name: decorin isoform 3 unmodified form
def: "A decorin isoform 3 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000273 ! decorin isoform 3
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002512
name: decorin isoform 4 unmodified form
def: "A decorin isoform 4 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000274 ! decorin isoform 4
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002513
name: decorin isoform 5 unmodified form
def: "A decorin isoform 5 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000275 ! decorin isoform 5
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002514
name: fas ligand isoform 1 unmodified form
def: "A fas ligand isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000276 ! fas ligand isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002515
name: fas ligand isoform 2 unmodified form
def: "A fas ligand isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000277 ! fas ligand isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002516
name: latent-TGF-beta-binding protein 1 isoform 1 unmodified form
def: "A latent-TGF-beta-binding protein 1 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000285 ! latent-TGF-beta-binding protein 1 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002517
name: latent-TGF-beta-binding protein 1 isoform 2 unmodified form
def: "A latent-TGF-beta-binding protein 1 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000286 ! latent-TGF-beta-binding protein 1 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002518
name: mitogen-activated protein kinase 1 isoform 1 unmodified form
def: "A mitogen-activated protein kinase 1 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000289 ! mitogen-activated protein kinase 1 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002519
name: mitogen-activated protein kinase 3 isoform 1 unmodified form
def: "A mitogen-activated protein kinase 3 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000290 ! mitogen-activated protein kinase 3 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002520
name: nodal isoform 1 unmodified form
def: "A nodal isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000291 ! nodal isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002521
name: pituitary homeobox protein 2 isoform 1 unmodified form
def: "A pituitary homeobox protein 2 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000294 ! pituitary homeobox protein 2 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002522
name: pituitary homeobox protein 2 isoform 2 unmodified form
def: "A pituitary homeobox protein 2 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000295 ! pituitary homeobox protein 2 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002523
name: pituitary homeobox protein 2 isoform 3 unmodified form
def: "A pituitary homeobox protein 2 isoform 3 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000296 ! pituitary homeobox protein 2 isoform 3
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002524
name: pituitary homeobox protein 2 isoform 4 unmodified form
def: "A pituitary homeobox protein 2 isoform 4 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000297 ! pituitary homeobox protein 2 isoform 4
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002525
name: retinoblastoma-like protein 1 isoform 1 unmodified form
def: "A retinoblastoma-like protein 1 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000303 ! retinoblastoma-like protein 1 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002526
name: retinoblastoma-like protein 1 isoform 2 unmodified form
def: "A retinoblastoma-like protein 1 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000304 ! retinoblastoma-like protein 1 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002527
name: retinoblastoma-like protein 1 isoform 3 unmodified form
def: "A retinoblastoma-like protein 1 isoform 3 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000305 ! retinoblastoma-like protein 1 isoform 3
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002528
name: retinoblastoma-like protein 2 isoform 1 unmodified form
def: "A retinoblastoma-like protein 2 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000306 ! retinoblastoma-like protein 2 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002529
name: rho-associated protein kinase 1 isoform 1 unmodified form
def: "A rho-associated protein kinase 1 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000307 ! rho-associated protein kinase 1 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002530
name: rho-associated protein kinase 2 isoform 1 unmodified form
def: "A rho-associated protein kinase 2 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000308 ! rho-associated protein kinase 2 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002531
name: rho-associated protein kinase 2 isoform 2 unmodified form
def: "A rho-associated protein kinase 2 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000309 ! rho-associated protein kinase 2 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002532
name: ribosomal protein S6 kinase beta 1 isoform 1 unmodified form
def: "A ribosomal protein S6 kinase beta 1 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000310 ! ribosomal protein S6 kinase beta 1 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002533
name: ribosomal protein S6 kinase beta 1 isoform 2 unmodified form
def: "A ribosomal protein S6 kinase beta 1 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000311 ! ribosomal protein S6 kinase beta 1 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002534
name: ribosomal protein S6 kinase beta 2 isoform 1 unmodified form
def: "A ribosomal protein S6 kinase beta 2 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000312 ! ribosomal protein S6 kinase beta 2 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002535
name: sara isoform 1 unmodified form
def: "A sara isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000313 ! sara isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002536
name: sara isoform 2 unmodified form
def: "A sara isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000314 ! sara isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002537
name: sara isoform 3 unmodified form
def: "A sara isoform 3 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000315 ! sara isoform 3
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002538
name: serine/threonine-protein kinase receptor R3 isoform 1 unmodified form
def: "A serine/threonine-protein kinase receptor R3 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000316 ! serine/threonine-protein kinase receptor R3 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002539
name: smad4 isoform 1 unmodified form
def: "A smad4 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000366 ! smad4 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002540
name: thrombospondin 1 isoform 1 unmodified form
def: "A thrombospondin 1 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000376 ! thrombospondin 1 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002541
name: thrombospondin 2 isoform 1 unmodified form
def: "A thrombospondin 2 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000377 ! thrombospondin 2 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002542
name: thrombospondin 3 isoform 1 unmodified form
def: "A thrombospondin 3 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000378 ! thrombospondin 3 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002543
name: thrombospondin 4 isoform 1 unmodified form
def: "A thrombospondin 4 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000379 ! thrombospondin 4 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002544
name: transcription factor Sp1 isoform 1 unmodified form
def: "A transcription factor Sp1 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000380 ! transcription factor Sp1 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002545
name: tumor necrosis factor alpha isoform 1 unmodified form
def: "A tumor necrosis factor alpha isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000381 ! tumor necrosis factor alpha isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002546
name: BMP10 isoform 1 unmodified form
def: "A BMP10 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000384 ! BMP10 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002547
name: BMP2 isoform 1 unmodified form
def: "A BMP2 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000385 ! BMP2 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002548
name: BMP4 isoform 1 unmodified form
def: "A BMP4 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000386 ! BMP4 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002549
name: BMP5 isoform 1 unmodified form
def: "A BMP5 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000387 ! BMP5 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002550
name: BMP6 isoform 1 unmodified form
def: "A BMP6 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000388 ! BMP6 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002551
name: BMP7 isoform 1 unmodified form
def: "A BMP7 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000389 ! BMP7 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002552
name: BMP8A isoform 1 unmodified form
def: "A BMP8A isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000390 ! BMP8A isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002553
name: BMP8B isoform 1 unmodified form
def: "A BMP8B isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000391 ! BMP8B isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002554
name: GTP-binding protein RhoA isoform 1 unmodified form
def: "A GTP-binding protein RhoA isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000395 ! GTP-binding protein RhoA isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002555
name: TGF-beta 1 isoform 1 unmodified form
def: "A TGF-beta 1 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000397 ! TGF-beta 1 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002556
name: TGF-beta 2 isoform 1 unmodified form
def: "A TGF-beta 2 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000404 ! TGF-beta 2 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002557
name: TGF-beta 2 isoform 2 unmodified form
def: "A TGF-beta 2 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000405 ! TGF-beta 2 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002558
name: TGF-beta 3 isoform 1 unmodified form
def: "A TGF-beta 3 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000406 ! TGF-beta 3 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002559
name: activin/inhibin beta A chain isoform 1 unmodified form
def: "An activin/inhibin beta A chain isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000416 ! activin/inhibin beta A chain isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002560
name: activin/inhibin beta B chain isoform 1 unmodified form
def: "An activin/inhibin beta B chain isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000417 ! activin/inhibin beta B chain isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002561
name: activin/inhibin beta E chain isoform 1 unmodified form
def: "An activin/inhibin beta E chain isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000418 ! activin/inhibin beta E chain isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002562
name: growth/differentiation factor 5 isoform 1 unmodified form
def: "A growth/differentiation factor 5 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000436 ! growth/differentiation factor 5 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002563
name: growth/differentiation factor 7 isoform 1 unmodified form
def: "A growth/differentiation factor 7 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000442 ! growth/differentiation factor 7 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002564
name: growth/differentiation factor 7 isoform 2 unmodified form
def: "A growth/differentiation factor 7 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000443 ! growth/differentiation factor 7 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002565
name: inhibin beta C chain isoform 1 unmodified form
def: "An inhibin beta C chain isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000444 ! inhibin beta C chain isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002566
name: lefty 1 isoform 1 unmodified form
def: "A lefty 1 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000450 ! lefty 1 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002567
name: lefty 2 isoform 1 unmodified form
def: "A lefty 2 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000451 ! lefty 2 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002568
name: smad ubiquitination regulatory factor 1 isoform 1 unmodified form
def: "A smad ubiquitination regulatory factor 1 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000466 ! smad ubiquitination regulatory factor 1 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002569
name: smad1 isoform 1 unmodified form
def: "A smad1 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000467 ! smad1 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002570
name: smad2 isoform 1 unmodified form
def: "A smad2 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000468 ! smad2 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002571
name: smad2 isoform 2 unmodified form
def: "A smad2 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000469 ! smad2 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002572
name: smad3 isoform 1 unmodified form
def: "A smad3 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000475 ! smad3 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002573
name: smad5 isoform 1 unmodified form
def: "A smad5 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000477 ! smad5 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002574
name: smad5 isoform 2 unmodified form
def: "A smad5 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000478 ! smad5 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002575
name: smad6 isoform 1 unmodified form
def: "A smad6 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000479 ! smad6 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002576
name: smad6 isoform 2 unmodified form
def: "A smad6 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000480 ! smad6 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002577
name: smad7 isoform 1 unmodified form
def: "A smad7 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000481 ! smad7 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002578
name: smad9 isoform 1 unmodified form
def: "A smad9 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000482 ! smad9 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002579
name: smad9 isoform 2 unmodified form
def: "A smad9 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000483 ! smad9 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002580
name: smad9 isoform 3 unmodified form
def: "A smad9 isoform 3 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000484 ! smad9 isoform 3
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002581
name: cation channel sperm-associated protein 1 isoform 1 unmodified form
def: "A cation channel sperm-associated protein 1 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000688 ! cation channel sperm-associated protein 1 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002582
name: cation channel sperm-associated protein 2 isoform 1 unmodified form
def: "A cation channel sperm-associated protein 2 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000689 ! cation channel sperm-associated protein 2 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002583
name: cation channel sperm-associated protein 2 isoform 2 unmodified form
def: "A cation channel sperm-associated protein 2 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000690 ! cation channel sperm-associated protein 2 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002584
name: cation channel sperm-associated protein 2 isoform 3 unmodified form
def: "A cation channel sperm-associated protein 2 isoform 3 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000691 ! cation channel sperm-associated protein 2 isoform 3
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002585
name: cation channel sperm-associated protein 2 isoform 4 unmodified form
def: "A cation channel sperm-associated protein 2 isoform 4 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000692 ! cation channel sperm-associated protein 2 isoform 4
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002586
name: cation channel sperm-associated protein 3 isoform 1 unmodified form
def: "A cation channel sperm-associated protein 3 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000693 ! cation channel sperm-associated protein 3 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002587
name: cation channel sperm-associated protein 3 isoform 2 unmodified form
def: "A cation channel sperm-associated protein 3 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000694 ! cation channel sperm-associated protein 3 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002588
name: cation channel sperm-associated protein subunit beta isoform 1 unmodified form
def: "A cation channel sperm-associated protein subunit beta isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000695 ! cation channel sperm-associated protein subunit beta isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002589
name: sodium leak channel non-selective protein isoform 1 unmodified form
def: "A sodium leak channel non-selective protein isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000715 ! sodium leak channel non-selective protein isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002590
name: sodium leak channel non-selective protein isoform 2 unmodified form
def: "A sodium leak channel non-selective protein isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000716 ! sodium leak channel non-selective protein isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002591
name: sodium leak channel non-selective protein isoform 3 unmodified form
def: "A sodium leak channel non-selective protein isoform 3 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000717 ! sodium leak channel non-selective protein isoform 3
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002592
name: voltage-gated potassium channel alpha subunit KCNA4 isoform 1 unmodified form
def: "A voltage-gated potassium channel alpha subunit KCNA4 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000727 ! voltage-gated potassium channel alpha subunit KCNA4 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002593
name: cGMP-gated cation channel alpha-1 isoform 1 unmodified form
def: "A cGMP-gated cation channel alpha-1 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000737 ! cGMP-gated cation channel alpha-1 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002594
name: cyclic nucleotide-gated cation channel alpha-3 isoform 1 unmodified form
def: "A cyclic nucleotide-gated cation channel alpha-3 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000739 ! cyclic nucleotide-gated cation channel alpha-3 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002595
name: cyclic nucleotide-gated cation channel alpha-3 isoform 2 unmodified form
def: "A cyclic nucleotide-gated cation channel alpha-3 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000740 ! cyclic nucleotide-gated cation channel alpha-3 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002596
name: cyclic nucleotide-gated cation channel beta-3 isoform 1 unmodified form
def: "A cyclic nucleotide-gated cation channel beta-3 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000749 ! cyclic nucleotide-gated cation channel beta-3 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002597
name: cyclic nucleotide-gated cation channel beta-3 isoform 2 unmodified form
def: "A cyclic nucleotide-gated cation channel beta-3 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000750 ! cyclic nucleotide-gated cation channel beta-3 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002598
name: cyclic nucleotide-gated cation channel beta-3 isoform 3 unmodified form
def: "A cyclic nucleotide-gated cation channel beta-3 isoform 3 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000751 ! cyclic nucleotide-gated cation channel beta-3 isoform 3
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002599
name: intermediate conductance calcium-activated potassium channel protein 4 isoform 1 unmodified form
def: "An intermediate conductance calcium-activated potassium channel protein 4 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000753 ! intermediate conductance calcium-activated potassium channel protein 4 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002600
name: platelet-derived growth factor C isoform 1 unmodified form
def: "A platelet-derived growth factor C isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000754 ! platelet-derived growth factor C isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002601
name: potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 isoform 1 unmodified form
def: "A potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000755 ! potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002602
name: potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2 isoform 1 unmodified form
def: "A potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000756 ! potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002603
name: potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 3 isoform 1 unmodified form
def: "A potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 3 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000757 ! potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 3 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002604
name: potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 isoform 1 unmodified form
def: "A potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000758 ! potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002605
name: small conductance calcium-activated potassium channel protein 1 isoform 1 unmodified form
def: "A small conductance calcium-activated potassium channel protein 1 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000761 ! small conductance calcium-activated potassium channel protein 1 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002606
name: small conductance calcium-activated potassium channel protein 1 isoform 2 unmodified form
def: "A small conductance calcium-activated potassium channel protein 1 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000762 ! small conductance calcium-activated potassium channel protein 1 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002607
name: small conductance calcium-activated potassium channel protein 1 isoform I unmodified form
def: "A small conductance calcium-activated potassium channel protein 1 isoform I that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000763 ! small conductance calcium-activated potassium channel protein 1 isoform I
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002608
name: small conductance calcium-activated potassium channel protein 1 isoform II unmodified form
def: "A small conductance calcium-activated potassium channel protein 1 isoform II that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000764 ! small conductance calcium-activated potassium channel protein 1 isoform II
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002609
name: small conductance calcium-activated potassium channel protein 1 isoform III unmodified form
def: "A small conductance calcium-activated potassium channel protein 1 isoform III that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000765 ! small conductance calcium-activated potassium channel protein 1 isoform III
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002610
name: small conductance calcium-activated potassium channel protein 1 isoform IV unmodified form
def: "A small conductance calcium-activated potassium channel protein 1 isoform IV that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000766 ! small conductance calcium-activated potassium channel protein 1 isoform IV
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002611
name: small conductance calcium-activated potassium channel protein 1 isoform V unmodified form
def: "A small conductance calcium-activated potassium channel protein 1 isoform V that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000767 ! small conductance calcium-activated potassium channel protein 1 isoform V
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002612
name: small conductance calcium-activated potassium channel protein 1 isoform VI unmodified form
def: "A small conductance calcium-activated potassium channel protein 1 isoform VI that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000768 ! small conductance calcium-activated potassium channel protein 1 isoform VI
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002613
name: small conductance calcium-activated potassium channel protein 1 isoform VII unmodified form
def: "A small conductance calcium-activated potassium channel protein 1 isoform VII that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000769 ! small conductance calcium-activated potassium channel protein 1 isoform VII
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002614
name: small conductance calcium-activated potassium channel protein 1 isoform VIII unmodified form
def: "A small conductance calcium-activated potassium channel protein 1 isoform VIII that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000770 ! small conductance calcium-activated potassium channel protein 1 isoform VIII
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002615
name: small conductance calcium-activated potassium channel protein 2 isoform 1 unmodified form
def: "A small conductance calcium-activated potassium channel protein 2 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000771 ! small conductance calcium-activated potassium channel protein 2 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002616
name: small conductance calcium-activated potassium channel protein 2 isoform 2 unmodified form
def: "A small conductance calcium-activated potassium channel protein 2 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000772 ! small conductance calcium-activated potassium channel protein 2 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002617
name: small conductance calcium-activated potassium channel protein 3 isoform 1 unmodified form
def: "A small conductance calcium-activated potassium channel protein 3 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000773 ! small conductance calcium-activated potassium channel protein 3 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002618
name: voltage-gated potassium channel KCNB1 isoform 1 unmodified form
def: "A voltage-gated potassium channel KCNB1 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000779 ! voltage-gated potassium channel KCNB1 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002619
name: voltage-gated potassium channel KCNB2 isoform 1 unmodified form
def: "A voltage-gated potassium channel KCNB2 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000780 ! voltage-gated potassium channel KCNB2 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002620
name: voltage-gated potassium channel KCNV1 isoform 1 unmodified form
def: "A voltage-gated potassium channel KCNV1 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000801 ! voltage-gated potassium channel KCNV1 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002621
name: voltage-gated potassium channel KCNV2 isoform 1 unmodified form
def: "A voltage-gated potassium channel KCNV2 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000802 ! voltage-gated potassium channel KCNV2 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002622
name: voltage-gated potassium channel subunit KCNQ1 isoform 1 unmodified form
def: "A voltage-gated potassium channel subunit KCNQ1 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000815 ! voltage-gated potassium channel subunit KCNQ1 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002623
name: voltage-gated potassium channel subunit KCNQ1 isoform 2 unmodified form
def: "A voltage-gated potassium channel subunit KCNQ1 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000816 ! voltage-gated potassium channel subunit KCNQ1 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002624
name: voltage-gated potassium channel subunit KCNQ2 isoform 1 unmodified form
def: "A voltage-gated potassium channel subunit KCNQ2 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000891 ! voltage-gated potassium channel subunit KCNQ2 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002625
name: voltage-gated potassium channel subunit KCNQ2 isoform 10 unmodified form
def: "A voltage-gated potassium channel subunit KCNQ2 isoform 10 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000892 ! voltage-gated potassium channel subunit KCNQ2 isoform 10
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002626
name: voltage-gated potassium channel subunit KCNQ2 isoform 11 unmodified form
def: "A voltage-gated potassium channel subunit KCNQ2 isoform 11 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000893 ! voltage-gated potassium channel subunit KCNQ2 isoform 11
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002627
name: voltage-gated potassium channel subunit KCNQ2 isoform 12 unmodified form
def: "A voltage-gated potassium channel subunit KCNQ2 isoform 12 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000894 ! voltage-gated potassium channel subunit KCNQ2 isoform 12
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002628
name: voltage-gated potassium channel subunit KCNQ2 isoform 13 unmodified form
def: "A voltage-gated potassium channel subunit KCNQ2 isoform 13 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000895 ! voltage-gated potassium channel subunit KCNQ2 isoform 13
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002629
name: voltage-gated potassium channel subunit KCNQ2 isoform 14 unmodified form
def: "A voltage-gated potassium channel subunit KCNQ2 isoform 14 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000896 ! voltage-gated potassium channel subunit KCNQ2 isoform 14
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002630
name: voltage-gated potassium channel subunit KCNQ2 isoform 15 unmodified form
def: "A voltage-gated potassium channel subunit KCNQ2 isoform 15 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000897 ! voltage-gated potassium channel subunit KCNQ2 isoform 15
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002631
name: voltage-gated potassium channel subunit KCNQ2 isoform 16 unmodified form
def: "A voltage-gated potassium channel subunit KCNQ2 isoform 16 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000898 ! voltage-gated potassium channel subunit KCNQ2 isoform 16
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002632
name: voltage-gated potassium channel subunit KCNQ2 isoform 2 unmodified form
def: "A voltage-gated potassium channel subunit KCNQ2 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000899 ! voltage-gated potassium channel subunit KCNQ2 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002633
name: voltage-gated potassium channel subunit KCNQ2 isoform 3 unmodified form
def: "A voltage-gated potassium channel subunit KCNQ2 isoform 3 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000900 ! voltage-gated potassium channel subunit KCNQ2 isoform 3
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002634
name: voltage-gated potassium channel subunit KCNQ2 isoform 4 unmodified form
def: "A voltage-gated potassium channel subunit KCNQ2 isoform 4 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000901 ! voltage-gated potassium channel subunit KCNQ2 isoform 4
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002635
name: voltage-gated potassium channel subunit KCNQ2 isoform 5 unmodified form
def: "A voltage-gated potassium channel subunit KCNQ2 isoform 5 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000902 ! voltage-gated potassium channel subunit KCNQ2 isoform 5
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002636
name: voltage-gated potassium channel subunit KCNQ2 isoform 6 unmodified form
def: "A voltage-gated potassium channel subunit KCNQ2 isoform 6 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000903 ! voltage-gated potassium channel subunit KCNQ2 isoform 6
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002637
name: voltage-gated potassium channel subunit KCNQ2 isoform 7 unmodified form
def: "A voltage-gated potassium channel subunit KCNQ2 isoform 7 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000904 ! voltage-gated potassium channel subunit KCNQ2 isoform 7
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002638
name: voltage-gated potassium channel subunit KCNQ2 isoform 8 unmodified form
def: "A voltage-gated potassium channel subunit KCNQ2 isoform 8 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000905 ! voltage-gated potassium channel subunit KCNQ2 isoform 8
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002639
name: voltage-gated potassium channel subunit KCNQ2 isoform 9 unmodified form
def: "A voltage-gated potassium channel subunit KCNQ2 isoform 9 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000906 ! voltage-gated potassium channel subunit KCNQ2 isoform 9
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002640
name: voltage-gated potassium channel subunit KCNQ3 isoform 1 unmodified form
def: "A voltage-gated potassium channel subunit KCNQ3 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000917 ! voltage-gated potassium channel subunit KCNQ3 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002641
name: voltage-gated potassium channel subunit KCNQ4 isoform 1 unmodified form
def: "A voltage-gated potassium channel subunit KCNQ4 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000918 ! voltage-gated potassium channel subunit KCNQ4 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002642
name: voltage-gated potassium channel subunit KCNQ4 isoform 2 unmodified form
def: "A voltage-gated potassium channel subunit KCNQ4 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000919 ! voltage-gated potassium channel subunit KCNQ4 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002643
name: voltage-gated potassium channel subunit KCNQ5 isoform 1 unmodified form
def: "A voltage-gated potassium channel subunit KCNQ5 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000926 ! voltage-gated potassium channel subunit KCNQ5 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002644
name: voltage-gated potassium channel subunit KCNQ5 isoform 2 unmodified form
def: "A voltage-gated potassium channel subunit KCNQ5 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000927 ! voltage-gated potassium channel subunit KCNQ5 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002645
name: voltage-gated potassium channel subunit KCNQ5 isoform 3 unmodified form
def: "A voltage-gated potassium channel subunit KCNQ5 isoform 3 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000928 ! voltage-gated potassium channel subunit KCNQ5 isoform 3
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002646
name: voltage-gated potassium channel subunit KCNQ5 isoform 4 unmodified form
def: "A voltage-gated potassium channel subunit KCNQ5 isoform 4 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000929 ! voltage-gated potassium channel subunit KCNQ5 isoform 4
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002647
name: transient receptor potential cation channel TRPC3 isoform 1 unmodified form
def: "A transient receptor potential cation channel TRPC3 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000937 ! transient receptor potential cation channel TRPC3 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002648
name: voltage-gated potassium channel KCNC1 isoform 1 unmodified form
def: "A voltage-gated potassium channel KCNC1 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000939 ! voltage-gated potassium channel KCNC1 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002649
name: voltage-gated potassium channel KCNC1 isoform 2 unmodified form
def: "A voltage-gated potassium channel KCNC1 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000940 ! voltage-gated potassium channel KCNC1 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002650
name: voltage-gated potassium channel KCNC2 isoform 1 unmodified form
def: "A voltage-gated potassium channel KCNC2 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000941 ! voltage-gated potassium channel KCNC2 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002651
name: voltage-gated potassium channel KCNC2 isoform 2 unmodified form
def: "A voltage-gated potassium channel KCNC2 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000942 ! voltage-gated potassium channel KCNC2 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002652
name: voltage-gated potassium channel KCNC2 isoform 3 unmodified form
def: "A voltage-gated potassium channel KCNC2 isoform 3 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000943 ! voltage-gated potassium channel KCNC2 isoform 3
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002653
name: voltage-gated potassium channel KCNC2 isoform 4 unmodified form
def: "A voltage-gated potassium channel KCNC2 isoform 4 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000944 ! voltage-gated potassium channel KCNC2 isoform 4
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002654
name: voltage-gated potassium channel KCNC4 isoform 1 unmodified form
def: "A voltage-gated potassium channel KCNC4 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000945 ! voltage-gated potassium channel KCNC4 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002655
name: voltage-gated potassium channel KCNC4 isoform 2 unmodified form
def: "A voltage-gated potassium channel KCNC4 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000946 ! voltage-gated potassium channel KCNC4 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002656
name: voltage-gated potassium channel KCND2 isoform 1 unmodified form
def: "A voltage-gated potassium channel KCND2 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000947 ! voltage-gated potassium channel KCND2 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002657
name: voltage-gated potassium channel KCND3 isoform 1 unmodified form
def: "A voltage-gated potassium channel KCND3 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000948 ! voltage-gated potassium channel KCND3 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002658
name: voltage-gated potassium channel KCND3 isoform 2 unmodified form
def: "A voltage-gated potassium channel KCND3 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000949 ! voltage-gated potassium channel KCND3 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002659
name: voltage-gated potassium channel KCNG1 isoform 1 unmodified form
def: "A voltage-gated potassium channel KCNG1 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000950 ! voltage-gated potassium channel KCNG1 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002660
name: voltage-gated potassium channel KCNG1 isoform 2 unmodified form
def: "A voltage-gated potassium channel KCNG1 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000951 ! voltage-gated potassium channel KCNG1 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002661
name: voltage-gated potassium channel KCNG3 isoform 1 unmodified form
def: "A voltage-gated potassium channel KCNG3 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000952 ! voltage-gated potassium channel KCNG3 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002662
name: voltage-gated potassium channel KCNG3 isoform 2 unmodified form
def: "A voltage-gated potassium channel KCNG3 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000953 ! voltage-gated potassium channel KCNG3 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002663
name: voltage-gated potassium channel KCNG4 isoform 1 unmodified form
def: "A voltage-gated potassium channel KCNG4 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000954 ! voltage-gated potassium channel KCNG4 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002664
name: voltage-gated potassium channel KCNH1 isoform 1 unmodified form
def: "A voltage-gated potassium channel KCNH1 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000955 ! voltage-gated potassium channel KCNH1 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002665
name: voltage-gated potassium channel KCNH1 isoform 2 unmodified form
def: "A voltage-gated potassium channel KCNH1 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000956 ! voltage-gated potassium channel KCNH1 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002666
name: voltage-gated potassium channel KCNH2 isoform 1 unmodified form
def: "A voltage-gated potassium channel KCNH2 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000957 ! voltage-gated potassium channel KCNH2 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002667
name: voltage-gated potassium channel KCNH2 isoform 2 unmodified form
def: "A voltage-gated potassium channel KCNH2 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000958 ! voltage-gated potassium channel KCNH2 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002668
name: voltage-gated potassium channel KCNH2 isoform 3 unmodified form
def: "A voltage-gated potassium channel KCNH2 isoform 3 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000959 ! voltage-gated potassium channel KCNH2 isoform 3
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002669
name: voltage-gated potassium channel KCNH2 isoform 4 unmodified form
def: "A voltage-gated potassium channel KCNH2 isoform 4 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000960 ! voltage-gated potassium channel KCNH2 isoform 4
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002670
name: voltage-gated potassium channel KCNH3 isoform 1 unmodified form
def: "A voltage-gated potassium channel KCNH3 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000961 ! voltage-gated potassium channel KCNH3 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002671
name: voltage-gated potassium channel KCNH4 isoform 1 unmodified form
def: "A voltage-gated potassium channel KCNH4 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000962 ! voltage-gated potassium channel KCNH4 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002672
name: voltage-gated potassium channel KCNH5 isoform 1 unmodified form
def: "A voltage-gated potassium channel KCNH5 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000963 ! voltage-gated potassium channel KCNH5 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002673
name: voltage-gated potassium channel KCNH5 isoform 2 unmodified form
def: "A voltage-gated potassium channel KCNH5 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000964 ! voltage-gated potassium channel KCNH5 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002674
name: voltage-gated potassium channel KCNH5 isoform 3 unmodified form
def: "A voltage-gated potassium channel KCNH5 isoform 3 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000965 ! voltage-gated potassium channel KCNH5 isoform 3
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002675
name: voltage-gated potassium channel KCNH6 isoform 1 unmodified form
def: "A voltage-gated potassium channel KCNH6 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000966 ! voltage-gated potassium channel KCNH6 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002676
name: voltage-gated potassium channel KCNH6 isoform 2 unmodified form
def: "A voltage-gated potassium channel KCNH6 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000967 ! voltage-gated potassium channel KCNH6 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002677
name: voltage-gated potassium channel KCNH6 isoform 3 unmodified form
def: "A voltage-gated potassium channel KCNH6 isoform 3 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000968 ! voltage-gated potassium channel KCNH6 isoform 3
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002678
name: voltage-gated potassium channel KCNS1 isoform 1 unmodified form
def: "A voltage-gated potassium channel KCNS1 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000969 ! voltage-gated potassium channel KCNS1 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002679
name: voltage-gated potassium channel KCNS2 isoform 1 unmodified form
def: "A voltage-gated potassium channel KCNS2 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000970 ! voltage-gated potassium channel KCNS2 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002680
name: voltage-gated potassium channel subunit KCNA10 isoform 1 unmodified form
def: "A voltage-gated potassium channel subunit KCNA10 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000971 ! voltage-gated potassium channel subunit KCNA10 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002681
name: voltage-gated potassium channel subunit KCNA2 isoform 1 unmodified form
def: "A voltage-gated potassium channel subunit KCNA2 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000972 ! voltage-gated potassium channel subunit KCNA2 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002682
name: voltage-gated potassium channel subunit KCNA3 isoform 1 unmodified form
def: "A voltage-gated potassium channel subunit KCNA3 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000973 ! voltage-gated potassium channel subunit KCNA3 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002683
name: voltage-gated potassium channel subunit KCNA5 isoform 1 unmodified form
def: "A voltage-gated potassium channel subunit KCNA5 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000974 ! voltage-gated potassium channel subunit KCNA5 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002684
name: voltage-gated potassium channel subunit KCNA5 isoform 2 unmodified form
def: "A voltage-gated potassium channel subunit KCNA5 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000975 ! voltage-gated potassium channel subunit KCNA5 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002685
name: voltage-gated potassium channel subunit KCNA5 isoform 3 unmodified form
def: "A voltage-gated potassium channel subunit KCNA5 isoform 3 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000976 ! voltage-gated potassium channel subunit KCNA5 isoform 3
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002686
name: voltage-gated potassium channel subunit KCNA6 isoform 1 unmodified form
def: "A voltage-gated potassium channel subunit KCNA6 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000978 ! voltage-gated potassium channel subunit KCNA6 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002687
name: voltage-gated potassium channel subunit KCNA7 isoform 1 unmodified form
def: "A voltage-gated potassium channel subunit KCNA7 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000979 ! voltage-gated potassium channel subunit KCNA7 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002688
name: voltage-gated potassium channel subunit KCNA7 isoform 2 unmodified form
def: "A voltage-gated potassium channel subunit KCNA7 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000000980 ! voltage-gated potassium channel subunit KCNA7 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002689
name: leukocyte common antigen CD45 isoform CD45R unmodified form
def: "A leukocyte common antigen CD45 isoform CD45R that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001014 ! leukocyte common antigen CD45 isoform CD45R
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002690
name: leukocyte common antigen CD45 isoform CD45RA unmodified form
def: "A leukocyte common antigen CD45 isoform CD45RA that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001015 ! leukocyte common antigen CD45 isoform CD45RA
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002691
name: leukocyte common antigen CD45 isoform CD45RB unmodified form
def: "A leukocyte common antigen CD45 isoform CD45RB that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001016 ! leukocyte common antigen CD45 isoform CD45RB
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002692
name: leukocyte common antigen CD45 isoform CD45RO unmodified form
def: "A leukocyte common antigen CD45 isoform CD45RO that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001017 ! leukocyte common antigen CD45 isoform CD45RO
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002693
name: CD247 isoform CD3 eta unmodified form
def: "A CD247 isoform CD3 eta that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001028 ! CD247 isoform CD3 eta
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002694
name: CD247 isoform CD3 zeta unmodified form
def: "A CD247 isoform CD3 zeta that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001029 ! CD247 isoform CD3 zeta
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002695
name: ezrin isoform 1 unmodified form
def: "An ezrin isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001032 ! ezrin isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002696
name: ww domain-containing oxidoreductase isoform 1 unmodified form
def: "A ww domain-containing oxidoreductase isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001037 ! ww domain-containing oxidoreductase isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002697
name: ezrin-radixin-moesin-binding phosphoprotein 50 isoform 1 unmodified form
def: "An ezrin-radixin-moesin-binding phosphoprotein 50 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001042 ! ezrin-radixin-moesin-binding phosphoprotein 50 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002698
name: cftr isoform 1 unmodified form
def: "A cftr isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001045 ! cftr isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002699
name: cftr isoform 2 unmodified form
def: "A cftr isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001046 ! cftr isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002700
name: cftr isoform 3 unmodified form
def: "A cftr isoform 3 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001047 ! cftr isoform 3
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002701
name: ww domain-containing oxidoreductase isoform 2 unmodified form
def: "A ww domain-containing oxidoreductase isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001053 ! ww domain-containing oxidoreductase isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002702
name: ww domain-containing oxidoreductase isoform 3 unmodified form
def: "A ww domain-containing oxidoreductase isoform 3 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001054 ! ww domain-containing oxidoreductase isoform 3
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002703
name: ww domain-containing oxidoreductase isoform 4 unmodified form
def: "A ww domain-containing oxidoreductase isoform 4 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001055 ! ww domain-containing oxidoreductase isoform 4
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002704
name: ww domain-containing oxidoreductase isoform 5 unmodified form
def: "A ww domain-containing oxidoreductase isoform 5 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001056 ! ww domain-containing oxidoreductase isoform 5
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002705
name: ww domain-containing oxidoreductase isoform 6 unmodified form
def: "A ww domain-containing oxidoreductase isoform 6 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001057 ! ww domain-containing oxidoreductase isoform 6
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002706
name: ezrin-radixin-moesin-binding phosphoprotein 50 isoform 2 unmodified form
def: "An ezrin-radixin-moesin-binding phosphoprotein 50 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001058 ! ezrin-radixin-moesin-binding phosphoprotein 50 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002707
name: transient receptor potential cation channel TRPA1 isoform 1 unmodified form
def: "A transient receptor potential cation channel TRPA1 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001059 ! transient receptor potential cation channel TRPA1 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002708
name: transient receptor potential cation channel TRPV3 isoform 2 unmodified form
def: "A transient receptor potential cation channel TRPV3 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001061 ! transient receptor potential cation channel TRPV3 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002709
name: transient receptor potential cation channel TRPV3 isoform 1 unmodified form
def: "A transient receptor potential cation channel TRPV3 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001062 ! transient receptor potential cation channel TRPV3 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002710
name: transient receptor potential cation channel TRPV3 isoform 3 unmodified form
def: "A transient receptor potential cation channel TRPV3 isoform 3 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001063 ! transient receptor potential cation channel TRPV3 isoform 3
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002711
name: transient receptor potential cation channel TRPV2 isoform 1 unmodified form
def: "A transient receptor potential cation channel TRPV2 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001066 ! transient receptor potential cation channel TRPV2 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002712
name: transient receptor potential cation channel TRPV1 isoform 1 unmodified form
def: "A transient receptor potential cation channel TRPV1 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001067 ! transient receptor potential cation channel TRPV1 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002713
name: transient receptor potential cation channel TRPV4 isoform 1 unmodified form
def: "A transient receptor potential cation channel TRPV4 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001069 ! transient receptor potential cation channel TRPV4 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002714
name: transient receptor potential cation channel TRPV4 isoform 2 unmodified form
def: "A transient receptor potential cation channel TRPV4 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001070 ! transient receptor potential cation channel TRPV4 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002715
name: transient receptor potential cation channel TRPV4 isoform 3 unmodified form
def: "A transient receptor potential cation channel TRPV4 isoform 3 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001071 ! transient receptor potential cation channel TRPV4 isoform 3
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002716
name: transient receptor potential cation channel TRPV4 isoform 4 unmodified form
def: "A transient receptor potential cation channel TRPV4 isoform 4 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001072 ! transient receptor potential cation channel TRPV4 isoform 4
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002717
name: transient receptor potential cation channel TRPV4 isoform 5 unmodified form
def: "A transient receptor potential cation channel TRPV4 isoform 5 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001073 ! transient receptor potential cation channel TRPV4 isoform 5
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002718
name: transient receptor potential cation channel TRPC4 isoform 1 unmodified form
def: "A transient receptor potential cation channel TRPC4 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001076 ! transient receptor potential cation channel TRPC4 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002719
name: transient receptor potential cation channel TRPC4 isoform 2 unmodified form
def: "A transient receptor potential cation channel TRPC4 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001077 ! transient receptor potential cation channel TRPC4 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002720
name: transient receptor potential cation channel TRPC4 isoform 3 unmodified form
def: "A transient receptor potential cation channel TRPC4 isoform 3 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001078 ! transient receptor potential cation channel TRPC4 isoform 3
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002721
name: transient receptor potential cation channel TRPC4 isoform 4 unmodified form
def: "A transient receptor potential cation channel TRPC4 isoform 4 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001079 ! transient receptor potential cation channel TRPC4 isoform 4
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002722
name: transient receptor potential cation channel TRPC7 isoform 1 unmodified form
def: "A transient receptor potential cation channel TRPC7 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001081 ! transient receptor potential cation channel TRPC7 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002723
name: T-cell surface antigen CD2 isoform 1 unmodified form
def: "A T-cell surface antigen CD2 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001114 ! T-cell surface antigen CD2 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002724
name: alpha-latrotoxin isoform 1 unmodified form
def: "An alpha-latrotoxin isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001117 ! alpha-latrotoxin isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002725
name: interleukin-1 alpha isoform 1 unmodified form
def: "An interleukin-1 alpha isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001227 ! interleukin-1 alpha isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002726
name: interleukin-1 receptor antagonist protein isoform 1 unmodified form
def: "An interleukin-1 receptor antagonist protein isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001228 ! interleukin-1 receptor antagonist protein isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002727
name: interleukin-1 receptor antagonist protein isoform 2 unmodified form
def: "An interleukin-1 receptor antagonist protein isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001229 ! interleukin-1 receptor antagonist protein isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002728
name: interleukin-1 receptor antagonist protein isoform 3 unmodified form
def: "An interleukin-1 receptor antagonist protein isoform 3 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001230 ! interleukin-1 receptor antagonist protein isoform 3
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002729
name: interleukin-1 receptor antagonist protein isoform 4 unmodified form
def: "An interleukin-1 receptor antagonist protein isoform 4 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001231 ! interleukin-1 receptor antagonist protein isoform 4
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002730
name: interleukin-17A isoform 1 unmodified form
def: "An interleukin-17A isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001232 ! interleukin-17A isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002731
name: latrophilin-1 isoform 1 unmodified form
def: "A latrophilin-1 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001263 ! latrophilin-1 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002732
name: latrophilin-1 isoform 2 unmodified form
def: "A latrophilin-1 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001264 ! latrophilin-1 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002733
name: latrophilin-1 isoform 3 unmodified form
def: "A latrophilin-1 isoform 3 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001265 ! latrophilin-1 isoform 3
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002734
name: latrophilin-1 isoform 4 unmodified form
def: "A latrophilin-1 isoform 4 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001266 ! latrophilin-1 isoform 4
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002735
name: transient receptor potential cation channel TRPM8 isoform 1 unmodified form
def: "A transient receptor potential cation channel TRPM8 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001720 ! transient receptor potential cation channel TRPM8 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002736
name: transient receptor potential cation channel TRPM8 isoform 2 unmodified form
def: "A transient receptor potential cation channel TRPM8 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001721 ! transient receptor potential cation channel TRPM8 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002737
name: transient receptor potential cation channel TRPM8 isoform 3 unmodified form
def: "A transient receptor potential cation channel TRPM8 isoform 3 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001722 ! transient receptor potential cation channel TRPM8 isoform 3
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002738
name: transient receptor potential cation channel TRPC2 isoform 1 unmodified form
def: "A transient receptor potential cation channel TRPC2 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001726 ! transient receptor potential cation channel TRPC2 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002739
name: transient receptor potential cation channel TRPC2 isoform 2 unmodified form
def: "A transient receptor potential cation channel TRPC2 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001727 ! transient receptor potential cation channel TRPC2 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002740
name: transient receptor potential cation channel TRPC2 isoform 3 unmodified form
def: "A transient receptor potential cation channel TRPC2 isoform 3 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001728 ! transient receptor potential cation channel TRPC2 isoform 3
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002741
name: transient receptor potential cation channel TRPC2 isoform 4 unmodified form
def: "A transient receptor potential cation channel TRPC2 isoform 4 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001729 ! transient receptor potential cation channel TRPC2 isoform 4
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002742
name: inhibin alpha chain isoform 1 unmodified form
def: "An inhibin alpha chain isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001731 ! inhibin alpha chain isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002743
name: myeloid differentiation primary response protein MyD88 isoform 1 unmodified form
def: "A myeloid differentiation primary response protein MyD88 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001741 ! myeloid differentiation primary response protein MyD88 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002744
name: translocation-associated membrane protein 1 isoform 1 unmodified form
def: "A translocation-associated membrane protein 1 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001747 ! translocation-associated membrane protein 1 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002745
name: translocation-associated membrane protein 2 isoform 1 unmodified form
def: "A translocation-associated membrane protein 2 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001748 ! translocation-associated membrane protein 2 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002746
name: nuclear factor NF-kappa-B p105 subunit isoform 1 unmodified form
def: "A nuclear factor NF-kappa-B p105 subunit isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001755 ! nuclear factor NF-kappa-B p105 subunit isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002747
name: nuclear factor NF-kappa-B p105 subunit isoform 2 unmodified form
def: "A nuclear factor NF-kappa-B p105 subunit isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001758 ! nuclear factor NF-kappa-B p105 subunit isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002748
name: nuclear factor NF-kappa-B p105 subunit isoform 3 unmodified form
def: "A nuclear factor NF-kappa-B p105 subunit isoform 3 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001761 ! nuclear factor NF-kappa-B p105 subunit isoform 3
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002749
name: NF-kappa-B essential modulator isoform 1 unmodified form
def: "A NF-kappa-B essential modulator isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001763 ! NF-kappa-B essential modulator isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002750
name: prominin-1 isoform 1 unmodified form
def: "A prominin-1 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001787 ! prominin-1 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002751
name: prominin-1 isoform 3 unmodified form
def: "A prominin-1 isoform 3 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001788 ! prominin-1 isoform 3
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002752
name: prominin-1 isoform 4 unmodified form
def: "A prominin-1 isoform 4 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001789 ! prominin-1 isoform 4
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002753
name: prominin-1 isoform 5 unmodified form
def: "A prominin-1 isoform 5 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001790 ! prominin-1 isoform 5
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002754
name: prominin-1 isoform 6 unmodified form
def: "A prominin-1 isoform 6 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001791 ! prominin-1 isoform 6
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002755
name: interleukin-6 receptor subunit alpha isoform 1 unmodified form
def: "An interleukin-6 receptor subunit alpha isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001794 ! interleukin-6 receptor subunit alpha isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002756
name: interleukin-6 receptor subunit alpha isoform 2 unmodified form
def: "An interleukin-6 receptor subunit alpha isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001795 ! interleukin-6 receptor subunit alpha isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002757
name: interleukin-6 receptor subunit alpha isoform 3 unmodified form
def: "An interleukin-6 receptor subunit alpha isoform 3 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001796 ! interleukin-6 receptor subunit alpha isoform 3
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002758
name: basigin isoform 1 unmodified form
def: "A basigin isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001846 ! basigin isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002759
name: basigin isoform 2 unmodified form
def: "A basigin isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001847 ! basigin isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002760
name: 5'-nucleotidase isoform 1 unmodified form
def: "A 5'-nucleotidase isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000001977 ! 5'-nucleotidase isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002761
name: receptor-type tyrosine-protein phosphatase eta isoform 1 unmodified form
def: "A receptor-type tyrosine-protein phosphatase eta isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002083 ! receptor-type tyrosine-protein phosphatase eta isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002762
name: alpha-type platelet-derived growth factor receptor isoform 1 unmodified form
def: "An alpha-type platelet-derived growth factor receptor isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002127 ! alpha-type platelet-derived growth factor receptor isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002763
name: alpha-type platelet-derived growth factor receptor isoform 2 unmodified form
def: "An alpha-type platelet-derived growth factor receptor isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002128 ! alpha-type platelet-derived growth factor receptor isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002764
name: alpha-type platelet-derived growth factor receptor isoform 3 unmodified form
def: "An alpha-type platelet-derived growth factor receptor isoform 3 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002129 ! alpha-type platelet-derived growth factor receptor isoform 3
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002765
name: angiopoietin-1 receptor isoform 1 unmodified form
def: "An angiopoietin-1 receptor isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002130 ! angiopoietin-1 receptor isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002766
name: band 3 anion transport protein isoform 1 unmodified form
def: "A band 3 anion transport protein isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002133 ! band 3 anion transport protein isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002767
name: band 3 anion transport protein isoform 2 unmodified form
def: "A band 3 anion transport protein isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002134 ! band 3 anion transport protein isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002768
name: band 3 anion transport protein isoform 3 unmodified form
def: "A band 3 anion transport protein isoform 3 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002135 ! band 3 anion transport protein isoform 3
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002769
name: beta-type platelet-derived growth factor receptor isoform 1 unmodified form
def: "A beta-type platelet-derived growth factor receptor isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002136 ! beta-type platelet-derived growth factor receptor isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002770
name: beta-type platelet-derived growth factor receptor isoform 2 unmodified form
def: "A beta-type platelet-derived growth factor receptor isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002137 ! beta-type platelet-derived growth factor receptor isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002771
name: monocyte differentiation antigen CD14 isoform 1 unmodified form
def: "A monocyte differentiation antigen CD14 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002144 ! monocyte differentiation antigen CD14 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002772
name: DNA-binding protein Ikaros isoform 1 unmodified form
def: "A DNA-binding protein Ikaros isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002150 ! DNA-binding protein ikaros isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002773
name: DNA-binding protein Ikaros isoform 2 unmodified form
def: "A DNA-binding protein Ikaros isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002151 ! DNA-binding protein Ikaros isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002774
name: DNA-binding protein Ikaros isoform 3 unmodified form
def: "A DNA-binding protein Ikaros isoform 3 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002152 ! DNA-binding protein Ikaros isoform 3
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002775
name: DNA-binding protein Ikaros isoform 4 unmodified form
def: "A DNA-binding protein Ikaros isoform 4 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002153 ! DNA-binding protein Ikaros isoform 4
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002776
name: DNA-binding protein Ikaros isoform 5 unmodified form
def: "A DNA-binding protein Ikaros isoform 5 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002154 ! DNA-binding protein Ikaros isoform 5
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002777
name: DNA-binding protein Ikaros isoform 6 unmodified form
def: "A DNA-binding protein Ikaros isoform 6 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002155 ! DNA-binding protein Ikaros isoform 6
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002778
name: ecto-ADP-ribosyltransferase 5 isoform 1 unmodified form
def: "An ecto-ADP-ribosyltransferase 5 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002160 ! ecto-ADP-ribosyltransferase 5 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002779
name: ecto-ADP-ribosyltransferase 5 isoform 2 unmodified form
def: "An ecto-ADP-ribosyltransferase 5 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002161 ! ecto-ADP-ribosyltransferase 5 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002780
name: ecto-ADP-ribosyltransferase 5 isoform 3 unmodified form
def: "An ecto-ADP-ribosyltransferase 5 isoform 3 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002162 ! ecto-ADP-ribosyltransferase 5 isoform 3
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002781
name: ecto-ADP-ribosyltransferase 5 isoform 4 unmodified form
def: "An ecto-ADP-ribosyltransferase 5 isoform 4 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002163 ! ecto-ADP-ribosyltransferase 5 isoform 4
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002782
name: ecto-ADP-ribosyltransferase 5 isoform 5 unmodified form
def: "An ecto-ADP-ribosyltransferase 5 isoform 5 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002164 ! ecto-ADP-ribosyltransferase 5 isoform 5
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002783
name: ecto-ADP-ribosyltransferase 5 isoform 6 unmodified form
def: "An ecto-ADP-ribosyltransferase 5 isoform 6 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002165 ! ecto-ADP-ribosyltransferase 5 isoform 6
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002784
name: zinc finger protein aiolos isoform 1 unmodified form
def: "A zinc finger protein aiolos isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002166 ! zinc finger protein aiolos isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002785
name: zinc finger protein aiolos isoform 2 unmodified form
def: "A zinc finger protein aiolos isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002167 ! zinc finger protein aiolos isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002786
name: zinc finger protein aiolos isoform 3 unmodified form
def: "A zinc finger protein aiolos isoform 3 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002168 ! zinc finger protein aiolos isoform 3
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002787
name: zinc finger protein aiolos isoform 4 unmodified form
def: "A zinc finger protein aiolos isoform 4 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002169 ! zinc finger protein aiolos isoform 4
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002788
name: zinc finger protein aiolos isoform 5 unmodified form
def: "A zinc finger protein aiolos isoform 5 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002170 ! zinc finger protein aiolos isoform 5
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002789
name: zinc finger protein aiolos isoform 6 unmodified form
def: "A zinc finger protein aiolos isoform 6 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002171 ! zinc finger protein aiolos isoform 6
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002790
name: zinc finger protein helios isoform 1 unmodified form
def: "A zinc finger protein helios isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002173 ! zinc finger protein helios isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002791
name: zinc finger protein helios isoform 2 unmodified form
def: "A zinc finger protein helios isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002174 ! zinc finger protein helios isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002792
name: tumor necrosis factor ligand superfamily member 10 isoform 1 unmodified form
def: "A tumor necrosis factor ligand superfamily member 10 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002214 ! tumor necrosis factor ligand superfamily member 10 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002793
name: tumor necrosis factor ligand superfamily member 11 isoform 1 unmodified form
def: "A tumor necrosis factor ligand superfamily member 11 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002217 ! tumor necrosis factor ligand superfamily member 11 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002794
name: tumor necrosis factor ligand superfamily member 11 isoform 2 unmodified form
def: "A tumor necrosis factor ligand superfamily member 11 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002218 ! tumor necrosis factor ligand superfamily member 11 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002795
name: tumor necrosis factor ligand superfamily member 11 isoform 3 unmodified form
def: "A tumor necrosis factor ligand superfamily member 11 isoform 3 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002219 ! tumor necrosis factor ligand superfamily member 11 isoform 3
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002796
name: tumor necrosis factor ligand superfamily member 11 isoform 4 unmodified form
def: "A tumor necrosis factor ligand superfamily member 11 isoform 4 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002220 ! tumor necrosis factor ligand superfamily member 11 isoform 4
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002797
name: tumor necrosis factor ligand superfamily member 11 isoform 5 unmodified form
def: "A tumor necrosis factor ligand superfamily member 11 isoform 5 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002221 ! tumor necrosis factor ligand superfamily member 11 isoform 5
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002798
name: tumor necrosis factor receptor superfamily member 10A isoform 1 unmodified form
def: "A tumor necrosis factor receptor superfamily member 10A isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002225 ! tumor necrosis factor receptor superfamily member 10A isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002799
name: tumor necrosis factor receptor superfamily member 10B isoform 1 unmodified form
def: "A tumor necrosis factor receptor superfamily member 10B isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002227 ! tumor necrosis factor receptor superfamily member 10B isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002800
name: tumor necrosis factor receptor superfamily member 10B isoform 2 unmodified form
def: "A tumor necrosis factor receptor superfamily member 10B isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002228 ! tumor necrosis factor receptor superfamily member 10B isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002801
name: tumor necrosis factor receptor superfamily member 10B isoform 3 unmodified form
def: "A tumor necrosis factor receptor superfamily member 10B isoform 3 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002229 ! tumor necrosis factor receptor superfamily member 10B isoform 3
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002802
name: tumor necrosis factor receptor superfamily member 1A isoform 1 unmodified form
def: "A tumor necrosis factor receptor superfamily member 1A isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002231 ! tumor necrosis factor receptor superfamily member 1A isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002803
name: tyrosine-protein kinase BTK isoform 1 unmodified form
def: "A tyrosine-protein kinase BTK isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002236 ! tyrosine-protein kinase BTK isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002804
name: tyrosine-protein kinase ITK/TSK isoform 1 unmodified form
def: "A tyrosine-protein kinase ITK/TSK isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002238 ! tyrosine-protein kinase ITK/TSK isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002805
name: tyrosine-protein kinase ITK/TSK isoform 2 unmodified form
def: "A tyrosine-protein kinase ITK/TSK isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002239 ! tyrosine-protein kinase ITK/TSK isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002806
name: 14-3-3 protein beta/alpha isoform 1 unmodified form
def: "A 14-3-3 protein beta/alpha isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002242 ! 14-3-3 protein beta/alpha isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002807
name: 14-3-3 protein beta/alpha isoform 2 unmodified form
def: "A 14-3-3 protein beta/alpha isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002243 ! 14-3-3 protein beta/alpha isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002808
name: 26S proteasome non-ATPase regulatory subunit 1 isoform 1 unmodified form
def: "A 26S proteasome non-ATPase regulatory subunit 1 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002244 ! 26S proteasome non-ATPase regulatory subunit 1 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002809
name: 26S proteasome non-ATPase regulatory subunit 1 isoform 2 unmodified form
def: "A 26S proteasome non-ATPase regulatory subunit 1 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002245 ! 26S proteasome non-ATPase regulatory subunit 1 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002810
name: 26S proteasome non-ATPase regulatory subunit 11 isoform 1 unmodified form
def: "A 26S proteasome non-ATPase regulatory subunit 11 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002246 ! 26S proteasome non-ATPase regulatory subunit 11 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002811
name: 26S proteasome non-ATPase regulatory subunit 12 isoform 1 unmodified form
def: "A 26S proteasome non-ATPase regulatory subunit 12 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002247 ! 26S proteasome non-ATPase regulatory subunit 12 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002812
name: 26S proteasome non-ATPase regulatory subunit 13 isoform 1 unmodified form
def: "A 26S proteasome non-ATPase regulatory subunit 13 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002248 ! 26S proteasome non-ATPase regulatory subunit 13 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002813
name: 26S proteasome non-ATPase regulatory subunit 13 isoform 2 unmodified form
def: "A 26S proteasome non-ATPase regulatory subunit 13 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002249 ! 26S proteasome non-ATPase regulatory subunit 13 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002814
name: 26S proteasome non-ATPase regulatory subunit 2 isoform 1 unmodified form
def: "A 26S proteasome non-ATPase regulatory subunit 2 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002250 ! 26S proteasome non-ATPase regulatory subunit 2 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002815
name: 26S proteasome non-ATPase regulatory subunit 4 isoform 1 unmodified form
def: "A 26S proteasome non-ATPase regulatory subunit 4 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002251 ! 26S proteasome non-ATPase regulatory subunit 4 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002816
name: 26S proteasome non-ATPase regulatory subunit 4 isoform 2 unmodified form
def: "A 26S proteasome non-ATPase regulatory subunit 4 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002252 ! 26S proteasome non-ATPase regulatory subunit 4 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002817
name: 26S proteasome non-ATPase regulatory subunit 4 isoform 3 unmodified form
def: "A 26S proteasome non-ATPase regulatory subunit 4 isoform 3 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002253 ! 26S proteasome non-ATPase regulatory subunit 4 isoform 3
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002818
name: 26S proteasome non-ATPase regulatory subunit 4 isoform 4 unmodified form
def: "A 26S proteasome non-ATPase regulatory subunit 4 isoform 4 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002254 ! 26S proteasome non-ATPase regulatory subunit 4 isoform 4
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002819
name: 26S proteasome non-ATPase regulatory subunit 4 isoform 5 unmodified form
def: "A 26S proteasome non-ATPase regulatory subunit 4 isoform 5 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002255 ! 26S proteasome non-ATPase regulatory subunit 4 isoform 5
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002820
name: 26S proteasome non-ATPase regulatory subunit 4 isoform 6 unmodified form
def: "A 26S proteasome non-ATPase regulatory subunit 4 isoform 6 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002256 ! 26S proteasome non-ATPase regulatory subunit 4 isoform 6
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002821
name: 26S proteasome non-ATPase regulatory subunit 6 isoform 1 unmodified form
def: "A 26S proteasome non-ATPase regulatory subunit 6 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002257 ! 26S proteasome non-ATPase regulatory subunit 6 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002822
name: BH3-interacting domain death agonist isoform 1 unmodified form
def: "A BH3-interacting domain death agonist isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002258 ! BH3-interacting domain death agonist isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002823
name: BH3-interacting domain death agonist isoform 2 unmodified form
def: "A BH3-interacting domain death agonist isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002259 ! BH3-interacting domain death agonist isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002824
name: BH3-interacting domain death agonist isoform 3 unmodified form
def: "A BH3-interacting domain death agonist isoform 3 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002260 ! BH3-interacting domain death agonist isoform 3
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002825
name: BH3-interacting domain death agonist isoform 4 unmodified form
def: "A BH3-interacting domain death agonist isoform 4 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002261 ! BH3-interacting domain death agonist isoform 4
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002826
name: Bcl-2-like protein 11 isoform 1 unmodified form
def: "A Bcl-2-like protein 11 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002263 ! Bcl-2-like protein 11 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002827
name: Bcl-2-like protein 11 isoform 10 unmodified form
def: "A Bcl-2-like protein 11 isoform 10 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002264 ! Bcl-2-like protein 11 isoform 10
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002828
name: Bcl-2-like protein 11 isoform 11 unmodified form
def: "A Bcl-2-like protein 11 isoform 11 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002265 ! Bcl-2-like protein 11 isoform 11
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002829
name: Bcl-2-like protein 11 isoform 12 unmodified form
def: "A Bcl-2-like protein 11 isoform 12 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002266 ! Bcl-2-like protein 11 isoform 12
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002830
name: Bcl-2-like protein 11 isoform 13 unmodified form
def: "A Bcl-2-like protein 11 isoform 13 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002267 ! Bcl-2-like protein 11 isoform 13
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002831
name: Bcl-2-like protein 11 isoform 14 unmodified form
def: "A Bcl-2-like protein 11 isoform 14 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002268 ! Bcl-2-like protein 11 isoform 14
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002832
name: Bcl-2-like protein 11 isoform 15 unmodified form
def: "A Bcl-2-like protein 11 isoform 15 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002269 ! Bcl-2-like protein 11 isoform 15
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002833
name: Bcl-2-like protein 11 isoform 16 unmodified form
def: "A Bcl-2-like protein 11 isoform 16 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002270 ! Bcl-2-like protein 11 isoform 16
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002834
name: Bcl-2-like protein 11 isoform 17 unmodified form
def: "A Bcl-2-like protein 11 isoform 17 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002271 ! Bcl-2-like protein 11 isoform 17
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002835
name: Bcl-2-like protein 11 isoform 2 unmodified form
def: "A Bcl-2-like protein 11 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002272 ! Bcl-2-like protein 11 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002836
name: Bcl-2-like protein 11 isoform 3 unmodified form
def: "A Bcl-2-like protein 11 isoform 3 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002273 ! Bcl-2-like protein 11 isoform 3
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002837
name: Bcl-2-like protein 11 isoform 4 unmodified form
def: "A Bcl-2-like protein 11 isoform 4 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002274 ! Bcl-2-like protein 11 isoform 4
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002838
name: Bcl-2-like protein 11 isoform 5 unmodified form
def: "A Bcl-2-like protein 11 isoform 5 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002275 ! Bcl-2-like protein 11 isoform 5
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002839
name: Bcl-2-like protein 11 isoform 6 unmodified form
def: "A Bcl-2-like protein 11 isoform 6 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002276 ! Bcl-2-like protein 11 isoform 6
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002840
name: Bcl-2-like protein 11 isoform 7 unmodified form
def: "A Bcl-2-like protein 11 isoform 7 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002277 ! Bcl-2-like protein 11 isoform 7
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002841
name: Bcl-2-like protein 11 isoform 8 unmodified form
def: "A Bcl-2-like protein 11 isoform 8 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002278 ! Bcl-2-like protein 11 isoform 8
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002842
name: Bcl-2-like protein 11 isoform 9 unmodified form
def: "A Bcl-2-like protein 11 isoform 9 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002279 ! Bcl-2-like protein 11 isoform 9
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002843
name: Bcl2 antagonist of cell death isoform 1 unmodified form
def: "A Bcl2 antagonist of cell death isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002280 ! Bcl2 antagonist of cell death isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002844
name: Bcl2 antagonist of cell death isoform 2 unmodified form
def: "A Bcl2 antagonist of cell death isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002281 ! Bcl2 antagonist of cell death isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002845
name: DNA fragmentation factor subunit alpha isoform 1 unmodified form
def: "A DNA fragmentation factor subunit alpha isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002283 ! DNA fragmentation factor subunit alpha isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002846
name: DNA fragmentation factor subunit alpha isoform 2 unmodified form
def: "A DNA fragmentation factor subunit alpha isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002284 ! DNA fragmentation factor subunit alpha isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002847
name: FADD protein isoform 1 unmodified form
def: "A FADD protein isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002285 ! FADD protein isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002848
name: RAC-alpha serine/threonine-protein kinase isoform 1 unmodified form
def: "A RAC-alpha serine/threonine-protein kinase isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002286 ! RAC-alpha serine/threonine-protein kinase isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002849
name: apoptosis protease-activating factor 1 isoform 1 unmodified form
def: "An apoptosis protease-activating factor 1 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002293 ! apoptosis protease-activating factor 1 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002850
name: apoptosis protease-activating factor 1 isoform 2 unmodified form
def: "An apoptosis protease-activating factor 1 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002294 ! apoptosis protease-activating factor 1 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002851
name: apoptosis protease-activating factor 1 isoform 3 unmodified form
def: "An apoptosis protease-activating factor 1 isoform 3 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002295 ! apoptosis protease-activating factor 1 isoform 3
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002852
name: apoptosis protease-activating factor 1 isoform 4 unmodified form
def: "An apoptosis protease-activating factor 1 isoform 4 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002296 ! apoptosis protease-activating factor 1 isoform 4
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002853
name: apoptosis protease-activating factor 1 isoform 5 unmodified form
def: "An apoptosis protease-activating factor 1 isoform 5 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002297 ! apoptosis protease-activating factor 1 isoform 5
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002854
name: apoptosis protease-activating factor 1 isoform 6 unmodified form
def: "An apoptosis protease-activating factor 1 isoform 6 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002298 ! apoptosis protease-activating factor 1 isoform 6
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002855
name: apoptosis regulator BAX isoform 1 unmodified form
def: "An apoptosis regulator BAX isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002299 ! apoptosis regulator BAX isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002856
name: apoptosis regulator BAX isoform 2 unmodified form
def: "An apoptosis regulator BAX isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002300 ! apoptosis regulator BAX isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002857
name: apoptosis regulator BAX isoform 4 unmodified form
def: "An apoptosis regulator BAX isoform 4 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002302 ! apoptosis regulator BAX isoform 4
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002858
name: apoptosis regulator BAX isoform 5 unmodified form
def: "An apoptosis regulator BAX isoform 5 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002303 ! apoptosis regulator BAX isoform 5
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002859
name: apoptosis regulator BAX isoform 6 unmodified form
def: "An apoptosis regulator BAX isoform 6 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002304 ! apoptosis regulator BAX isoform 6
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002860
name: apoptosis regulator BAX isoform 7 unmodified form
def: "An apoptosis regulator BAX isoform 7 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002305 ! apoptosis regulator BAX isoform 7
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002861
name: apoptosis regulator BAX isoform 8 unmodified form
def: "An apoptosis regulator BAX isoform 8 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002306 ! apoptosis regulator BAX isoform 8
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002862
name: catenin beta-1 isoform 1 unmodified form
def: "A catenin beta-1 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002319 ! catenin beta-1 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002863
name: catenin beta-1 isoform 2 unmodified form
def: "A catenin beta-1 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002320 ! catenin beta-1 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002864
name: cytoplasmic tyrosine-protein kinase BMX isoform 1 unmodified form
def: "A cytoplasmic tyrosine-protein kinase BMX isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002323 ! cytoplasmic tyrosine-protein kinase BMX isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002865
name: cytoplasmic tyrosine-protein kinase BMX isoform 2 unmodified form
def: "A cytoplasmic tyrosine-protein kinase BMX isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002324 ! cytoplasmic tyrosine-protein kinase BMX isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002866
name: gelsolin isoform 1 unmodified form
def: "A gelsolin isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002327 ! gelsolin isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002867
name: gelsolin isoform 2 unmodified form
def: "A gelsolin isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002328 ! gelsolin isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002868
name: glycylpeptide N-tetradecanoyltransferase 1 isoform 1 unmodified form
def: "A glycylpeptide N-tetradecanoyltransferase 1 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002329 ! glycylpeptide N-tetradecanoyltransferase 1 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002869
name: glycylpeptide N-tetradecanoyltransferase 1 isoform 2 unmodified form
def: "A glycylpeptide N-tetradecanoyltransferase 1 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002330 ! glycylpeptide N-tetradecanoyltransferase 1 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002870
name: lymphotoxin-alpha isoform 1 unmodified form
def: "A lymphotoxin-alpha isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002331 ! lymphotoxin-alpha isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002871
name: lymphotoxin-beta isoform 1 unmodified form
def: "A lymphotoxin-beta isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002332 ! lymphotoxin-beta isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002872
name: lymphotoxin-beta isoform 2 unmodified form
def: "A lymphotoxin-beta isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002333 ! lymphotoxin-beta isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002873
name: mitogen-activated protein kinase 8 isoform 1 unmodified form
def: "A mitogen-activated protein kinase 8 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002334 ! mitogen-activated protein kinase 8 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002874
name: mitogen-activated protein kinase 8 isoform 2 unmodified form
def: "A mitogen-activated protein kinase 8 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002335 ! mitogen-activated protein kinase 8 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002875
name: mitogen-activated protein kinase 8 isoform 3 unmodified form
def: "A mitogen-activated protein kinase 8 isoform 3 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002336 ! mitogen-activated protein kinase 8 isoform 3
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002876
name: mitogen-activated protein kinase 8 isoform 4 unmodified form
def: "A mitogen-activated protein kinase 8 isoform 4 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002337 ! mitogen-activated protein kinase 8 isoform 4
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002877
name: occludin isoform 1 unmodified form
def: "An occludin isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002338 ! occludin isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002878
name: proteasome subunit beta type-2 isoform 1 unmodified form
def: "A proteasome subunit beta type-2 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002339 ! proteasome subunit beta type-2 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002879
name: proteasome subunit beta type-4 isoform 1 unmodified form
def: "A proteasome subunit beta type-4 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002340 ! proteasome subunit beta type-4 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002880
name: rho GTPase-activating protein 10 isoform 1 unmodified form
def: "A rho GTPase-activating protein 10 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002345 ! rho GTPase-activating protein 10 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002881
name: rho GTPase-activating protein 10 isoform 2 unmodified form
def: "A rho GTPase-activating protein 10 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002346 ! rho GTPase-activating protein 10 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002882
name: rho GTPase-activating protein 10 isoform 3 unmodified form
def: "A rho GTPase-activating protein 10 isoform 3 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002347 ! rho GTPase-activating protein 10 isoform 3
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002883
name: rho GTPase-activating protein 10 isoform 4 unmodified form
def: "A rho GTPase-activating protein 10 isoform 4 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002348 ! rho GTPase-activating protein 10 isoform 4
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002884
name: tumor necrosis factor ligand superfamily member 14 isoform 1 unmodified form
def: "A tumor necrosis factor ligand superfamily member 14 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002353 ! tumor necrosis factor ligand superfamily member 14 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002885
name: tumor necrosis factor ligand superfamily member 14 isoform 2 unmodified form
def: "A tumor necrosis factor ligand superfamily member 14 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002354 ! tumor necrosis factor ligand superfamily member 14 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002886
name: tumor necrosis factor ligand superfamily member 15 isoform 1 unmodified form
def: "A tumor necrosis factor ligand superfamily member 15 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002355 ! tumor necrosis factor ligand superfamily member 15 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002887
name: tumor necrosis factor ligand superfamily member 15 isoform 2 unmodified form
def: "A tumor necrosis factor ligand superfamily member 15 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002356 ! tumor necrosis factor ligand superfamily member 15 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002888
name: tumor necrosis factor ligand superfamily member 15 isoform 3 unmodified form
def: "A tumor necrosis factor ligand superfamily member 15 isoform 3 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002357 ! tumor necrosis factor ligand superfamily member 15 isoform 3
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002889
name: tumor necrosis factor receptor superfamily member 6 isoform 1 unmodified form
def: "A tumor necrosis factor receptor superfamily member 6 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002358 ! tumor necrosis factor receptor superfamily member 6 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002890
name: tumor necrosis factor receptor superfamily member 6 isoform 2 unmodified form
def: "A tumor necrosis factor receptor superfamily member 6 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002359 ! tumor necrosis factor receptor superfamily member 6 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002891
name: tumor necrosis factor receptor superfamily member 6 isoform 3 unmodified form
def: "A tumor necrosis factor receptor superfamily member 6 isoform 3 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002360 ! tumor necrosis factor receptor superfamily member 6 isoform 3
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002892
name: tumor necrosis factor receptor superfamily member 6 isoform 4 unmodified form
def: "A tumor necrosis factor receptor superfamily member 6 isoform 4 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002361 ! tumor necrosis factor receptor superfamily member 6 isoform 4
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002893
name: tumor necrosis factor receptor superfamily member 6 isoform 5 unmodified form
def: "A tumor necrosis factor receptor superfamily member 6 isoform 5 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002362 ! tumor necrosis factor receptor superfamily member 6 isoform 5
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002894
name: tumor necrosis factor receptor superfamily member 6 isoform 6 unmodified form
def: "A tumor necrosis factor receptor superfamily member 6 isoform 6 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002363 ! tumor necrosis factor receptor superfamily member 6 isoform 6
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002895
name: tumor necrosis factor receptor superfamily member 6 isoform 7 unmodified form
def: "A tumor necrosis factor receptor superfamily member 6 isoform 7 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002364 ! tumor necrosis factor receptor superfamily member 6 isoform 7
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002896
name: tumor necrosis factor receptor type 1-associated DEATH domain protein isoform 1 unmodified form
def: "A tumor necrosis factor receptor type 1-associated DEATH domain protein isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002365 ! tumor necrosis factor receptor type 1-associated DEATH domain protein isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002897
name: tyrosine-protein kinase Tec isoform 1 unmodified form
def: "A tyrosine-protein kinase Tec isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002366 ! tyrosine-protein kinase Tec isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002898
name: tyrosine-protein kinase Tec isoform 2 unmodified form
def: "A tyrosine-protein kinase Tec isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002367 ! tyrosine-protein kinase Tec isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002899
name: tyrosine-protein kinase Tec isoform 3 unmodified form
def: "A tyrosine-protein kinase Tec isoform 3 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002368 ! tyrosine-protein kinase Tec isoform 3
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002900
name: tyrosine-protein kinase Tec isoform 4 unmodified form
def: "A tyrosine-protein kinase Tec isoform 4 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002369 ! tyrosine-protein kinase Tec isoform 4
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002901
name: tyrosine-protein kinase Tec isoform 5 unmodified form
def: "A tyrosine-protein kinase Tec isoform 5 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002370 ! tyrosine-protein kinase Tec isoform 5
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002902
name: tyrosine-protein kinase Tec isoform 6 unmodified form
def: "A tyrosine-protein kinase Tec isoform 6 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002371 ! tyrosine-protein kinase Tec isoform 6
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002903
name: TNF receptor-associated factor 1 isoform 1 unmodified form
def: "A TNF receptor-associated factor 1 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002373 ! TNF receptor-associated factor 1 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002904
name: TNF receptor-associated factor 2 isoform 1 unmodified form
def: "A TNF receptor-associated factor 2 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002374 ! TNF receptor-associated factor 2 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002905
name: TNF receptor-associated factor 2 isoform 2 unmodified form
def: "A TNF receptor-associated factor 2 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002375 ! TNF receptor-associated factor 2 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002906
name: TNF receptor-associated factor 2 isoform 3 unmodified form
def: "A TNF receptor-associated factor 2 isoform 3 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002376 ! TNF receptor-associated factor 2 isoform 3
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002907
name: TNF receptor-associated factor 3 isoform 1 unmodified form
def: "A TNF receptor-associated factor 3 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002377 ! TNF receptor-associated factor 3 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002908
name: TNF receptor-associated factor 4 isoform 1 unmodified form
def: "A TNF receptor-associated factor 4 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002378 ! TNF receptor-associated factor 4 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002909
name: TNF receptor-associated factor 4 isoform 2 unmodified form
def: "A TNF receptor-associated factor 4 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002379 ! TNF receptor-associated factor 4 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002910
name: TNF receptor-associated factor 5 isoform 1 unmodified form
def: "A TNF receptor-associated factor 5 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002380 ! TNF receptor-associated factor 5 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002911
name: TNF receptor-associated factor 6 isoform 1 unmodified form
def: "A TNF receptor-associated factor 6 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002381 ! TNF receptor-associated factor 6 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002912
name: TNF receptor-associated factor 6 isoform 2 unmodified form
def: "A TNF receptor-associated factor 6 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002382 ! TNF receptor-associated factor 6 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002913
name: apoptosis regulator Bcl-2 isoform 1 unmodified form
def: "An apoptosis regulator Bcl-2 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002383 ! apoptosis regulator Bcl-2 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002914
name: apoptosis regulator Bcl-2 isoform 2 unmodified form
def: "An apoptosis regulator Bcl-2 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002384 ! apoptosis regulator Bcl-2 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002915
name: Bcl-2-like protein 1 unmodified form
def: "A Bcl-2-like protein 1 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
synonym: "apoptosis regulator Bcl-X isoform 1 unmodified form" EXACT []
intersection_of: PRO:000002385 ! Bcl-2-like protein 1 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002916
name: apoptosis regulator Bcl-X isoform 2 unmodified form
def: "An apoptosis regulator Bcl-X isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002386 ! Bcl-2-like protein 1 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002917
name: Bcl-2-like protein 1 isoform 3 unmodified form
def: "A Bcl-2-like protein 1 isoform 3 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
synonym: "apoptosis regulator Bcl-X isoform 3 unmodified form" EXACT []
intersection_of: PRO:000002387 ! Bcl-2-like protein 1 isoform 3
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002918
name: Bcl-2-like protein 1 isoform 4 unmodified form
def: "A Bcl-2-like protein 1 isoform 4 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
synonym: "apoptosis regulator Bcl-X isoform 4 unmodified form" EXACT []
intersection_of: PRO:000002388 ! Bcl-2-like protein 1 isoform 4
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002919
name: Bcl-2-like protein 1 isoform 5 unmodified form
def: "A Bcl-2-like protein 1 isoform 5 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
synonym: "apoptosis regulator Bcl-X isoform 5 unmodified form" EXACT []
intersection_of: PRO:000002389 ! Bcl-2-like protein 1 isoform 5
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002920
name: caspase-1 isoform 1 unmodified form
def: "A caspase-1 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002390 ! caspase-1 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002921
name: caspase-1 isoform 2 unmodified form
def: "A caspase-1 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002391 ! caspase-1 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002922
name: caspase-1 isoform 3 unmodified form
def: "A caspase-1 isoform 3 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002392 ! caspase-1 isoform 3
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002923
name: caspase-1 isoform 4 unmodified form
def: "A caspase-1 isoform 4 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002393 ! caspase-1 isoform 4
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002924
name: caspase-1 isoform 5 unmodified form
def: "A caspase-1 isoform 5 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002394 ! caspase-1 isoform 5
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002925
name: caspase-1 isoform 6 unmodified form
def: "A caspase-1 isoform 6 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002395 ! caspase-1 isoform 6
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002926
name: caspase-10 isoform 1 unmodified form
def: "A caspase-10 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002396 ! caspase-10 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002927
name: caspase-10 isoform 2 unmodified form
def: "A caspase-10 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002397 ! caspase-10 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002928
name: caspase-10 isoform 3 unmodified form
def: "A caspase-10 isoform 3 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002398 ! caspase-10 isoform 3
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002929
name: caspase-10 isoform 4 unmodified form
def: "A caspase-10 isoform 4 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002399 ! caspase-10 isoform 4
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002930
name: caspase-2 isoform 1 unmodified form
def: "A caspase-2 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002400 ! caspase-2 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002931
name: caspase-2 isoform 2 unmodified form
def: "A caspase-2 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002401 ! caspase-2 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002932
name: caspase-3 isoform 1 unmodified form
def: "A caspase-3 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002402 ! caspase-3 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002933
name: caspase-4 isoform 1 unmodified form
def: "A caspase-4 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002403 ! caspase-4 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002934
name: caspase-4 isoform 2 unmodified form
def: "A caspase-4 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002404 ! caspase-4 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002935
name: caspase-5 isoform 1 unmodified form
def: "A caspase-5 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002405 ! caspase-5 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002936
name: caspase-6 isoform 1 unmodified form
def: "A caspase-6 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002406 ! caspase-6 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002937
name: caspase-6 isoform 2 unmodified form
def: "A caspase-6 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002407 ! caspase-6 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002938
name: caspase-6 isoform 3 unmodified form
def: "A caspase-6 isoform 3 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002408 ! caspase-6 isoform 3
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002939
name: caspase-7 isoform 1 unmodified form
def: "A caspase-7 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002409 ! caspase-7 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002940
name: caspase-7 isoform 2 unmodified form
def: "A caspase-7 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002410 ! caspase-7 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002941
name: caspase-7 isoform 3 unmodified form
def: "A caspase-7 isoform 3 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002411 ! caspase-7 isoform 3
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002942
name: caspase-8 isoform 1 unmodified form
def: "A caspase-8 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002412 ! caspase-8 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002943
name: caspase-8 isoform 2 unmodified form
def: "A caspase-8 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002413 ! caspase-8 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002944
name: caspase-8 isoform 3 unmodified form
def: "A caspase-8 isoform 3 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002414 ! caspase-8 isoform 3
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002945
name: caspase-8 isoform 4 unmodified form
def: "A caspase-8 isoform 4 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002415 ! caspase-8 isoform 4
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002946
name: caspase-8 isoform 5 unmodified form
def: "A caspase-8 isoform 5 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002416 ! caspase-8 isoform 5
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002947
name: caspase-8 isoform 6 unmodified form
def: "A caspase-8 isoform 6 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002417 ! caspase-8 isoform 6
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002948
name: caspase-8 isoform 7 unmodified form
def: "A caspase-8 isoform 7 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002418 ! caspase-8 isoform 7
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002949
name: caspase-8 isoform 8 unmodified form
def: "A caspase-8 isoform 8 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002419 ! caspase-8 isoform 8
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002950
name: caspase-8 isoform 9 unmodified form
def: "A caspase-8 isoform 9 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002420 ! caspase-8 isoform 9
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002951
name: caspase-9 isoform 1 unmodified form
def: "A caspase-9 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002421 ! caspase-9 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002952
name: caspase-9 isoform 2 unmodified form
def: "A caspase-9 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002422 ! caspase-9 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002953
name: cytochrome c, somatic isoform 1 unmodified form
def: "A cytochrome c, somatic isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002423 ! cytochrome c, somatic isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002954
name: cytochrome c, testis-specific isoform 1 unmodified form
def: "A cytochrome c, testis-specific isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002424 ! cytochrome c, testis-specific isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002955
name: dynein light chain 1, cytoplasmic isoform 1 unmodified form
def: "A dynein light chain 1, cytoplasmic isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002425 ! dynein light chain 1, cytoplasmic isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002956
name: dynein light chain 2, cytoplasmic isoform 1 unmodified form
def: "A dynein light chain 2, cytoplasmic isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002426 ! dynein light chain 2, cytoplasmic isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002957
name: protein kinase C delta type isoform 1 unmodified form
def: "A protein kinase C delta type isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002427 ! protein kinase C delta type isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002958
name: protein kinase C delta type isoform 2 unmodified form
def: "A protein kinase C delta type isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002428 ! protein kinase C delta type isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002959
name: protein kinase C epsilon isoform 1 unmodified form
def: "A protein kinase C epsilon isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002429 ! protein kinase C epsilon isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002960
name: protein kinase C eta type isoform 1 unmodified form
def: "A protein kinase C eta type isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002430 ! protein kinase C eta type isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002961
name: protein kinase C theta type isoform 1 unmodified form
def: "A protein kinase C theta type isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002431 ! protein kinase C theta type isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002962
name: protein kinase C theta type isoform 2 unmodified form
def: "A protein kinase C theta type isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002432 ! protein kinase C theta type isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002963
name: serine/threonine-protein kinase 24 isoform 1 unmodified form
def: "A serine/threonine-protein kinase 24 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002433 ! serine/threonine-protein kinase 24 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002964
name: serine/threonine-protein kinase 24 isoform 2 unmodified form
def: "A serine/threonine-protein kinase 24 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002434 ! serine/threonine-protein kinase 24 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002965
name: serine/threonine-protein kinase 25 isoform 1 unmodified form
def: "A serine/threonine-protein kinase 25 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002435 ! serine/threonine-protein kinase 25 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002966
name: serine/threonine-protein kinase MST4 isoform 1 unmodified form
def: "A serine/threonine-protein kinase MST4 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:DNx]
comment: Category=modification.
intersection_of: PRO:000002436 ! serine/threonine-protein kinase MST4 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002967
name: post-translational protein modification
def: "An alteration to a protein chain or any of its constituent residues that occurs during or after translation." [PRO:DAN]
comment: PRO needs to distinguish between pre-translational modifications (such as selenocysteine) and those that occur after chain elongation begins; also, chain cleavage must be included. For these reasons MOD:00000 is not used.
is_a: PRO:000002969 ! protein covalent modification

[Term]
id: PRO:000002968
name: modified protein residue
def: "A naturally-occurring amino acid within a protein chain that is covalently bonded to an external molecule after its incorporation into the chain." [PRO:DAN]
is_a: PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002969
name: protein covalent modification
def: "A direct change to a protein chain or its constituent residues that occurs before, during or after translation." [PRO:DAN]

[Term]
id: PRO:000002970
name: non-standard encoded protein residue
def: "A naturally-occurring amino acid within a protein chain that is covalently bonded to an external molecule before its incorporation into the chain." [PRO:DAN]
comment: PRO needs to refer to such residues as distinct from the standard set of amino acids.  These are produced exclusively by modification of amino acids acylated to special tRNA before incorporation by ribosomes into proteins. For this reason, they have also been referred to as pre-translational modifications. [PSI-MOD]
synonym: "natural, non-standard encoded residue" RELATED [MOD:00868]
is_a: PRO:000002969 ! protein covalent modification

[Term]
id: PRO:000002971
name: cleaved peptide bond
def: "A dissolved bond between adjacent amino acid residues of a protein leading to the formation of smaller molecules." [PRO:DAN]
comment: PRO needs to distinguish between the act of breaking the bond and the broken bond itself. For this reason MI:0570 -- which refers to the reaction -- is not used.
synonym: "protein cleavage" RELATED [MI:0570]
is_a: PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002972
name: macrophage mannose receptor 1
def: "A C-type lectin with multiple lectin domains that is a translation product of the MRC1 gene." [PMID:8297379, PRO:CNA]
comment: Category=gene.
synonym: "C-type lectin domain family 13 member D" EXACT []
synonym: "CD antigen CD206" EXACT []
synonym: "CD206" EXACT []
synonym: "CLEC13D" RELATED []
synonym: "MMR" EXACT []
synonym: "MRC1" RELATED []
is_a: PRO:000001025 ! C-type lectin with multiple lectin domains

[Term]
id: PRO:000002973
name: ataxin-1/ataxin-1-like
def: "A protein that is a translation product of the ATXN1, or ATXN1L gene. The canonical protein sequence has a core domain architecture consisting of an Ataxin-1 and HBP1 module (AXH) (PF08517) domain towards the C-terminus." [PMID:16121196]
comment: Category=family.
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000002974
name: ataxin-1
def: "An ataxin-1/ataxin-1-like that is a translation product of the ATXN1 gene." [PRO:CNA]
comment: Category=gene.
synonym: "ATX1" RELATED []
synonym: "ATXN1" RELATED []
synonym: "SCA1" RELATED []
synonym: "spinocerebellar ataxia type 1 protein" EXACT []
is_a: PRO:000002973 ! ataxin-1/ataxin-1-like

[Term]
id: PRO:000002975
name: ataxin-1-like
def: "An ataxin-1/ataxin-1-like that is a translation product of the ATXN1L gene." [PRO:CNA]
comment: Category=gene.
synonym: "ATXN1L" RELATED []
synonym: "BOAT" EXACT []
synonym: "brother of ataxin-1" EXACT []
is_a: PRO:000002973 ! ataxin-1/ataxin-1-like

[Term]
id: PRO:000002976
name: ly-6-like protein
def: "A protein that is the translation product of some gene evolved from the last common ancestor of" [PRO:CNA]
comment: Category=family.
xref: PIRSF:PIRSF002021
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000002977
name: killer cell lectin-like receptor subfamily B member 1C
def: "A killer cell lectin-like receptor subfamily B member 1 that is a translation product of the KLRB1C gene." [PRO:CNA]
comment: Category=gene.
synonym: " NKR-P1C" EXACT []
synonym: "CD161 antigen-like family member C" EXACT []
synonym: "CD161c" EXACT []
synonym: "Klrb1c" RELATED []
synonym: "Ly-55c" EXACT []
synonym: "Ly55c" RELATED []
synonym: "Lymphocyte antigen 55c" EXACT []
synonym: "natural killer cell surface protein P1-40" EXACT []
synonym: "NK1.1" EXACT []
synonym: "NKR-P1 40" EXACT []
synonym: "NKR-P1.9" EXACT []
synonym: "Nkrp1c" RELATED []
is_a: PRO:000001874 ! killer cell lectin-like receptor subfamily B member 1

[Term]
id: PRO:000002978
name: lymphocyte antigen 6G
def: "A ly-6-like protein that is a translation product of the LY6G gene." [PRO:CNA]
comment: Category=gene.
synonym: "Ly-6G" EXACT []
synonym: "Ly-6G.1" EXACT []
synonym: "LY6G" RELATED []
is_a: PRO:000002976 ! ly-6-like protein

[Term]
id: PRO:000002979
name: lymphocyte antigen 6A-2/6E-1
def: "A ly-6-like protein that is a translation product of the LY6A gene." [PRO:CNA]
comment: Category=gene.
synonym: "ly-6A.2/ly-6E.1" EXACT []
synonym: "LY6" RELATED []
synonym: "LY6A" RELATED []
synonym: "SCA-1" EXACT []
synonym: "Stem cell antigen 1" EXACT []
synonym: "T-cell-activating protein" EXACT []
synonym: "TAP" EXACT []
is_a: PRO:000002976 ! ly-6-like protein

[Term]
id: PRO:000002980
name: lymphocyte antigen 6C
def: "An ly-6-like protein that is a translation product of the LY6C2 gene." [PRO:CNA]
comment: Category=gene.
synonym: "Ly-6C2" EXACT []
synonym: "Ly6c" RELATED []
synonym: "Ly6c2" RELATED []
is_a: PRO:000002976 ! ly-6-like protein

[Term]
id: PRO:000002981
name: lymphocyte antigen 76
def: "A protein that is a translation product of the LY76 gene." [MGI:106910, PMID:10848813]
comment: Category=gene.
synonym: "ly76" RELATED []
synonym: "ter-119" EXACT []
synonym: "ter119" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000002982
name: fractalkine isoform 1
def: "A fractalkine that is a translation product of a mature transcript of the CX3CL1 gene. Represented by the sequence UniProtKB:Q9Z0D9-1." [PRO:HJD]
comment: Category=sequence.
is_a: PRO:000001855 ! fractalkine

[Term]
id: PRO:000002983
name: fractalkine isoform 1 cleaved form
def: "A fractalkine isoform 1 that has been processed by proteolytic cleavage." [PRO:HJD]
comment: Category=modification.
synonym: "soluble form of neurotactin" EXACT []
intersection_of: PRO:000002982 ! fractalkine isoform 1
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000002984
name: zinc finger protein eos
def: "An ikaros-like zinc finger transcription factor that is a translation product of the IKZF4 gene." [PRO:HJD]
comment: Category=gene.
synonym: "eos" EXACT []
synonym: "ikaros family zinc finger protein 4" EXACT []
synonym: "IKZF4" RELATED []
synonym: "ZNFN1A4" RELATED []
is_a: PRO:000002986 ! ikaros-like zinc finger transcription factor

[Term]
id: PRO:000002985
name: fractalkine isoform 1 unmodified form
def: "A fractalkine isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:CNA]
comment: Category=modification.
synonym: "fractalkine membrane form" EXACT []
intersection_of: PRO:000002982 ! fractalkine isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000002986
name: ikaros-like zinc finger transcription factor
def: "A protein that is the translation product of some gene evolved from the last common ancestor of human IKZF1 and human IKZF5 gene. The canonical protein sequence has a core domain architecture consisting of two copies of the Zinc finger, C2H2 type (PF00096) domains, an N-terminal domain important for DNA recognition, and a C-terminal domain that mediates homo- and heterotypic associations between family members." [PMID:10978333, PMID:19342657]
comment: Category=family.
synonym: "ikaros family of zinc finger transcription factors" EXACT []
xref: PIRSF:PIRSF038846
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000002987
name: zinc finger protein pegasus
def: "An ikaros-like zinc finger transcription factor that is a translation product of the IKZF5 gene." [PRO:CNA]
comment: Category=gene.
synonym: "ikaros family zinc finger protein 5" EXACT []
synonym: "IKZF5" RELATED []
synonym: "pegasus" EXACT []
synonym: "ZNFN1A5" RELATED []
is_a: PRO:000002986 ! ikaros-like zinc finger transcription factor

[Term]
id: PRO:000002988
name: zinc finger protein eos isoform 1
def: "A zinc finger protein eos that is a translation product of a mature transcript of the IKZF4 gene. Represented by the sequence UniProtKB:Q8C208-1." [PRO:HJD]
comment: Category=sequence.
is_a: PRO:000002984 ! zinc finger protein eos

[Term]
id: PRO:000002989
name: zinc finger protein eos isoform 2
def: "A zinc finger protein eos that is a translation product of a mature transcript of the IKZF4 gene. Represented by the sequence UniProtKB:Q8C208-2." [PRO:HJD]
comment: Category=sequence.
is_a: PRO:000002984 ! zinc finger protein eos

[Term]
id: PRO:000002990
name: zinc finger protein eos isoform 3
def: "A zinc finger protein eos that is a translation product of a mature transcript of the IKZF4 gene. Represented by the sequence UniProtKB:Q8C208-3." [PRO:HJD]
comment: Category=sequence.
is_a: PRO:000002984 ! zinc finger protein eos

[Term]
id: PRO:000002991
name: zinc finger protein eos isoform 4
def: "A zinc finger protein eos that is a translation product of a mature transcript of the IKZF4 gene. Represented by the sequence UniProtKB:Q8C208-4." [PRO:HJD]
comment: Category=sequence.
is_a: PRO:000002984 ! zinc finger protein eos

[Term]
id: PRO:000002992
name: NRAMP-like divalent ion transporter
comment: Category=family.
xref: PIRSF:PIRSF005717
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000002993
name: natural resistance-associated macrophage protein 2
def: "A protein that is a translation product of the SLC11A2 gene." [PRO:HJD]
comment: Category=gene.
synonym: "divalent metal transporter 1" EXACT []
synonym: "DMT1" EXACT []
synonym: "NRAMP 2" EXACT []
synonym: "NRAMP2" RELATED []
synonym: "SLC11A2" RELATED []
is_a: PRO:000002992 ! NRAMP-like divalent ion transporter

[Term]
id: PRO:000002994
name: natural resistance-associated macrophage protein 1
def: "A protein that is a translation product of the SLC11A1 gene." [PRO:CNA]
comment: Category=gene.
synonym: "Bcg" RELATED []
synonym: "Ity" RELATED []
synonym: "LSH" RELATED []
synonym: "NRAMP" RELATED []
synonym: "NRAMP 1" EXACT []
synonym: "NRAMP1" RELATED []
synonym: "SLC11A1" RELATED []
is_a: PRO:000002992 ! NRAMP-like divalent ion transporter

[Term]
id: PRO:000002995
name: natural resistance-associated macrophage protein 2 isoform 1
def: "A natural resistance-associated macrophage protein 2 that is a translation product of a mature transcript of the SLC11A2 gene. Represented by the sequence UniProtKB:P49282-2." [PMID:7789986, PRO:HJD]
comment: Category=sequence.
synonym: "IRE" EXACT []
is_a: PRO:000002993 ! natural resistance-associated macrophage protein 2

[Term]
id: PRO:000002996
name: natural resistance-associated macrophage protein 2 isoform 2
def: "A natural resistance-associated macrophage protein 2 that is a translation product of a mature transcript of the SLC11A2 gene. Represented by the sequence UniProtKB:P49282-1." [PRO:HJD]
comment: Category=sequence.
synonym: "non-IRE" EXACT []
is_a: PRO:000002993 ! natural resistance-associated macrophage protein 2

[Term]
id: PRO:000002997
name: proto-oncogene SRC-like tyrosine-protein kinase
def: "(PF00018)(PF00017)(PF07714)." [PRO:CNA]
comment: Category=family.
xref: PIRSF:PIRSF000601
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000002998
name: proto-oncogene tyrosine-protein kinase lck
def: "A proto-oncogene SRC-like tyrosine-protein kinase that is translation product of the LCK gene." [PRO:CNA]
comment: Category=gene.
synonym: "LCK" EXACT []
synonym: "LSK" EXACT []
synonym: "Lsk-t" RELATED []
synonym: "lymphocyte cell-specific protein-tyrosine kinase" EXACT []
synonym: "p56-LCK" EXACT []
synonym: "T cell-specific protein-tyrosine kinase" EXACT []
is_a: PRO:000002997 ! proto-oncogene SRC-like tyrosine-protein kinase

[Term]
id: PRO:000002999
name: proto-oncogene tyrosine-protein kinase lck isoform 1
def: "A proto-oncogene tyrosine-protein kinase lck that is a translation product of a mature transcript of the LCK gene. Represented by the sequence UniProtKB:P06239-1." [PRO:CNA]
comment: Category=sequence.
synonym: "LCK isoform Long" EXACT []
is_a: PRO:000002998 ! proto-oncogene tyrosine-protein kinase lck

[Term]
id: PRO:000003000
name: proto-oncogene tyrosine-protein kinase lck isoform 1 phosphorylated form
def: "A proto-oncogene tyrosine-protein kinase lck isoform 1 that has been post-translationally modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000002999 ! proto-oncogene tyrosine-protein kinase lck isoform 1
intersection_of: has_modification MOD:00696 ! phosphorylated residue

[Term]
id: PRO:000003001
name: proto-oncogene tyrosine-protein kinase lck isoform 1 phosphorylated 1
def: "A proto-oncogene tyrosine-protein kinase lck isoform 1 phosphorylated form that has been phosphorylated in the autoinhibitory Tyr residue (Tyr-505 in human lck), and in the activation Tyr residue (Tyr-394 in human lck). This form is predominant in the presence of HIV gp120 protein." [PMID:9043947, PRO:CL]
comment: Category=modification.
synonym: "lck autoinhibited" EXACT []
is_a: PRO:000003000 ! proto-oncogene tyrosine-protein kinase lck isoform 1 phosphorylated form

[Term]
id: PRO:000003002
name: proto-oncogene tyrosine-protein kinase lck isoform 1 unmodified form
def: "A proto-oncogene tyrosine-protein kinase lck isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000002999 ! proto-oncogene tyrosine-protein kinase lck isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000003003
name: proto-oncogene tyrosine-protein kinase fyn
def: "A proto-oncogene SRC-like tyrosine-protein kinase that is translation product of the FYN gene." [PRO:CNA]
comment: Category=gene.
synonym: " p59-Fyn" EXACT []
synonym: "FYN" EXACT []
synonym: "Protooncogene Syn" EXACT []
synonym: "SLK" EXACT []
is_a: PRO:000002997 ! proto-oncogene SRC-like tyrosine-protein kinase

[Term]
id: PRO:000003004
name: proto-oncogene tyrosine-protein kinase fyn isoform 1
def: "A proto-oncogene tyrosine-protein kinase fyn that is a translation product of a mature transcript of the FYN gene. Represented by the sequence UniProtKB:P06241-1." [PRO:CNA]
comment: Category=sequence.
synonym: "isoform B" EXACT []
is_a: PRO:000003003 ! proto-oncogene tyrosine-protein kinase fyn

[Term]
id: PRO:000003005
name: proto-oncogene tyrosine-protein kinase fyn isoform 1 phosphorylated form
def: "A proto-oncogene tyrosine-protein kinase fyn isoform 1 that has been post-translationally modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000003004 ! proto-oncogene tyrosine-protein kinase fyn isoform 1
intersection_of: has_modification MOD:00696 ! phosphorylated residue

[Term]
id: PRO:000003006
name: proto-oncogene tyrosine-protein kinase fyn isoform 1 phosphorylated 1
def: "A proto-oncogene tyrosine-protein kinase fyn isoform 1 phosphorylated form that has been phosphorylated on Tyr residues upon activation of the T cell antigen receptor-mediated signal transduction pathway." [PMID:1526965, PRO:CL]
comment: Category=modification.
synonym: "fyn active form" EXACT []
is_a: PRO:000003005 ! proto-oncogene tyrosine-protein kinase fyn isoform 1 phosphorylated form

[Term]
id: PRO:000003007
name: proto-oncogene tyrosine-protein kinase fyn isoform 1 unmodified form
def: "A proto-oncogene tyrosine-protein kinase fyn isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000003004 ! proto-oncogene tyrosine-protein kinase fyn isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000003008
name: moesin
def: "An erm protein that is a translation product of the MSN gene." [PRO:CNA]
comment: Category=gene.
synonym: "membrane-organizing extension spike protein" EXACT []
synonym: "MSN" RELATED []
is_a: PRO:000001030 ! erm protein

[Term]
id: PRO:000003009
name: radixin
def: "An erm protein that is a translation product of the RDX gene." [PRO:CNA]
comment: Category=gene.
synonym: "RDX" RELATED []
is_a: PRO:000001030 ! erm protein

[Term]
id: PRO:000003010
name: moesin isoform 1
def: "A moesin that is a translation product of a mature transcript of the MSN gene. Represented by the sequence UniProtKB:P26038-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000003008 ! moesin

[Term]
id: PRO:000003011
name: moesin isoform 1 unmodified form
def: "A moesin isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000003010 ! moesin isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000003012
name: moesin isoform 1 phosphorylated form
comment: Category=modification.
intersection_of: PRO:000003010 ! moesin isoform 1
intersection_of: has_modification MOD:00696 ! phosphorylated residue

[Term]
id: PRO:000003013
name: moesin isoform 1 phosphorylated 1
def: "A moesin isoform 1 phosphorylated form that has been phosphorylated at a Thr residue located within the C-terminal domain.  Example:UniProtKB:P26038-1, has_modification MOD:00047 O-phospho-L-threonine, Thr-558." [PMID:18941185, PMID:9456324]
comment: Category=modification.
synonym: "moesin active form" EXACT []
is_a: PRO:000003012 ! moesin isoform 1 phosphorylated form

[Term]
id: PRO:000003014
name: radixin isoform 1
def: "A radixin that is a translation product of a mature transcript of the RDX gene. Represented by the sequence UniProt:P35241-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000003009 ! radixin

[Term]
id: PRO:000003015
name: prostate-specific antigen
def: "A protein that is a translation product of the KLK3 gene." [PRO:CNA]
comment: Category=gene.
synonym: "APS" RELATED []
synonym: "gamma-seminoprotein" EXACT []
synonym: "kallikrein-3" EXACT []
synonym: "KLK3" RELATED []
synonym: "P-30 antigen" EXACT []
synonym: "PSA" EXACT []
synonym: "semenogelase" EXACT []
synonym: "seminin" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003016
name: prostate-specific antigen isoform 1
def: "A prostate-specific antigen that is a translation product of a mature transcript of the KLK3 gene. Represented by the sequence UniProtKB:P07288-1." [PMID:2422647, PRO:CNA]
comment: Category=sequence.
is_a: PRO:000003015 ! prostate-specific antigen

[Term]
id: PRO:000003017
name: prostate-specific antigen isoform 1 unmodified form
def: "A prostate-specific antigen isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:CNA]
comment: Category=modification.
synonym: "PSA precursor" EXACT []
intersection_of: PRO:000003016 ! prostate-specific antigen isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000003018
name: prostate-specific antigen isoform 1 cleaved and glycosylated form
def: "A prostate-specific antigen isoform 1 that has been processed by proteolytic cleavage and has been post-translationally process to include glycosylated residues." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000003016 ! prostate-specific antigen isoform 1
intersection_of: has_modification MOD:00693 ! glycosylated residue
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000003019
name: prostate-specific antigen isoform 1 cleaved and glycosylated 1
def: "A prostate-specific antigen isoform 1 cleaved and glycosylated form that has been processed by release of the signal peptide and the propeptide, to yield the active mature protein containing an N-glycosylated Asn residue within the glycosylation consensus sequence near its N-terminus. Example:UniProtKB:P07288-1 (residues 25-261), Asn-69, MOD:00006." [PMID:2422647, PMID:3691515]
comment: Category=modification.
synonym: "prostate-specific antigen secreted form" EXACT []
synonym: "PSA secreted" EXACT []
is_a: PRO:000003018 ! prostate-specific antigen isoform 1 cleaved and glycosylated form

[Term]
id: PRO:000003020
name: merlin
def: "An erm protein that is a translation product of the NF2 gene." [PRO:CNA]
comment: Category=gene.
synonym: "moesin-ezrin-radixin-like protein " EXACT []
synonym: "neurofibromin-2" EXACT []
synonym: "NF2" RELATED []
synonym: "SCH" RELATED []
synonym: "Schwannomerlin" EXACT []
synonym: "Schwannomin" EXACT []
is_a: PRO:000001030 ! erm protein

[Term]
id: PRO:000003021
name: merlin isoform 1
def: "A merlin that is a translation product of a mature transcript of the NF2 gene. Represented by the sequence UniProtKB:P35240-1." [PMID:18071304]
comment: Category=sequence.
synonym: "merlin isoform I" EXACT []
is_a: PRO:000003020 ! merlin

[Term]
id: PRO:000003022
name: merlin isoform 2
def: "A merlin that is a translation product of a mature transcript of the NF2 gene. Represented by the sequence UniProtKB:P35240-3." [PMID:18071304]
comment: Category=sequence.
synonym: "merlin isoform II" EXACT []
is_a: PRO:000003020 ! merlin

[Term]
id: PRO:000003023
name: merlin isoform 1 unmodified form
def: "A merlin isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000003021 ! merlin isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000003024
name: merlin isoform 1 phosphorylated form
comment: Category=modification.
intersection_of: PRO:000003021 ! merlin isoform 1
intersection_of: has_modification MOD:00696 ! phosphorylated residue

[Term]
id: PRO:000003025
name: merlin isoform 1 phosphorylated 1
def: "A merlin isoform 1 phosphorylated form that is phosphorylated in a C-terminal Ser residue within the PKA consensus site. Example:UniProtKB:P35240-1, has_modification MOD:00046 O-phospho-L-serine, Ser-518." [PMID:18071304, PRO:AL]
comment: Category=modification.
is_a: PRO:000003024 ! merlin isoform 1 phosphorylated form

[Term]
id: PRO:000003026
name: merlin isoform 1 phosphorylated 2
def: "A merlin isoform 1 phosphorylated form that is phosphorylated in a Ser residue (PKA consensus site) located within the N-terminal actin binding site, and it is also phosphorylated at a C-terminal Ser residue." [PMID:18071304, PRO:AL]
comment: Category=modification.
is_a: PRO:000003024 ! merlin isoform 1 phosphorylated form

[Term]
id: PRO:000003027
name: merlin isoform 2 unmodified form
def: "A merlin isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000003022 ! merlin isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000003028
name: merlin isoform 2 phosphorylated form
comment: Category=modification.
intersection_of: PRO:000003022 ! merlin isoform 2
intersection_of: has_modification MOD:00696 ! phosphorylated residue

[Term]
id: PRO:000003029
name: merlin isoform 2 phosphorylated 1
def: "A merlin isoform 2 phosphorylated form that is phosphorylated in a Ser residue (PKA consensus site) located within the N-terminal actin binding site, and it is also phosphorylated at a C-terminal Ser residue." [PMID:18071304, PRO:AL]
comment: Category=modification.
is_a: PRO:000003028 ! merlin isoform 2 phosphorylated form

[Term]
id: PRO:000003030
name: focal adhesion kinase
def: "A protein that is a translation product of the PTK2 or PTK2B gene." [PRO:CNA]
comment: Category=family.
synonym: "FAK" EXACT []
xref: PIRSF:PIRSF038851
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003031
name: focal adhesion kinase 1
def: "A focal adhesion kinase that is a translation product of the PTK2 gene." [PRO:CNA]
comment: Category=gene.
synonym: "FADK1" EXACT []
synonym: "FAK" RELATED []
synonym: "FAK1" RELATED []
synonym: "pp125FAK" EXACT []
synonym: "protein- tyrosine kinase 2" EXACT []
is_a: PRO:000003030 ! focal adhesion kinase

[Term]
id: PRO:000003032
name: focal adhesion kinase 2
def: "A focal adhesion kinase that is a translation product of the PTK2B gene." [PRO:CNA]
comment: Category=gene.
synonym: "CADTK " EXACT []
synonym: "CAK beta" EXACT []
synonym: "calcium-dependent tyrosine kinase " EXACT []
synonym: "cell adhesion kinase beta" EXACT []
synonym: "FADK 2 " EXACT []
synonym: "FAK2" RELATED []
synonym: "proline-rich tyrosine kinase 2" EXACT []
synonym: "protein tyrosine kinase 2 beta" EXACT []
synonym: "PTK2B" RELATED []
synonym: "PYK2" RELATED []
synonym: "RAFTK" EXACT []
synonym: "related adhesion focal tyrosine kinase" EXACT []
is_a: PRO:000003030 ! focal adhesion kinase

[Term]
id: PRO:000003033
name: leucine-rich repeat serine/threonine-protein kinase 2
def: "A protein that is translation product of the LRRK2 gene. LRRK2 belongs to a gene family known as Roco. Roco genes encode for large proteins that have a characteristic GTPase domain, named Roc, plus a domain of unknown function called COR. Several Roco proteins also contain a protein kinase domain. Leucine-rich repeat serine/threonine-protein kinase 2 contains a N-terminal repeat that is unique to this protein." [PMID:16966681, PRO:CNA]
comment: Category=gene.
synonym: "dardarin" EXACT []
synonym: "LRRK2" RELATED []
synonym: "PARK8" RELATED []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003034
name: proto-oncogene tyrosine-protein kinase lck isoform 1 phosphorylated 2
def: "A proto-oncogene tyrosine-protein kinase lck isoform 1 phosphorylated form that has been phosphorylated in the activation Tyr residue (Tyr-394 in human lck)." [PMID:9043947, PRO:CL]
comment: Category=modification.
synonym: "lck active form" EXACT []
is_a: PRO:000003000 ! proto-oncogene tyrosine-protein kinase lck isoform 1 phosphorylated form

[Term]
id: PRO:000003035
name: cellular tumor antigen p53
def: "A protein that is a translation product of the TP53 gene." [PRO:CNA]
comment: Category=gene.
synonym: "antigen NY-CO-13" EXACT []
synonym: "p53" EXACT []
synonym: "phosphoprotein p53" EXACT []
synonym: "Trp53" RELATED []
synonym: "tumor suppressor p53" EXACT []
xref: PIRSF:PIRSF002089
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003036
name: cellular tumor antigen p53 isoform 1
comment: Category=sequence.
is_a: PRO:000003035 ! cellular tumor antigen p53

[Term]
id: PRO:000003037
name: cellular tumor antigen p53 isoform 1 unmodified form
comment: Category=modification.
intersection_of: PRO:000003036 ! cellular tumor antigen p53 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000003038
name: cellular tumor antigen p53 isoform 1 phosphorylated form
comment: Category=modification.
is_a: PRO:000003036 ! cellular tumor antigen p53 isoform 1

[Term]
id: PRO:000003039
name: cellular tumor antigen p53 isoform 1 phosphorylated 1
def: "A cellular tumor antigen p53 isoform 1 phosphorylated form that has been phosphorylated at the Ser residue equivalent to Ser-15 in UniProtKB:P04637-1." [PMID:11602639, PRO:CL]
comment: Category=modification.
synonym: "p53S15" EXACT []
is_a: PRO:000003038 ! cellular tumor antigen p53 isoform 1 phosphorylated form

[Term]
id: PRO:000003040
name: cellular tumor antigen p53 isoform 1 phosphorylated 2
def: "A cellular tumor antigen p53 isoform 1 phosphorylated form that has been phosphorylated at the Ser residues equivalent to Ser-15/Ser-46 in UniProtKB:P04637-1." [PMID:15642743, PRO:CL]
comment: Category=modification.
synonym: "p53S46P" EXACT []
is_a: PRO:000003038 ! cellular tumor antigen p53 isoform 1 phosphorylated form

[Term]
id: PRO:000003041
name: serine/threonine-protein kinase mTOR
def: "A protein that is a translation product of the FRAP1 gene." [PRO:CL]
comment: Category=gene.
synonym: "FK506-binding protein 12-rapamycin complex-associated protein 1 " EXACT []
synonym: "FKBP12-rapamycin complex-associated protein " EXACT []
synonym: "FRAP" RELATED []
synonym: "FRAP1" RELATED []
synonym: "FRAP2" RELATED []
synonym: "mammalian target of rapamycin" EXACT []
synonym: "mTor" EXACT []
synonym: "rapamycin target protein" EXACT []
synonym: "RAPT1" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003042
name: ezrin isoform 1 phosphorylated 6
def: "An ezrin phosphorylated form that has been phosphorylated at either the C-terminal Thr (Thr-567 in human), through kinases such as Rho-kinase, or the N-terminal tyrosine residue (Tyr-354 in human). Example:UniProtKB:P15311-1, has_modification MOD:00048 O4'-phosphorylated L-tyrosine, Tyr-354; MOD:00047 O-phospho-L-threonine, Thr-567." [PMID:18852256, PRO:AL]
comment: Category=modification.
is_a: PRO:000001033 ! ezrin isoform 1 phosphorylated form

[Term]
id: PRO:000003043
name: mitogen-activated protein kinase kinase kinase kinase 4
def: "A protein that is a translation product of the MAP4K4 gene." [PMID:16938849, PRO:AL]
comment: Category=gene.
synonym: "HPK/GCK-like kinase HGK" EXACT []
synonym: "MAP4K4" RELATED []
synonym: "MAPK/ERK kinase kinase kinase 4" EXACT []
synonym: "MEK kinase kinase 4 " EXACT []
synonym: "MEKKK 4" EXACT []
synonym: "nck-interacting kinase" EXACT []
synonym: "NIK" RELATED []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003044
name: mitogen-activated protein kinase kinase kinase kinase 4 isoform 1
def: "A mitogen-activated protein kinase kinase kinase kinase 4 that is a translation product of a mature transcript of the MAP4K4 gene. Represented by the sequence UniProtKB:P97820-1." [PMID:9135144, PRO:AL]
comment: Category=sequence.
is_a: PRO:000003043 ! mitogen-activated protein kinase kinase kinase kinase 4

[Term]
id: PRO:000003045
name: kinesin-like protein KIF11
def: "A protein that is a translation product of the KIF11 gene. The canonical sequence contains one copy of the Kinesin motor domain (PF00225)." [PRO:AL]
comment: Category=gene.
synonym: "EG5" RELATED []
synonym: "KIF11" RELATED []
synonym: "kinesin-like protein 1" EXACT []
synonym: "kinesin-like spindle protein HKSP" EXACT []
synonym: "kinesin-related motor protein Eg5 " EXACT []
synonym: "KNSL1" RELATED []
synonym: "TRIP-5" EXACT []
synonym: "TRIP5" RELATED []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003046
name: kinesin-like protein KIF11 isoform 1
def: "A kinesin-like protein KIF1 that is a translation product of a mature transcript of the KIF11 gene. Represented by the sequence UniProtKB:P52732-1." [PRO:AL]
comment: Category=sequence.
is_a: PRO:000003045 ! kinesin-like protein KIF11

[Term]
id: PRO:000003047
name: kinesin-like protein KIF11 isoform 1 phosphorylated form
comment: Category=modification.
is_a: PRO:000003046 ! kinesin-like protein KIF11 isoform 1

[Term]
id: PRO:000003048
name: kinesin-like protein KIF11 isoform 1 phosphorylated 1
def: "A kinesin-like protein KIF11 isoform 1 phosphorylated form that has been phosphorylated by CDK1 during mitosis. Example: UniProtKB:P52732-1, has_modification MOD:00047, Thr-926." [PMID:19001501, PRO:AL]
comment: Category=modification.
is_a: PRO:000003047 ! kinesin-like protein KIF11 isoform 1 phosphorylated form

[Term]
id: PRO:000003049
name: radixin isoform 1 phosphorylated form
comment: Category=modification.
is_a: PRO:000003014 ! radixin isoform 1

[Term]
id: PRO:000003050
name: radixin isoform 1 phosphorylated 1
def: "A radixin isoform 1 phosphorylated form that has been activated though Thr phosphorylation by mitogen-activated protein kinase kinase kinase kinase 4 (Nik). Example: UniProtKB:P26044-1, Thr-564, MOD:00047." [PMID:16938849, PRO:AL]
comment: Category=modification.
synonym: "radixin active form" EXACT []
is_a: PRO:000003049 ! radixin isoform 1 phosphorylated form

[Term]
id: PRO:000003051
name: transmembrane protease, serine 9
def: "A protein that is a translation product of the TMPRSS9 gene." [PRO:CNA]
comment: Category=gene.
synonym: "polyserase-1" EXACT []
synonym: "polyserase-1/TMPRSS9" EXACT []
synonym: "polyserase-I" EXACT []
synonym: "polyserine protease 1" EXACT []
synonym: "TMPRSS9" RELATED []
xref: PIRSF:PIRSF037931
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003052
name: transmembrane protease, serine 9 isoform 1
def: "A transmembrane protease, serine 9 that is a translation product of a mature transcript of the TMPRSS9 gene. Represented by the sequence UniProtKB:Q7Z410-1." [PMID:12886014, PRO:CNA]
comment: Category=sequence.
synonym: "transmembrane protease, serine 9 isoform A" EXACT []
is_a: PRO:000003051 ! transmembrane protease, serine 9

[Term]
id: PRO:000003053
name: transmembrane protease, serine 9 isoform 2
def: "A transmembrane protease, serine 9 that is a translation product of a mature transcript of the TMPRSS9 gene. Represented by the sequence UniProtKB:Q7Z410-2." [PMID:12886014, PRO:CNA]
comment: Category=sequence.
synonym: "transmembrane protease, serine 9 isoform B" EXACT []
is_a: PRO:000003051 ! transmembrane protease, serine 9

[Term]
id: PRO:000003054
name: transmembrane protease, serine 9 isoform 3
def: "A transmembrane protease, serine 9 that is a translation product of a mature transcript of the TMPRSS9 gene. Represented by the sequence UniProtKB:Q0X0F1-1." [PRO:CNA]
comment: Category=sequence.
synonym: "serase-1B" EXACT []
is_a: PRO:000003051 ! transmembrane protease, serine 9

[Term]
id: PRO:000003055
name: transmembrane protease, serine 9 isoform 3 cleaved form
comment: Category=modification.
is_a: PRO:000003054 ! transmembrane protease, serine 9 isoform 3

[Term]
id: PRO:000003056
name: transmembrane protease, serine 9 isoform 3 cleaved 1
def: "A transmembrane protease, serine 9 isoform 3 cleaved form that has been cleaved and activated by trypsin proteolytic cleavage." [PMID:16872279, PRO:CL]
comment: Category=modification.
synonym: "serase-1B active form" EXACT []
synonym: "soluble serase-1B" EXACT []
is_a: PRO:000003055 ! transmembrane protease, serine 9 isoform 3 cleaved form

[Term]
id: PRO:000003057
name: conventional protein kinase C
def: "A protein that is a member of the conventional phorbol ester (and diacylglycerol) receptor/protein kinase class. The canonical protein sequence has a core domain architecture consisting of two copies of the Phorbol esters/diacylglycerol binding domain (C1 domain) (PF00130), followed by a C2 domain (PF00168), a Protein kinase domain (PF00069) and a Protein kinase C terminal domain (PF00433)." [PMID:1877391]
comment: Category=family.
synonym: "cPKC" EXACT []
synonym: "protein kinase C, alpha/beta/gamma types" EXACT []
xref: PIRSF:PIRSF0000550
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003058
name: protein kinase C alpha type
def: "A conventional protein kinase C that is a translation product of the PRKCA gene." [PRO:CL]
comment: Category=gene.
synonym: "PKC-A" EXACT []
synonym: "PKC-alpha" EXACT []
synonym: "PKCA" RELATED []
synonym: "PRKCA" RELATED []
is_a: PRO:000003057 ! conventional protein kinase C

[Term]
id: PRO:000003059
name: protein kinase C beta type
def: "A conventional protein kinase C that is a translation product of the PRKCB gene." [PRO:CNA]
comment: Category=gene.
synonym: "PKC-B" EXACT []
synonym: "PKC-beta" EXACT []
synonym: "PKCB" RELATED []
synonym: "PRKCB" RELATED []
synonym: "PRKCB1" RELATED []
is_a: PRO:000003057 ! conventional protein kinase C

[Term]
id: PRO:000003060
name: protein kinase C gamma type
def: "A conventional protein kinase C that is a translation product of the PRKCG gene." [PRO:CNA]
comment: Category=gene.
synonym: "PKC-gamma" EXACT []
synonym: "PKCG" RELATED []
synonym: "PRKCG" RELATED []
is_a: PRO:000003057 ! conventional protein kinase C

[Term]
id: PRO:000003061
name: CD247 isoform CD3 zeta phosphorylated form
comment: Category=modification.
is_a: PRO:000001029 ! CD247 isoform CD3 zeta

[Term]
id: PRO:000003062
name: CD247 isoform CD3 zeta phosphorylated 1
def: "A CD247 isoform CD3 zeta phosphorylated form that has been phosphorylated on the Tyr residues of the tyrosine-based activation motifs (TAMs also known as Reth motifs), a 15-16 amino acid module containing two tyrosine residues." [PMID:2927501, PMID:7528772, PMID:8195151, PRO:CL]
comment: Category=modification.
synonym: "CD3 zeta activated" EXACT []
synonym: "CD3 zeta active form" EXACT []
is_a: PRO:000003061 ! CD247 isoform CD3 zeta phosphorylated form

[Term]
id: PRO:000003063
name: SYK/ZAP-70 family tyrosine-protein kinase
def: "A protein that is a translation product of the SYK or ZAP70 gene." [PMID:8520027, PMID:9140060, PRO:CNA]
comment: Category=family.
synonym: "tyrosine-protein kinase, SYK/ZAP-70 type" EXACT []
xref: PIRSF:PIRSF000604
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003064
name: tyrosine-protein kinase ZAP-70
def: "A SYK/ZAP-70 family tyrosine-protein kinase that is a translation product of the ZAP70 gene." [PRO:CL]
comment: Category=gene.
synonym: "70 kDa zeta-associated protein" EXACT []
synonym: "SRK" RELATED []
synonym: "syk-related tyrosine kinase" EXACT []
synonym: "ZAP-70" EXACT []
synonym: "ZAP70" RELATED []
is_a: PRO:000003063 ! SYK/ZAP-70 family tyrosine-protein kinase

[Term]
id: PRO:000003065
name: tyrosine-protein kinase SYK
def: "A SYK/ZAP-70 family tyrosine-protein kinase that is a translation product of the SYK gene." [PRO:CNA]
comment: Category=gene.
synonym: "spleen tyrosine kinase" EXACT []
synonym: "SYK" RELATED []
is_a: PRO:000003063 ! SYK/ZAP-70 family tyrosine-protein kinase

[Term]
id: PRO:000003066
name: tyrosine-protein kinase ZAP-70 isoform 1
comment: Category=sequence.
is_a: PRO:000003064 ! tyrosine-protein kinase ZAP-70

[Term]
id: PRO:000003067
name: tyrosine-protein kinase ZAP-70 isoform 1 phosphorylated form
comment: Category=modification.
is_a: PRO:000003066 ! tyrosine-protein kinase ZAP-70 isoform 1

[Term]
id: PRO:000003068
name: tyrosine-protein kinase ZAP-70 isoform 1 phosphorylated 1
def: "A tyrosine-protein kinase ZAP-70 isoform 1 phosphorylated form that phosphorylated on several tyrosine residues through autophosphorylation and transphosphorylation by the Src family tyrosine kinase Lck, following TCR engagement. Tyrosine phosphorylation correlates with increased Zap-70 kinase activity and downstream signaling events. It has been shown that Tyr-319 in the human sequence is required for the positive regulation of ZAP-70 function." [PMID:10037717, PRO:CL]
comment: Category=modification.
synonym: "ZAP-70 activated" EXACT []
synonym: "ZAP-70 active form" EXACT []
is_a: PRO:000003067 ! tyrosine-protein kinase ZAP-70 isoform 1 phosphorylated form

[Term]
id: PRO:000003069
name: CD4 isoform 1
def: "A CD4 that is a translation product of a mature transcript of the CD4 gene. Represented by the sequence UniProtKB:P01730-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000001004 ! CD4

[Term]
id: PRO:000003070
name: CD4 isoform 1 unmodified
def: "A CD4 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000003069 ! CD4 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000003071
name: CD4 isoform 1 phosphorylated form
def: "A CD4 has been post-translationally modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000003069 ! CD4 isoform 1

[Term]
id: PRO:000003072
name: CD4 isoform1 phosphorylated 1
comment: Category=modification.
synonym: "CD4 activated" EXACT []
synonym: "CD4 active form" EXACT []
is_a: PRO:000003071 ! CD4 isoform 1 phosphorylated form

[Term]
id: PRO:000003073
name: signal transducer and activator of transcription 1 isoform 1
def: "A signal transducer and activator of transcription 1 that is a translation product of a mature transcript of the STAT1 gene. Represented by the sequence UniProtKB:P42224-1." [PMID:1502203, PRO:CNA]
comment: Category=sequence.
synonym: "STAT1 alpha" EXACT []
synonym: "STAT1 p91" RELATED []
is_a: PRO:000002087 ! signal transducer and activator of transcription 1

[Term]
id: PRO:000003074
name: signal transducer and activator of transcription 1 isoform 1 unmodified form
def: "A signal transducer and activator of transcription 1 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:CNA]
comment: Category=modification.
synonym: "STAT1 inactive form" EXACT []
intersection_of: PRO:000003073 ! signal transducer and activator of transcription 1 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000003075
name: signal transducer and activator of transcription 1 isoform 1 phosphorylated form
def: "A signal transducer and activator of transcription 1 isoform 1 that has been post-translationally modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000003073 ! signal transducer and activator of transcription 1 isoform 1

[Term]
id: PRO:000003076
name: signal transducer and activator of transcription 1 isoform 1 phosphorylated 1
def: "A signal transducer and activator of transcription 1 isoform 1 phosphorylated form that has been phosphorylated in at a C-terminal Tyr residue located after the SH2 domain by JNK." [PMID:7543024, PRO:CNA]
comment: Category=modification.
synonym: "stat1 alpha active" EXACT []
is_a: PRO:000003075 ! signal transducer and activator of transcription 1 isoform 1 phosphorylated form

[Term]
id: PRO:000003077
name: signal transducer and activator of transcription 1 isoform 2
def: "A signal transducer and activator of transcription 1 that is a translation product of a mature transcript of the STAT1 gene. Represented by the sequence UniProtKB:P42224-2." [PRO:CNA]
comment: Category=sequence.
synonym: "STAT1 beta" EXACT []
synonym: "STAT1 p84" RELATED []
is_a: PRO:000002087 ! signal transducer and activator of transcription 1

[Term]
id: PRO:000003078
name: neuropilin-1 isoform 1
def: "A neuropilin-1 that is a translation product of a mature transcript of the NRP1 gene. Represented by the sequence UniProtKB:O14786-1." [PMID:9529250, PRO:CNA]
comment: Category=sequence.
synonym: "membrane-bound NRP1" EXACT []
is_a: PRO:000001900 ! neuropilin-1

[Term]
id: PRO:000003079
name: neuropilin-1 isoform 2
def: "A neuropilin-1 that is a translation product of a mature transcript of the NRP1 gene. Represented by the sequence UniProtKB:O14786-2." [PMID:10688880, PRO:CNA]
comment: Category=sequence.
synonym: "SNRP1" EXACT []
synonym: "soluble NRP1" EXACT []
is_a: PRO:000001900 ! neuropilin-1

[Term]
id: PRO:000003080
name: neuropilin-1 isoform 1 unmodified form
def: "A neuropilin-1 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000003078 ! neuropilin-1 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000003081
name: neuropilin-1 isoform 1 cleaved and glycosylated form
def: "A neuropilin-1 isoform 1 that has removal of the signal peptide, and has been post-translationally modified to include a glycosylated residue." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000003078 ! neuropilin-1 isoform 1

[Term]
id: PRO:000003082
name: neuropilin-1 isoform 1 cleaved and glycosylated 1
def: "A neuropilin-1 isoform 1 cleaved and glycosylated form that has an heparan sulfate moiety on a Ser residue located in the region between the F5/8 type C domain (PF00754) and the MAM domain (PF00629). Example:UniProtKB:O14786-1, Ser-612, MOD:00215." [PMID:16763549, PRO:JAN]
comment: Category=modification.
is_a: PRO:000003081 ! neuropilin-1 isoform 1 cleaved and glycosylated form

[Term]
id: PRO:000003083
name: neuropilin-1 isoform 1 cleaved and glycosylated 2
def: "A neuropilin-1 isoform 1 cleaved and glycosylated form that has a chondroitin sulfate moiety on a Ser residue located in the region between the F5/8 type C domain (PF00754) and the MAM domain (PF00629). Example:UniProtKB:O14786-1, Ser-612, MOD:00213." [PMID:16763549, PRO:JAN]
comment: Category=modification.
is_a: PRO:000003081 ! neuropilin-1 isoform 1 cleaved and glycosylated form

[Term]
id: PRO:000003084
name: Bcl2 antagonist of cell death isoform 1 phosphorylated form
def: "A Bcl2 antagonist of cell death isoform 1 that has been post-translationally modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000002280 ! Bcl2 antagonist of cell death isoform 1

[Term]
id: PRO:000003085
name: Bcl2 antagonist of cell death isoform 1 phosphorylated 1
def: "A Bcl2 antagonist of cell death isoform 1 phosphorylated form that has been phosphorylated in two Ser residues which are the major sites of phosphorylation by MAPK and AKT signaling. Phosphorylation on these residues favors binding to 14-3-3 proteins. Example: UniProtKB:Q61337-1, Ser-112/Ser-136, MOD:00046." [PMID:10949026, PMID:8929531, PMID:9346240, PRO:JAN]
comment: Category=modification.
synonym: "p112p136BAD" EXACT []
is_a: PRO:000003084 ! Bcl2 antagonist of cell death isoform 1 phosphorylated form

[Term]
id: PRO:000003086
name: Bcl2 antagonist of cell death isoform 1 phosphorylated 2
def: "A Bcl2 antagonist of cell death isoform 1 phosphorylated form that has been phosphorylated in two Ser residues which are the major sites of phosphorylation by MAPK and AKT signaling, and a Ser residue within the BH3 domain, which is the major protein kinase A phosphorylation site. Phosphorylation on these residues favors binding to 14-3-3 proteins. Example: UniProtKB:Q61337-1,Ser-112/Ser-136/Ser-155, MOD:00046." [PMID:10880354, PMID:10949026, PRO:JAN]
comment: Category=modification.
synonym: "inactive BAD" EXACT []
is_a: PRO:000003084 ! Bcl2 antagonist of cell death isoform 1 phosphorylated form

[Term]
id: PRO:000003087
name: Bcl2 antagonist of cell death isoform 1 phosphorylated 3
def: "A Bcl2 antagonist of cell death isoform 1 phosphorylated form that has been phosphorylated by activation of the MAPK pathway. Phosphorylation on this residue favors binding to 14-3-3 proteins. Example: UniProtKB:Q61337-1,Ser-112, MOD:00046." [PMID:10195903, PMID:10597268, PRO:JAN]
comment: Category=modification.
is_a: PRO:000003084 ! Bcl2 antagonist of cell death isoform 1 phosphorylated form

[Term]
id: PRO:000003088
name: apoptosis regulator Bcl-2 isoform 1 phosphorylated form
def: "An apoptosis regulator Bcl-2 isoform 1 that has been post-translationally modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000002383 ! apoptosis regulator Bcl-2 isoform 1

[Term]
id: PRO:000003089
name: apoptosis regulator Bcl-2 isoform 1 phosphorylated 1
def: "An apoptosis regulator Bcl-2 isoform 1 phosphorylated form that has been phosphorylated by PKC. Example: UniProtKB:P10417-1, Ser-70, MOD:00046." [PMID:9115213, PMID:9852076, PRO:JAN]
comment: Category=modification.
is_a: PRO:000003088 ! apoptosis regulator Bcl-2 isoform 1 phosphorylated form

[Term]
id: PRO:000003090
name: cyclin-dependent kinase inhibitor 1B
def: "A protein that is a translation product of the CDKN1B gene." [PRO:CNA]
comment: Category=gene.
synonym: "CDKN1B" RELATED []
synonym: "cyclin-dependent kinase inhibitor p27 " EXACT []
synonym: "KIP1" RELATED []
synonym: "p27Kip1" EXACT []
xref: PIRSF:PIRSF018555
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003091
name: cyclin-dependent kinase inhibitor 1B isoform 1
def: "A cyclin-dependent kinase inhibitor 1B that is a translation product of a mature transcript of the CDKN1B gene. Represented by the sequence UniProtKB:P46527-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000003090 ! cyclin-dependent kinase inhibitor 1B

[Term]
id: PRO:000003092
name: cyclin-dependent kinase inhibitor 1B isoform 1 unmodified form
def: "A cyclin-dependent kinase inhibitor 1B isoform that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:JAN]
comment: Category=modification.
intersection_of: PRO:000003091 ! cyclin-dependent kinase inhibitor 1B isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000003093
name: cyclin-dependent kinase inhibitor 1B isoform 1 phosphorylated form
def: "A cyclin-dependent kinase inhibitor 1B isoform 1 that has been post-translationally modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000003091 ! cyclin-dependent kinase inhibitor 1B isoform 1

[Term]
id: PRO:000003094
name: cyclin-dependent kinase inhibitor 1B isoform 1 phosphorylated 1
def: "A cyclin-dependent kinase inhibitor 1B isoform 1 phosphorylated form that has been phosphorylated within the nuclear localization sequence (NLS)." [PMID:15057270, PRO:JAN]
comment: Category=modification.
synonym: "p27 phosphorylated form" RELATED []
synonym: "p27NLS" EXACT []
is_a: PRO:000003093 ! cyclin-dependent kinase inhibitor 1B isoform 1 phosphorylated form

[Term]
id: PRO:000003095
name: neuropilin-1 isoform 1 cleaved form
def: "A neuropilin-1 isoform 1 that has removal of the signal peptide." [PRO:JAN]
comment: Category=modification.
intersection_of: PRO:000003078 ! neuropilin-1 isoform 1
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000003096
name: vascular endothelial growth factor B
def: "A protein that is a translation product of the VEGFB gene." [PRO:CNA]
comment: Category=gene.
synonym: "VEGF-B " EXACT []
synonym: "VEGF-related factor" EXACT []
synonym: "VEGFB " RELATED []
synonym: "VRF" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003097
name: vascular endothelial growth factor B isoform 1
def: "A vascular endothelial growth factor B that is a translation product of a mature transcript of the VEGFB gene. Represented by the sequence UniProtKB:P49765-1." [PRO:CNA]
comment: Category=sequence.
synonym: "VEGF-B186" EXACT []
is_a: PRO:000003096 ! vascular endothelial growth factor B

[Term]
id: PRO:000003098
name: vascular endothelial growth factor B isoform 1 unmodified form
def: "A vascular endothelial growth factor B isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:CNA]
comment: Category=modification.
synonym: "VEGFB precursor" EXACT []
intersection_of: PRO:000003097 ! vascular endothelial growth factor B isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000003099
name: vascular endothelial growth factor B isoform 1 cleaved form
def: "A vascular endothelial growth factor B isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000003097 ! vascular endothelial growth factor B isoform 1
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000003100
name: vascular endothelial growth factor B isoform 1 cleaved 1
def: "A vascular endothelial growth factor B isoform 1 cleaved form product of proteolytic cleavage yielding the N-terminal cystine knot domain." [PMID:10409677, PRO:CNA]
comment: Category=modification.
is_a: PRO:000003099 ! vascular endothelial growth factor B isoform 1 cleaved form

[Term]
id: PRO:000003101
name: vascular endothelial growth factor B isoform 2
def: "A vascular endothelial growth factor B that is a translation product of a mature transcript of the VEGFB gene. Represented by the sequence UniProtKB:P49765-2." [PRO:CNA]
comment: Category=sequence.
synonym: "VEGF-B167" EXACT []
is_a: PRO:000003096 ! vascular endothelial growth factor B

[Term]
id: PRO:000003102
name: RAC-alpha serine/threonine-protein kinase isoform 1 phosphorylated form
def: "A RAC-alpha serine/threonine-protein kinase isoform 1 that has been post-translationally modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000002286 ! RAC-alpha serine/threonine-protein kinase isoform 1

[Term]
id: PRO:000003103
name: RAC-alpha serine/threonine-protein kinase isoform 1 phosphorylated 1
def: "A RAC-alpha serine/threonine-protein kinase isoform 1 phosphorylated form that is an active kinase form. Example: UniProtKB:P31749-1,Thr-308, MOD:00047|Ser-473,  MOD:00046." [PID:cd8tcrpathway\, tcrpathway\, ptp1bpathway\, pi3kciaktpathway, PMID:12586360, PRO:JAN]
comment: Category=modification.
synonym: "Akt1 active form" EXACT []
is_a: PRO:000003102 ! RAC-alpha serine/threonine-protein kinase isoform 1 phosphorylated form

[Term]
id: PRO:000003104
name: 14-3-3 epsilon
def: "A protein that is a translation product of the YWHAE gene." [PRO:CNA]
comment: Category=gene.
synonym: "14-3-3E" EXACT []
synonym: "YWHAE" RELATED []
is_a: PRO:000003237 ! 14-3-3 protein

[Term]
id: PRO:000003105
name: 14-3-3 protein epsilon isoform 1
def: "A 14-3-3 protein epsilon that is a translation product of a mature transcript of the YWHAE gene. Represented by the sequence UniProtKB:P62258-1." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000003104 ! 14-3-3 epsilon

[Term]
id: PRO:000003106
name: map kinase p38
def: "A protein that is a serine/threonine-specific protein kinase that responds to extracellular stimuli ( environmental stress, pro-inflammatory cytokines and lipopolysaccharide) and regulates cellular activities such as gene expression, mitosis, differentiation, and cell survival/apoptosis. The activated form phosphorylates target substrates on Ser or Thr residues followed by a proline. A distinguishing feature is the conserved sequence TxY." [PRO:CNA]
comment: Category=family.
xref: PIRSF:PIRSF500943
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003107
name: mitogen-activated protein kinase 14
def: "A protein that is a translation product of the MAPK14 gene." [PRO:CNA]
comment: Category=gene.
synonym: "CSAID-binding protein " RELATED []
synonym: "CSBP" RELATED []
synonym: "CSBP1 " RELATED []
synonym: "CSBP2" RELATED []
synonym: "cytokine suppressive anti-inflammatory drug-binding protein" EXACT []
synonym: "MAP kinase MXI2" RELATED []
synonym: "MAP kinase p38 alpha " EXACT []
synonym: "MAPK14" RELATED []
synonym: "MAX-interacting protein 2" RELATED []
synonym: "mitogen-activated protein kinase p38 alpha" EXACT []
synonym: "MXI2" RELATED []
is_a: PRO:000003106 ! map kinase p38

[Term]
id: PRO:000003108
name: mitogen-activated protein kinase 14 phosphorylated form
def: "A mitogen-activated protein kinase 14 that has been post-translationally modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000003107 ! mitogen-activated protein kinase 14

[Term]
id: PRO:000003109
name: mitogen-activated protein kinase 14 phosphorylated 1
def: "A mitogen-activated protein kinase 14 phosphorylated form that has been activated  by Thr and Tyr phosphorylation within the TxY motif." [PMID:15642743]
comment: Category=modification.
synonym: "MAPK p38 active form" EXACT []
synonym: "MAPK p38T180P-Y182P" EXACT []
is_a: PRO:000003108 ! mitogen-activated protein kinase 14 phosphorylated form

[Term]
id: PRO:000003110
name: TGF-beta receptor type-3
def: "A protein that is a translation product of the TGFBR3 gene." [PRO:CNA]
comment: Category=gene.
synonym: "betaglycan" EXACT []
synonym: "TGF-beta receptor type III" EXACT []
synonym: "TGFBR-3 " EXACT []
synonym: "TGFBR3" RELATED []
synonym: "transforming growth factor beta receptor III" EXACT []
xref: PIRSF:PIRSF002558
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003111
name: TGF-beta receptor type-3 isoform 1
comment: Category=sequence.
is_a: PRO:000003110 ! TGF-beta receptor type-3

[Term]
id: PRO:000003112
name: NFAT protein
def: "A protein that contains a Rel homology domain (RHD) (PF00554) followed by a IPT/TIG domain (PF01833)." [PANTHER:PTHR12533]
comment: Category=family.
xref: PANTHER:PTHR12533
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003113
name: nuclear factor of activated T-cells, cytoplasmic 1
def: "An NFAT protein that is a translation product of the NFATC1 gene." [PRO:CNA]
comment: Category=gene.
synonym: "NF-ATc " EXACT []
synonym: "NFAT transcription complex cytosolic component       " EXACT []
synonym: "NFAT2" RELATED []
synonym: "NFATC" RELATED []
synonym: "NFATC-1" EXACT []
is_a: PRO:000003112 ! NFAT protein

[Term]
id: PRO:000003114
name: nuclear factor of activated T-cells, cytoplasmic 1 isoform 1
def: "A nuclear factor of activated T-cells, cytoplasmic 1 that is a translation product of a mature transcript of the NFATC1 gene. Represented by the sequence UniProtKB:O95644-1." [PMID:8202141, PRO:JAN]
comment: Category=sequence.
synonym: "NFATC1 A-alpha" EXACT []
synonym: "NFATC1-alpha" EXACT []
synonym: "nuclear factor of activated T-cells, cytoplasmic A alpha" EXACT []
is_a: PRO:000003113 ! nuclear factor of activated T-cells, cytoplasmic 1

[Term]
id: PRO:000003115
name: nuclear factor of activated T-cells, cytoplasmic 1 isoform 1 unmodified form
def: "A nuclear factor of activated T-cells, cytoplasmic 1 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:JAN]
comment: Category=modification.
intersection_of: PRO:000003114 ! nuclear factor of activated T-cells, cytoplasmic 1 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000003116
name: nuclear factor of activated T-cells, cytoplasmic 1 isoform 1 phosphorylated 1
def: "A nuclear factor of activated T-cells, cytoplasmic 1 isoform 1 phosphorylated form that has been phosphorylated in the calcineurin targeting domain by the c-Jun NH2-terminal kinase (JNK). Example:UniProtKB:O95644-1, Ser-117/Ser-172,  MOD:00046." [PMID:10866678, PRO:JAN]
comment: Category=modification.
is_a: PRO:000003117 ! nuclear factor of activated T-cells, cytoplasmic 1 isoform 1 phosphorylated form

[Term]
id: PRO:000003117
name: nuclear factor of activated T-cells, cytoplasmic 1 isoform 1 phosphorylated form
def: "A nuclear factor of activated T-cells, cytoplasmic 1 isoform 1 that has been post-translationally modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000003114 ! nuclear factor of activated T-cells, cytoplasmic 1 isoform 1

[Term]
id: PRO:000003118
name: proto-oncogene vav
def: "A protein that is a translation product of the VAV1 gene. Couples tyrosine kinase signals with the activation of the Rho/Rac GTPases, thus leading to cell differentiation and/or proliferation." [PRO:CL, UniProtKB:P15498]
comment: Category=gene.
synonym: "p95vav" EXACT []
synonym: "VAV" RELATED []
synonym: "VAV1" RELATED []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003119
name: baculoviral IAP repeat-containing protein 4
def: "A protein that is a translation product of the XIAP gene. Potent negative regulator of apoptosis." [PRO:CNA]
comment: Category=gene.
synonym: "API3" RELATED []
synonym: "BIRC4" RELATED []
synonym: "E3 ubiquitin-protein ligase XIAP" EXACT []
synonym: "HILP" EXACT []
synonym: "IAP-like protein" EXACT []
synonym: "IAP3" RELATED []
synonym: "inhibitor of apoptosis protein 3 " EXACT []
synonym: "X-linked inhibitor of apoptosis protein " EXACT []
synonym: "XIAP" RELATED []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003120
name: baculoviral IAP repeat-containing protein 4 isoform 1
def: "A baculoviral IAP repeat-containing protein 4 that is a translation product of a mature transcript of the XIAP gene. Represented by the sequence UniProtKB:P98170-1." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000003119 ! baculoviral IAP repeat-containing protein 4

[Term]
id: PRO:000003121
name: baculoviral IAP repeat-containing protein 4 isoform 1 unmodified form
def: "A baculoviral IAP repeat-containing protein 4 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:JAN]
comment: Category=modification.
intersection_of: PRO:000003120 ! baculoviral IAP repeat-containing protein 4 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000003122
name: baculoviral IAP repeat-containing protein 4 isoform 1 phosphorylated form
def: "A baculoviral IAP repeat-containing protein 4 isoform 1 that has been post-translationally modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000003120 ! baculoviral IAP repeat-containing protein 4 isoform 1

[Term]
id: PRO:000003123
name: baculoviral IAP repeat-containing protein 4 isoform 1 phosphorylated 1
def: "A baculoviral IAP repeat-containing protein 4 isoform 1 phosphorylated form that has been phosphorylated in a Ser residue by AKT kinase, AKT1 or AKT2. Example:UniProtKB:P98170-1, Ser-87, MOD:00046." [PMID:14645242, PRO:JAN]
comment: Category=modification.
is_a: PRO:000003122 ! baculoviral IAP repeat-containing protein 4 isoform 1 phosphorylated form

[Term]
id: PRO:000003124
name: Bcl-2-binding component 3
def: "A protein that is a translation product of the BBC3 gene." [PRO:JAN]
comment: Category=gene.
synonym: "BBC3" RELATED []
synonym: "JFY-1" EXACT []
synonym: "p53 up-regulated modulator of apoptosis " EXACT []
synonym: "PUMA" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003125
name: Bcl-2-binding component 3 isoform 1
def: "A Bcl-2-binding component 3 that is a translation product of a mature transcript of the BBC3 gene. Represented by the sequence UniProtKB:Q9BXH1-1." [PMID:11463391, PMID:11463392, PRO:JAN]
comment: Category=sequence.
synonym: "puma-alpha" EXACT []
is_a: PRO:000003124 ! Bcl-2-binding component 3

[Term]
id: PRO:000003126
name: Bcl-2-binding component 3 isoform 2
def: "A Bcl-2-binding component 3 that is a translation product of a mature transcript of the BBC3 gene. Represented by the sequence UniProtKB:Q9BXH1-2." [PMID:11463392, PRO:JAN]
comment: Category=sequence.
synonym: "puma-beta" RELATED []
is_a: PRO:000003124 ! Bcl-2-binding component 3

[Term]
id: PRO:000003127
name: baculoviral IAP repeat-containing protein 7
def: "A protein that is a translation product of the BIRC7 gene." [PRO:CNA]
comment: Category=gene.
synonym: "KIAP" EXACT []
synonym: "kidney inhibitor of apoptosis protein" EXACT []
synonym: "livin" EXACT []
synonym: "melanoma inhibitor of apoptosis protein" RELATED []
synonym: "ML-IAP" EXACT []
synonym: "MLIAP" RELATED []
synonym: "RING finger protein 50" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003128
name: baculoviral IAP repeat-containing protein 7 isoform 1
def: "A baculoviral IAP repeat-containing protein 7 that is a translation product of a mature transcript of the BIRC7 gene. Represented by the sequence UniProtKB:Q96CA5-2." [PMID:11084335, PRO:JAN]
comment: Category=sequence.
synonym: "livin beta" EXACT []
synonym: "ML-IAP short isoform" EXACT []
is_a: PRO:000003127 ! baculoviral IAP repeat-containing protein 7

[Term]
id: PRO:000003129
name: baculoviral IAP repeat-containing protein 7 isoform 2
def: "A baculoviral IAP repeat-containing protein 7 that is a translation product of a mature transcript of the BIRC7 gene. Represented by the sequence UniProtKB:Q96CA5-1." [PRO:JAN]
comment: Category=sequence.
synonym: "livin alpha" EXACT []
is_a: PRO:000003127 ! baculoviral IAP repeat-containing protein 7

[Term]
id: PRO:000003130
name: diablo homolog, mitochondrial
def: "A protein that is a translation product of the DIABLO gene." [PRO:CNA]
comment: Category=gene.
synonym: "diablo" EXACT []
synonym: "direct IAP-binding protein with low pI" EXACT []
synonym: "second mitochondria-derived activator of caspase" EXACT []
synonym: "SMAC" RELATED []
synonym: "SMAC protein" RELATED []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003131
name: diablo homolog, mitochondrial isoform 1
def: "A diablo homolog, mitochondrial that is a translation product of a mature transcript of the DIABLO gene. Represented by the sequence UniProtKB:Q9NR28-1." [PRO:JAN]
comment: Category=sequence.
is_a: PRO:000003130 ! diablo homolog, mitochondrial

[Term]
id: PRO:000003132
name: diablo homolog, mitochondrial isoform 2
def: "A diablo homolog, mitochondrial that is a translation product of a mature transcript of the DIABLO gene. Represented by the sequence UniProtKB:Q9NR28-2." [PRO:JAN]
comment: Category=sequence.
synonym: "diablo short isoform" EXACT []
synonym: "diablo-S" EXACT []
is_a: PRO:000003130 ! diablo homolog, mitochondrial

[Term]
id: PRO:000003133
name: diablo homolog, mitochondrial isoform 1 unmodified form
def: "A diablo homolog, mitochondrial isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:CNA]
comment: Category=modification.
synonym: "diablo precursor" EXACT []
intersection_of: PRO:000003131 ! diablo homolog, mitochondrial isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000003134
name: diablo homolog, mitochondrial isoform 1 cleaved form
def: "A diablo homolog, mitochondrial isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000003131 ! diablo homolog, mitochondrial isoform 1
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000003135
name: diablo homolog, mitochondrial isoform 1 cleaved 1
def: "A diablo homolog, mitochondrial isoform 1 cleaved whose mitochondrial transit peptide has been removed." [PRO:JAN]
comment: Category=modification.
synonym: "diablo mature" EXACT []
is_a: PRO:000003134 ! diablo homolog, mitochondrial isoform 1 cleaved form

[Term]
id: PRO:000003136
name: subtilisin/kexin-type proprotein convertase
comment: Category=family.
xref: PIRSF:PIRSF001179
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003137
name: furin
def: "A subtilisin/kexin-type proprotein convertase that is a translation product of the FURIN gene." [PRO:CNA]
comment: Category=gene.
synonym: "dibasic-processing enzyme" EXACT []
synonym: "FUR" RELATED []
synonym: "PACE" EXACT []
synonym: "paired basic amino acid residue cleaving enzyme" EXACT []
synonym: "PCSK3" RELATED []
is_a: PRO:000003136 ! subtilisin/kexin-type proprotein convertase

[Term]
id: PRO:000003138
name: TNF receptor-associated factor 6 isoform 1 ubiquitinated form
def: "A TNF receptor-associated factor 6 isoform 1 that has been post-translationally modified to include a ubiquitinated residue." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000002381 ! TNF receptor-associated factor 6 isoform 1
intersection_of: has_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000003139
name: TNF receptor-associated factor 6 isoform 1 ubiquitinated 1
def: "A TNF receptor-associated factor 6 isoform 1 ubiquitinated form that is a major product of auto-ubiquitination. The ubiquitinated Lys residue is located downstream the RING domain. Example: UniProtKB:P70196-1, Lys-124, MOD:01148." [PMID:17135271, TLRs:AMM]
comment: Category=modification.
is_a: PRO:000003138 ! TNF receptor-associated factor 6 isoform 1 ubiquitinated form

[Term]
id: PRO:000003140
name: protein pellino
def: "A protein that is the stand-alone version of the Pellino (PF04710) domain. Pellino is involved in Toll-like signalling pathways, and associates with the kinase domain of the Pelle Ser/Thr kinase." [Pfam:PF04710]
comment: Category=family.
xref: PANTHER:PTHR12098
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003141
name: protein pellino homolog 1
def: "A protein pellino that is a translation product of the PELI1 gene." [PRO:CNA]
comment: Category=gene.
synonym: "PELI1" RELATED []
synonym: "pellino-1" EXACT []
is_a: PRO:000003140 ! protein pellino

[Term]
id: PRO:000003142
name: protein pellino homolog 1 isoform 1
def: "A protein pellino homolog 1 that is a translation product of a mature transcript of the PELI1 gene. Represented by the sequence UniProtKB:Q8C669-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000003141 ! protein pellino homolog 1

[Term]
id: PRO:000003143
name: protein pellino homolog 1 isoform 1 unmodified form
def: "A protein pellino homolog 1 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000003142 ! protein pellino homolog 1 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000003144
name: protein pellino homolog 1 isoform 1 phosphorylated form
def: "A protein pellino homolog 1 isoform 1 that has been post-translationally modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000003142 ! protein pellino homolog 1 isoform 1

[Term]
id: PRO:000003145
name: protein pellino homolog 1 isoform 1 phosphorylated 1
def: "A protein pellino homolog 1 isoform 1 phosphorylated for that has been phosphorylated at the seven residues whose phosphorylation are critical for activation. Five of these residues are located in the region of antiparallel beta-sheet, termed the wing; whereas the other two are just N-terminal to the RING-like domain that carries the E3 ligase activity." [PMID:19264966, TLRs:AMM]
comment: Category=modification.
synonym: "pellino 1 active" EXACT []
synonym: "protein pellino homolog 1 phosphorylated" EXACT []
is_a: PRO:000003144 ! protein pellino homolog 1 isoform 1 phosphorylated form

[Term]
id: PRO:000003146
name: TRAF family member-associated NF-kappa-B activator
def: "A protein that is a translation product of the TANK gene." [PRO:CNA]
comment: Category=gene.
synonym: "i-TRAF" EXACT []
synonym: "ITRAF" EXACT []
synonym: "TANK" EXACT []
synonym: "TRAF-interacting protein" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003147
name: furin isoform 1
def: "A furin that is a translation product of a mature transcript of the FURIN gene. Represented by the sequence UniProtKB:P09958-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000003137 ! furin

[Term]
id: PRO:000003148
name: furin isoform 1 unmodified form
def: "A furin isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:CNA]
comment: Category=modification.
synonym: "furin precursor" EXACT []
intersection_of: PRO:000003147 ! furin isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000003149
name: furin isoform 1 cleaved form
def: "A furin isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000003147 ! furin isoform 1
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000003150
name: furin isoform 1 cleaved 1
def: "A furin isoform 1 cleaved form whose signal peptide and inhibition peptide have been removed." [Reactome:REACT_4414.2]
comment: Category=modification.
synonym: "mature furin" EXACT []
is_a: PRO:000003149 ! furin isoform 1 cleaved form

[Term]
id: PRO:000003151
name: furin isoform 1 cleaved and phosphorylated form
def: "A furin isoform 1 that has been processed by proteolytic cleavage and has been post-translationally modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000003147 ! furin isoform 1

[Term]
id: PRO:000003152
name: furin isoform 1 cleaved and phosphorylated 1
def: "A furin cleaved and phosphorylated form that is the mature protein that has been phosphorylated in two Ser residues located in the acid cytoplasmic tail. Phosphorylation of mature furin is required for TGN localization of the endoprotease. Example:P09958-1 (108-794), Ser-773/Ser-775, MOD:00046." [PMID:8846780, UniProtKB:P09958]
comment: Category=modification.
synonym: "furin mature phosphorylated" EXACT []
is_a: PRO:000003151 ! furin isoform 1 cleaved and phosphorylated form

[Term]
id: PRO:000003153
name: UBA domain-containing ubiquitin-conjugating enzyme E2
def: "A protein that contains one copy of the Ubiquitin-conjugating enzyme (PF00179) domain at the N-terminus. The active protein catalyzes the covalent attachment of ubiquitin to other proteins." [PMID:17034365, PMID:8530467]
comment: Category=family.
synonym: "E2 conjugating enzyme" EXACT []
synonym: "ubc" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003154
name: ubiquitin-conjugating enzyme E2 D3
def: "A UBA domain-containing ubiquitin-conjugating enzyme E2 that is a translation product of the UBE2D3 gene." [PRO:CNA]
comment: Category=gene.
synonym: "E2(17)KB 3" EXACT []
synonym: "UBCH5C" EXACT []
synonym: "ubiquitin carrier protein D3" EXACT []
synonym: "ubiquitin-conjugating enzyme E2-17 kDa 3" EXACT []
synonym: "ubiquitin-protein ligase D3" EXACT []
is_a: PRO:000003153 ! UBA domain-containing ubiquitin-conjugating enzyme E2

[Term]
id: PRO:000003155
name: ubiquitin-conjugating enzyme E2 D3 isoform 1
def: "A ubiquitin-conjugating enzyme E2 D3 that is a translation product of a mature transcript of the UBE2D3 gene. Represented by the sequence UniProtKB:P61077-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000003154 ! ubiquitin-conjugating enzyme E2 D3

[Term]
id: PRO:000003156
name: ubiquitin-conjugating enzyme E2 D1
def: "A UBA domain-containing ubiquitin-conjugating enzyme E that is a translation product of the UBE2D1 gene." [PRO:CNA]
comment: Category=gene.
synonym: "E2(17)KB 1" EXACT []
synonym: "SFT" EXACT []
synonym: "stimulator of Fe transport" EXACT []
synonym: "UBC4/5 homolog" EXACT []
synonym: "ubcH5" EXACT []
synonym: "UBCH5" EXACT []
synonym: "UBCH5A" EXACT []
synonym: "ubiquitin carrier protein D1" EXACT []
synonym: "ubiquitin-conjugating enzyme E2-17 kDa 1" EXACT []
synonym: "ubiquitin-protein ligase D1" EXACT []
is_a: PRO:000003153 ! UBA domain-containing ubiquitin-conjugating enzyme E2

[Term]
id: PRO:000003157
name: ubiquitin-conjugating enzyme E2 D1 isoform 1
def: "A ubiquitin-conjugating enzyme E2 D1 that is a translation product of a mature transcript of the UBE2D1 gene. Represented by the sequence UniProtKB:P51668-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000003156 ! ubiquitin-conjugating enzyme E2 D1

[Term]
id: PRO:000003158
name: mitogen-activated protein kinase kinase kinase 7
def: "A protein that is a translation product of the MAP3K7 gene." [PRO:CNA]
comment: Category=gene.
synonym: "TAK1" EXACT []
synonym: "TGF-beta-activated kinase 1" EXACT []
synonym: "transforming growth factor-beta-activated kinase 1" EXACT []
xref: PIRSF: PIRSF038168
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003159
name: mitogen-activated protein kinase kinase kinase 7 isoform 1
def: "A mitogen-activated protein kinase kinase kinase 7 that is a translation product of a mature transcript of the MAP3K7 gene. Represented by the sequence UniProtKB:Q62073-1." [PMID:8533096]
comment: Category=sequence.
synonym: "TAK1 isoform 1A" EXACT []
is_a: PRO:000003158 ! mitogen-activated protein kinase kinase kinase 7

[Term]
id: PRO:000003160
name: mitogen-activated protein kinase kinase kinase 7 isoform 1 unmodified form
def: "A mitogen-activated protein kinase kinase kinase 7 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000003159 ! mitogen-activated protein kinase kinase kinase 7 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000003161
name: mitogen-activated protein kinase kinase kinase 7 isoform 1 ubiquitinated form
def: "A mitogen-activated protein kinase kinase kinase 7 isoform 1 that has been post-translationally modified to include ubiquitin chain." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000003159 ! mitogen-activated protein kinase kinase kinase 7 isoform 1

[Term]
id: PRO:000003162
name: mitogen-activated protein kinase kinase kinase 7 isoform 1 ubiquitinated 1
def: "A mitogen-activated protein kinase kinase kinase 7 isoform 1 ubiquitinated form that has been modified by XIAP. This leads to proteosomal degradation of mitogen-activated protein kinase kinase kinase 7 isoform 1." [PMID:16157589]
comment: Category=modification.
is_a: PRO:000003161 ! mitogen-activated protein kinase kinase kinase 7 isoform 1 ubiquitinated form

[Term]
id: PRO:000003163
name: transforming growth factor-beta receptor-associated protein 1
def: "A protein that is a translation product of the TGFBRAP1 gene." [PRO:CNA]
comment: Category=gene.
synonym: "TGF-beta receptor-associated protein 1" EXACT []
synonym: "TGFBRAP1" RELATED []
synonym: "TRAP-1" EXACT []
synonym: "TRAP1" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003164
name: transforming growth factor-beta receptor-associated protein 1 isoform 1
def: "A transforming growth factor-beta receptor-associated protein 1 that is a translation product of a mature transcript of the TGFBRAP1 gene. Represented by the sequence UniProtKB:Q8WUH2-1." [PMID:11278302]
comment: Category=sequence.
is_a: PRO:000003163 ! transforming growth factor-beta receptor-associated protein 1

[Term]
id: PRO:000003165
name: spectrin beta subunit
def: "A protein that is the beta subunit of spectrin. Spectrin is a tetrameric actin-crosslinking protein which contains two alpha and two beta subunits. Spectrins are involved in the support of general membrane integrity, stabilization of cell-cell interactions, axonal growth, normal functioning of the Golgi complex and organization of synaptic vesicles." [PIRSF: PIRSF002297]
comment: Category=family.
xref: PIRSF:PIRSF002297
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003166
name: spectrin beta chain, brain 1
def: "A spectrin beta subunit that is a translation product of the SPTBN1 gene." [PRO:CNA]
comment: Category=gene.
synonym: "beta-II spectrin" EXACT []
synonym: "ELF" EXACT []
synonym: "fodrin beta chain" EXACT []
synonym: "spectrin, non-erythroid beta chain 1" EXACT []
synonym: "SPTB2" RELATED []
synonym: "SPTBN1" RELATED []
is_a: PRO:000003165 ! spectrin beta subunit

[Term]
id: PRO:000003167
name: spectrin beta chain, brain 1 isoform 1
def: "A spectrin beta chain, brain 1 that is a translation product of a mature transcript of the SPTBN1 gene. Represented by the sequence UniProtKB:Q01082-1." [PMID:1527002]
comment: Category=sequence.
synonym: "elf isoform Long" EXACT []
is_a: PRO:000003166 ! spectrin beta chain, brain 1

[Term]
id: PRO:000003168
name: spectrin beta chain, brain 1 phosphorylated form
def: "A spectrin beta chain, brain 1 that has been post-translationally modified to include a phosphorylated residue." [PMID:12543979, PRO:CNA]
comment: Category=modification.
is_a: PRO:000003166 ! spectrin beta chain, brain 1

[Term]
id: PRO:000003169
name: spectrin beta chain, brain 1 isoform 2
def: "A spectrin beta chain, brain 1 that is a translation product of a mature transcript of the SPTBN1 gene. Represented by the sequence UniProtKB:Q01082-2." [PRO:CNA]
comment: Category=sequence.
synonym: "elf isoform short" RELATED []
is_a: PRO:000003166 ! spectrin beta chain, brain 1

[Term]
id: PRO:000003170
name: spectrin beta chain, brain 1 isoform 3
def: "A spectrin beta chain, brain 1 that is a translation product of a mature transcript of the SPTBN1 gene. Represented by the sequence UniProtKB:Q01082-3." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000003166 ! spectrin beta chain, brain 1

[Term]
id: PRO:000003171
name: IGFBP-related protein
comment: Category=family.
xref: PIRSF:PIRSF036495
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003172
name: connective tissue growth factor
def: "An IGFBP-related protein that is a translation product of the CTGF gene." [PRO:CNA]
comment: Category=gene.
synonym: "CCN2" RELATED []
synonym: "CTGF" RELATED []
synonym: "HCS24" RELATED []
synonym: "hypertrophic chondrocyte-specific protein 24" EXACT []
synonym: "IGFBP8" RELATED []
synonym: "NOV2" RELATED []
is_a: PRO:000003171 ! IGFBP-related protein

[Term]
id: PRO:000003173
name: TGF-beta receptor type-1 isoform 1 cleaved, phosphorylated and ubiquitinated form
def: "A TGF-beta receptor type-1 isoform 1 whose signal peptide has been removed, and is post-translationally modified to include phosphorylated and ubiquitinated residues." [PID:TGFB/TGFBR2/TGFBR1/WWP1/SMAD8, PRO:CNA]
comment: Category=modification.
synonym: "TGFBR1 inactive" EXACT []
is_a: PRO:000000185 ! TGF-beta receptor type-1 isoform 1

[Term]
id: PRO:000003174
name: NEDD4-like E3 ubiquitin-protein ligase WWP1
def: "A protein that is a translation product of the WWP1 gene." [PRO:CNA]
comment: Category=gene.
synonym: "AIP5" EXACT []
synonym: "atrophin-1-interacting protein 5" EXACT []
synonym: "WW domain-containing protein 1" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003175
name: TGF-beta receptor type-2 isoform 1 cleaved and phosphorylated form
def: "A TGF-beta receptor type-2 isoform that has been processed to a mature protein by removal of the signal peptide, and has been postranslationally modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000000048 ! TGF-beta receptor type-2 isoform 1

[Term]
id: PRO:000003176
name: TGF-beta receptor type-2 isoform 1 cleaved and phosphorylated 1
def: "TGF-beta receptor type-2 isoform 1 cleaved and phosphorylated that has been activated through the TGF-beta signaling pathway. Example:UniProtKB:P37173, Ser-213/Ser- 409, MOD:00046, Tyr-259/Tyr-336/Tyr-424, MOD:00048." [PID:TGFB/TGFBR2/TGFBR1]
comment: Category=modification.
is_a: PRO:000003175 ! TGF-beta receptor type-2 isoform 1 cleaved and phosphorylated form

[Term]
id: PRO:000003177
name: shc-transforming protein
def: "A protein that is a translation product of the SHC1, SHC2, SHC3 or SHC4 gene. The canonical protein sequence has a core domain architecture consisting of a copy of the Phosphotyrosine interaction domain (PTB/PID) (PF00640) and a copy of the SH2 domain (PF00017) towards the C-terminus." [PRO:CNA]
comment: Category=family.
synonym: "SHC" EXACT []
xref: PIRSF:PIRSF038768
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003178
name: shc-transforming protein 1
def: "A shc-transforming protein that is a translation product of the SHC1 gene." [PRO:CNA]
comment: Category=gene.
synonym: "SH2 domain protein C1" EXACT []
synonym: "SHC" RELATED []
synonym: "SHC1" EXACT []
synonym: "SHCA" RELATED []
synonym: "src homology 2 domain-containing-transforming protein C1" EXACT []
is_a: PRO:000003177 ! shc-transforming protein

[Term]
id: PRO:000003179
name: shc-transforming protein 4
def: "A shc-transforming protein that is a translation product of the SHC4 gene." [PRO:CNA]
comment: Category=gene.
synonym: "hshcD" EXACT []
synonym: "rai-like protein" EXACT []
synonym: "RaLP" EXACT []
synonym: "SH2 domain protein C4" EXACT []
synonym: "SHC4" EXACT []
synonym: "Src homology 2 domain-containing-transforming protein C4" EXACT []
is_a: PRO:000003177 ! shc-transforming protein

[Term]
id: PRO:000003180
name: shc-transforming protein 2
def: "A shc-transforming protein that is a translation product of the SHC2 gene." [PRO:CNA]
comment: Category=gene.
synonym: "protein sck" EXACT []
synonym: "SCK" RELATED []
synonym: "SH2 domain protein C2" EXACT []
synonym: "SHC2" EXACT []
synonym: "SHCB" RELATED []
synonym: "src homology 2 domain-containing-transforming protein C2" EXACT []
is_a: PRO:000003177 ! shc-transforming protein

[Term]
id: PRO:000003181
name: shc-transforming protein 3
def: "A shc-transforming protein that is a translation product of the SHC3 gene." [PRO:CNA]
comment: Category=gene.
synonym: "N-Shc" EXACT []
synonym: "neuronal Shc" EXACT []
synonym: "NSHC" RELATED []
synonym: "protein rai" EXACT []
synonym: "SH2 domain protein C3" EXACT []
synonym: "SHC3" EXACT []
synonym: "SHCC" RELATED []
synonym: "Src homology 2 domain-containing-transforming protein C3" EXACT []
is_a: PRO:000003177 ! shc-transforming protein

[Term]
id: PRO:000003182
name: shc-transforming protein 1 isoform 1
def: "A shc-transforming protein 1 that is a translation product of a mature transcript of the SHC1 gene. Represented by the sequence UniProtKB:P98083-1." [PMID:11948181, PRO:CNA]
comment: Category=sequence.
synonym: "p66Shc" EXACT []
synonym: "SHC1 p66" EXACT []
synonym: "SHCA p66" EXACT []
is_a: PRO:000003178 ! shc-transforming protein 1

[Term]
id: PRO:000003183
name: shc-transforming protein 1 isoform 2
def: "A shc-transforming protein 1 that is a translation product of a mature transcript of the SHC1 gene. Represented by the sequence UniProtKB:P98083-2." [PRO:CNA]
comment: Category=sequence.
synonym: "p52Shc" EXACT []
synonym: "SHC1 p52" EXACT []
synonym: "SHCA p52" EXACT []
is_a: PRO:000003178 ! shc-transforming protein 1

[Term]
id: PRO:000003184
name: shc-transforming protein 1 isoform 3
def: "A shc-transforming protein 1 that is a translation product of a mature transcript of the SHC1 gene. Represented by the sequence UniProtKB:P98083-3." [PRO:CNA]
comment: Category=sequence.
synonym: "SHC1 p47" EXACT []
synonym: "SHCA p47" EXACT []
is_a: PRO:000003178 ! shc-transforming protein 1

[Term]
id: PRO:000003185
name: shc-transforming protein 1 isoform 1 unmodified form
def: "A shc-transforming protein 1 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000003182 ! shc-transforming protein 1 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000003186
name: shc-transforming protein 1 isoform 1 phosphorylated form
def: "A shc-transforming protein 1 isoform 1 that has been post-translationally modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000003182 ! shc-transforming protein 1 isoform 1

[Term]
id: PRO:000003187
name: shc-transforming protein 1 isoform 1 phosphorylated 1
def: "A shc-transforming protein 1 isoform 1 phosphorylated form that has been phosphorylated in Ser and Tyr residues by activated TGF beta receptor type 1." [PID:SHC, PMID:17673906]
comment: Category=modification.
is_a: PRO:000003186 ! shc-transforming protein 1 isoform 1 phosphorylated form

[Term]
id: PRO:000003188
name: shc-transforming protein 1 isoform 2 unmodified form
def: "A shc-transforming protein 1 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000003183 ! shc-transforming protein 1 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000003189
name: shc-transforming protein 1 isoform 2 phosphorylated form
def: "A shc-transforming protein 1 isoform 2 that has been post-translationally modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000003183 ! shc-transforming protein 1 isoform 2

[Term]
id: PRO:000003190
name: shc-transforming protein 1 isoform 2 phosphorylated 1
def: "A shc-transforming protein 1 isoform 2 phosphorylated form that has been phosphorylated in Ser and Tyr residues by activated TGF beta receptor type 1." [PID:SHC, PMIMD:17673906]
comment: Category=modification.
is_a: PRO:000003189 ! shc-transforming protein 1 isoform 2 phosphorylated form

[Term]
id: PRO:000003191
name: E3 ubiquitin-protein ligase NEDD4-like
def: "A HECT-domain-containing E3 ubiquitin-protein ligase with WW domains that is a translation product of the NEDD4L gene." [PRO:CNA]
comment: Category=gene.
synonym: " nedd4-2" EXACT []
synonym: "NEDD4.2" EXACT []
synonym: "Nedd4b" RELATED []
synonym: "Nedd4l" RELATED []
is_a: PRO:000000016 ! HECT-domain-containing E3 ubiquitin-protein ligase with WW domains

[Term]
id: PRO:000003192
name: E3 ubiquitin-protein ligase itchy
def: "A HECT-domain-containing E3 ubiquitin-protein ligase with WW domains that is a translation product of the ITCH gene." [PRO:CNA]
comment: Category=gene.
synonym: "ITCH" EXACT []
is_a: PRO:000000016 ! HECT-domain-containing E3 ubiquitin-protein ligase with WW domains

[Term]
id: PRO:000003193
name: TRAF family member-associated NF-kappa-B activator isoform 1
def: "A TRAF family member-associated NF-kappa-B activator that is a translation product of a mature transcript of the TANK gene. Represented by the sequence UniProtKB:P70347-1." [PRO:CNA]
comment: Category=sequence.
synonym: "tank beta" EXACT []
is_a: PRO:000003146 ! TRAF family member-associated NF-kappa-B activator

[Term]
id: PRO:000003194
name: TRAF family member-associated NF-kappa-B activator isoform 1 unmodified form
def: "A TRAF family member-associated NF-kappa-B activator isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000003193 ! TRAF family member-associated NF-kappa-B activator isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000003195
name: TRAF family member-associated NF-kappa-B activator isoform 1 phosphorylated and ubiquitinated form
def: "A TRAF family member-associated NF-kappa-B activator isoform 1 that has been post-translationally modified to include phosphorylated and ubiquitinated residues." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000003193 ! TRAF family member-associated NF-kappa-B activator isoform 1

[Term]
id: PRO:000003196
name: TRAF family member-associated NF-kappa-B activator isoform 1 phosphorylated and ubiquitinated 1
def: "A TRAF family member-associated NF-kappa-B activator isoform 1 phosphorylated and ubiquitinated that has been phosphorylated by TBK1-IKKepsilon upon lipopolysaccharide stimulation and is also subject to lipopolysaccharide- and TBK1-IKKepsilon-mediated Lys-63-linked polyubiquitination, a mechanism that does not require TBK1-IKKepsilon kinase activity." [PMID:17823124, TLRs:AMM]
comment: Category=modification.
is_a: PRO:000003195 ! TRAF family member-associated NF-kappa-B activator isoform 1 phosphorylated and ubiquitinated form

[Term]
id: PRO:000003197
name: calcium/calmodulin-dependent protein kinase II chain
def: "A protein with a core domain architecture consisting of a Protein kinase domain (PF00069) and a C terminal Calcium/calmodulin dependent protein kinase II Association (PF08332) domain." [PRO:CNA]
comment: Category=family.
synonym: "CAMKII" EXACT []
xref: PIRSF:PIRSF000594
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003198
name: caveolin-1
def: "A protein that is a translation product of the CAV1 gene." [PRO:CNA]
comment: Category=gene.
synonym: "CAV" RELATED []
synonym: "CAV1" RELATED []
xref: PIRSF:PIRSF009396
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003199
name: calcium/calmodulin-dependent protein kinase type II alpha chain
def: "A calcium/calmodulin-dependent protein kinase type II chain that is a translation product of the CAMK2A gene." [PRO:CNA]
comment: Category=gene.
synonym: "CaM-kinase II alpha chain" EXACT []
synonym: "CaM-kinase II subunit alpha" EXACT []
synonym: "CaMK-II subunit alpha" EXACT []
synonym: "CAMK2A" EXACT []
synonym: "CAMKA" RELATED []
is_a: PRO:000003197 ! calcium/calmodulin-dependent protein kinase II chain

[Term]
id: PRO:000003200
name: calcium/calmodulin-dependent protein kinase type II beta chain
def: "A calcium/calmodulin-dependent protein kinase type II chain that is a translation product of the CAMK2B gene." [PRO:CNA]
comment: Category=gene.
synonym: "CaM-kinase II beta chain" EXACT []
synonym: "CaM-kinase II subunit beta" EXACT []
synonym: "CAM2" EXACT []
synonym: "CaMK-II subunit beta" EXACT []
synonym: "CAMK2B" EXACT []
synonym: "CAMKB" RELATED []
is_a: PRO:000003197 ! calcium/calmodulin-dependent protein kinase II chain

[Term]
id: PRO:000003201
name: calcium/calmodulin-dependent protein kinase type II gamma chain
def: "A calcium/calmodulin-dependent protein kinase type II chain that is a translation product of the CAMK2G gene." [PRO:CNA]
comment: Category=gene.
synonym: "CaM-kinase II gamma chain" EXACT []
synonym: "CaM-kinase II subunit gamma" EXACT []
synonym: "CaMK-II subunit gamma" EXACT []
synonym: "CAMK2G" EXACT []
synonym: "CAMKG" RELATED []
is_a: PRO:000003197 ! calcium/calmodulin-dependent protein kinase II chain

[Term]
id: PRO:000003202
name: calcium/calmodulin-dependent protein kinase type II delta chain
def: "A calcium/calmodulin-dependent protein kinase type II chain that is a translation product of the CAMK2D gene." [PRO:CNA]
comment: Category=gene.
synonym: "CaM-kinase II delta chain" EXACT []
synonym: "CaM-kinase II subunit delta" EXACT []
synonym: "CaMK-II subunit delta" EXACT []
synonym: "CAMK2D" EXACT []
synonym: "CAMKD" RELATED []
is_a: PRO:000003197 ! calcium/calmodulin-dependent protein kinase II chain

[Term]
id: PRO:000003203
name: serine-threonine kinase receptor-associated protein
def: "A protein that is a translation product of the STRAP gene." [PMID:9856985, PRO:CNA]
comment: Category=gene.
synonym: "MAP activator with WD repeats" EXACT []
synonym: "MAWD" RELATED []
synonym: "strap" EXACT []
synonym: "UNR-interacting protein" EXACT []
synonym: "UNRIP" RELATED []
synonym: "WD-40 repeat protein PT-WD" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003204
name: serine-threonine kinase receptor-associated protein isoform 1
def: "A serine-threonine kinase receptor-associated protein that is a translation product of a mature transcript of the STRAP gene. Represented by the sequence UniProtKB:Q9Z1Z2-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000003203 ! serine-threonine kinase receptor-associated protein

[Term]
id: PRO:000003205
name: serine-threonine kinase receptor-associated protein isoform 1 unmodified form
def: "A serine-threonine kinase receptor-associated protein isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000003204 ! serine-threonine kinase receptor-associated protein isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000003206
name: serine-threonine kinase receptor-associated protein isoform 1 phosphorylated form
def: "A serine-threonine kinase receptor-associated protein isoform 1 that has been post-translationally modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000003204 ! serine-threonine kinase receptor-associated protein isoform 1

[Term]
id: PRO:000003207
name: serine-threonine kinase receptor-associated protein isoform 1 phosphorylated 1
def: "A serine-threonine kinase receptor-associated protein isoform 1 phosphorylated form that has been phosphorylated at its C- terminal region by the active TGF beta receptor type 1." [PID:STRAP, PMID:10757800]
comment: Category=modification.
is_a: PRO:000003206 ! serine-threonine kinase receptor-associated protein isoform 1 phosphorylated form

[Term]
id: PRO:000003208
name: conventional serine/threonine-protein phosphatase
def: "A protein that is a single-domain protein (PF00149) typically containing the signatures characteristic of the IPR006186 (serine/threonine-specific protein phosphatase and bis(5-nucleosyl)-tetraphosphatase) form of the IPR004843 (metallophosphoesterase) domain." [PIRSF:PIRSF000908]
comment: Category=family.
xref: PIRSF:PIRSF000908
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003209
name: serine/threonine-protein phosphatase PP1-alpha catalytic subunit
def: "A protein that is a translation product of the PPP1CA gene." [PRO:CNA]
comment: Category=gene.
synonym: "PP-1A" EXACT []
synonym: "PPP1A" RELATED []
synonym: "PPP1CA" EXACT []
is_a: PRO:000003208 ! conventional serine/threonine-protein phosphatase

[Term]
id: PRO:000003210
name: serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
def: "A protein that is a translation product of the PPP2CB gene." [PRO:CNA]
comment: Category=gene.
synonym: "PP2A-beta" EXACT []
synonym: "PPP2CB" EXACT []
is_a: PRO:000003208 ! conventional serine/threonine-protein phosphatase

[Term]
id: PRO:000003211
name: serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
def: "A protein that is a translation product of the PPP2CA gene." [PRO:CNA]
comment: Category=gene.
synonym: "PP2A-alpha" EXACT []
synonym: "PPP2CA" EXACT []
synonym: "replication protein C" EXACT []
synonym: "rp-c" EXACT []
is_a: PRO:000003208 ! conventional serine/threonine-protein phosphatase

[Term]
id: PRO:000003212
name: serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B
def: "A protein with a core domain architecture consisting of a copy of the Serine-threonine phosphatase 2A subunit B alpha and beta N-terminal domain (PF10586) followed by a copy of the Serine-threonine phosphatase 2A subunit B alpha and beta central domain (PF10594)." [PRO:CNA]
comment: Category=family.
synonym: "serine/threonine-protein phosphatase 2A, subunit B55" EXACT []
xref: PIRSF:PIRSF037309
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003213
name: serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform
def: "A serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B that is a translation product of the PPP2R2A gene." [PRO:CNA]
comment: Category=gene.
synonym: "PP2A, subunit B, B55-alpha isoform" EXACT []
synonym: "PP2A, subunit B, PR55-alpha isoform     " EXACT []
synonym: "PP2A, subunit B, R2-alpha isoform" EXACT []
synonym: "PPP2R2A" EXACT []
is_a: PRO:000003212 ! serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B

[Term]
id: PRO:000003214
name: ski oncogene
def: "A protein that is a translation product of the SKI gene." [PRO:CNA]
comment: Category=gene.
synonym: "c-ski" EXACT []
synonym: "SKI" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003215
name: mitogen-activated protein kinase kinase kinase 1
def: "A protein that is a translation product of the MAP3K1 gene." [PRO:CNA]
comment: Category=gene.
synonym: "MAPK/ERK kinase kinase 1" EXACT []
synonym: "MEK kinase 1" EXACT []
synonym: "MEKK1" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003216
name: mitogen-activated protein kinase kinase kinase 1 isoform 1
def: "A mitogen-activated protein kinase kinase kinase 1 that is a translation product of a mature transcript of the MAP3K1 gene. Represented by the sequence UniProtKB:Q13233-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000003215 ! mitogen-activated protein kinase kinase kinase 1

[Term]
id: PRO:000003217
name: mitogen-activated protein kinase kinase kinase 1 isoform 1 unmodified form
def: "A mitogen-activated protein kinase kinase kinase 1 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000003216 ! mitogen-activated protein kinase kinase kinase 1 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000003218
name: mitogen-activated protein kinase kinase kinase 1 isoform 1 phosphorylated form
def: "A mitogen-activated protein kinase kinase kinase 1 isoform 1 that has been post-translationally modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000003216 ! mitogen-activated protein kinase kinase kinase 1 isoform 1

[Term]
id: PRO:000003219
name: mitogen-activated protein kinase kinase kinase 1 isoform 1 phosphorylated 1
comment: Category=modification.
synonym: "MEKK1 active" EXACT []
is_a: PRO:000003218 ! mitogen-activated protein kinase kinase kinase 1 isoform 1 phosphorylated form

[Term]
id: PRO:000003220
name: myosin light chain
def: "A protein that is a translation product of the MYL3 gene." [PRO:CNA]
comment: Category=gene.
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003221
name: myosin light chain phosphorylated form
comment: Category=modification.
is_a: PRO:000003220 ! myosin light chain

[Term]
id: PRO:000003223
name: voltage-gated potassium channel subunit KCNA3 isoform 1 phosphorylated form
def: "A voltage-gated potassium channel subunit KCNA3 isoform 1 that has been post-translationally modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000000973 ! voltage-gated potassium channel subunit KCNA3 isoform 1

[Term]
id: PRO:000003224
name: voltage-gated potassium channel subunit KCNA3 isoform 1 phosphorylated 1
def: "A voltage-gated potassium channel subunit KCNA3 isoform 1 phosphorylated form that has been phosphorylated as a result of the interaction of HIV gp160 with CD4. Probably phosphorylated by PKC." [PMID:9989602, PRO:CL]
comment: Category=modification.
is_a: PRO:000003223 ! voltage-gated potassium channel subunit KCNA3 isoform 1 phosphorylated form

[Term]
id: PRO:000003225
name: envelope glycoprotein gp160
def: "A protein that is a translation product of the env gene." [PRO:CNA]
comment: Category=gene.
synonym: "Env polyprotein" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003226
name: envelope glycoprotein gp160 isoform 1
def: "An envelope glycoprotein gp160 that is a translation product of a mature transcript of the env gene. Represented by the sequence UniProtKB:P03378-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000003225 ! envelope glycoprotein gp160

[Term]
id: PRO:000003227
name: envelope glycoprotein gp160 isoform 1 cleaved and glycosylated form
def: "An envelope glycoprotein gp160 isoform 1 that has been processed by proteolytic cleavage and has been post-translationally modified to include glycosylated residues." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000003226 ! envelope glycoprotein gp160 isoform 1

[Term]
id: PRO:000003228
name: envelope glycoprotein gp160 isoform 1 cleaved and glycosylated 1
def: "An envelope glycoprotein gp160 isoform 1 cleaved and glycosylated form with removal of signal peptide and glycosylation." [PRO:CNA]
comment: Category=modification.
synonym: "gp160" EXACT []
synonym: "gp160 precursor" EXACT []
is_a: PRO:000003227 ! envelope glycoprotein gp160 isoform 1 cleaved and glycosylated form

[Term]
id: PRO:000003229
name: envelope glycoprotein gp160 isoform 1 cleaved and glycosylated 2
def: "An envelope glycoprotein gp160 isoform 1 cleaved and glycosylated form that is the N- terminal product of proteolytic processing of the precursor gp160." [UniProtKB:P03378]
comment: Category=modification.
synonym: "glycoprotein 120" EXACT []
synonym: "gp120" EXACT []
synonym: "mature SU protein" EXACT []
synonym: "surface protein" EXACT []
is_a: PRO:000003227 ! envelope glycoprotein gp160 isoform 1 cleaved and glycosylated form

[Term]
id: PRO:000003230
name: envelope glycoprotein gp160 isoform 1 cleaved and glycosylated 3
def: "An envelope glycoprotein gp160 isoform 1 cleaved and glycosylated form that is the C- terminal product of proteolytic processing of the precursor gp160. This cleaved form includes part of the extracellular domain, the transmembrane and the cytosolic domains." [PRO:CNA]
comment: Category=modification.
synonym: "glycoprotein 41" EXACT []
synonym: "gp41" EXACT []
synonym: "Tm protein" EXACT []
synonym: "transmembrane protein" EXACT []
is_a: PRO:000003227 ! envelope glycoprotein gp160 isoform 1 cleaved and glycosylated form

[Term]
id: PRO:000003231
name: Bcl2 antagonist of cell death isoform 2 phosphorylated form
def: "A Bcl2 antagonist of cell death isoform 2 that has been post-translationally modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000002281 ! Bcl2 antagonist of cell death isoform 2

[Term]
id: PRO:000003232
name: Bcl2 antagonist of cell death isoform 2 phosphorylated 1
def: "A Bcl2 antagonist of cell death isoform 2 phosphorylated form that has been phosphorylated in two Ser residues which are the major sites of phosphorylation by MAPK and AKT signaling. Phosphorylation on these residues favors binding to 14-3-3 proteins. Example: UniProtKB:Q92934-1,Ser-75/Ser-99, MOD:00046." [PRO:JAN]
comment: Category=modification.
is_a: PRO:000003231 ! Bcl2 antagonist of cell death isoform 2 phosphorylated form

[Term]
id: PRO:000003233
name: Bcl2 antagonist of cell death isoform 1 phosphorylated 4
def: "A Bcl2 antagonist of cell death isoform 1 that has been phosphorylated at a Thr residue by JNK1. Example: UniProtKB:Q61337-1, Thr-201, MOD:00047." [PMID:14967141, PRO:JAN]
comment: Category=modification.
is_a: PRO:000003084 ! Bcl2 antagonist of cell death isoform 1 phosphorylated form

[Term]
id: PRO:000003234
name: Bcl-2-like protein 11 isoform 2 phosphorylated form
def: "A Bcl-2-like protein 11 isoform 2 that has been post-translationally modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000002272 ! Bcl-2-like protein 11 isoform 2

[Term]
id: PRO:000003235
name: Bcl-2-like protein 11 isoform 2 phosphorylated 1
def: "A Bcl-2-like protein 11 isoform 2 phosphorylated 1 that has been phosphorylated by JNK in the three consensus Ser/Thr-Pro sites. Example:UniProtKB:O43521-2, Ser-44/Ser-58, MOD:00046|Thr-56, MOD:00047." [PMID:12591950, PRO:JAN>]
comment: Category=modification.
is_a: PRO:000003234 ! Bcl-2-like protein 11 isoform 2 phosphorylated form

[Term]
id: PRO:000003236
name: 14-3-3 protein zeta/delta
def: "A 14-3-3 protein that is a translation product of the YWHAZ gene." [PRO:CNA]
comment: Category=gene.
synonym: "KCIP-1" EXACT []
synonym: "protein kinase C inhibitor protein 1 " EXACT []
synonym: "YWHAZ" RELATED []
is_a: PRO:000003237 ! 14-3-3 protein

[Term]
id: PRO:000003237
name: 14-3-3 protein
def: "A protein that is a stand alone version of the 14-3-3 protein (PF00244) domain." [PRO:CNA]
comment: Category=family.
xref: PIRSF:PIRSF000868
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003238
name: Bcl2 antagonist of cell death isoform 1 phosphorylated 5
def: "A Bcl2 antagonist of cell death isoform 1 phosphorylated form that has been phosphorylated in one of the two Ser residues which are the major sites of phosphorylation by MAPK and AKT signaling. Phosphorylation on this residue favors binding to 14-3-3 proteins. Example: UniProtKB:Q61337-1, Ser-136, MOD:00046." [PMID:12049737, PRO:JAN, REACTOME:REACT_12828.1]
comment: Category=modification.
is_a: PRO:000003084 ! Bcl2 antagonist of cell death isoform 1 phosphorylated form

[Term]
id: PRO:000003239
name: focal adhesion kinase 2 isoform 1
def: "A focal adhesion kinase 2 that is a translation product of a mature transcript of the PTK2B gene. Represented by the sequence UniProtKB:Q14289-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000003032 ! focal adhesion kinase 2

[Term]
id: PRO:000003240
name: focal adhesion kinase 2 isoform 1 unmodified form
def: "A focal adhesion kinase 2 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000003239 ! focal adhesion kinase 2 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000003241
name: focal adhesion kinase 2 isoform 1 phosphorylated form
def: "A focal adhesion kinase 2 isoform 1 that has been post-translationally modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000003239 ! focal adhesion kinase 2 isoform 1

[Term]
id: PRO:000003242
name: focal adhesion kinase 2 isoform 1 phosphorylated 1
def: "A focal adhesion kinase 2 isoform 1 phosphorylated form that has been phosphorylated on the Tyr residues yielding the active kinase. Example:UniProtKB:Q14289-1, Tyr-402/Tyr-579/Tyr-580/Tyr-881, MOD:00048." [PMID:11698270, PRO:CL]
comment: Category=modification.
synonym: "pyk2 active form" EXACT []
is_a: PRO:000003241 ! focal adhesion kinase 2 isoform 1 phosphorylated form

[Term]
id: PRO:000003243
name: DNA-binding protein A
def: "A protein that is a translation product of the CSDA gene." [MGI:2137670, PRO:HJD]
comment: Category=gene.
synonym: "cold shock domain-containing protein A " EXACT []
synonym: "CSDA" RELATED []
synonym: "DBPA" RELATED []
synonym: "single-strand DNA-binding protein NF-GMB" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003244
name: RAF proto-oncogene serine/threonine-protein kinase
def: "A protein that is a translation product of the RAF1 gene." [PRO:CNA]
comment: Category=gene.
synonym: "C-RAF " EXACT []
synonym: "cRAF" EXACT []
synonym: "RAF" RELATED []
synonym: "RAF1" RELATED []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003245
name: RAF proto-oncogene serine/threonine-protein kinase isoform 1
def: "A RAF proto-oncogene serine/threonine-protein kinase that is a translation product of a mature transcript of the RAF1 gene. Represented by the sequence UniProtKB:P04049-1." [PRO:CNA]
comment: Category=sequence.
synonym: "RAF-1 isoform 6C" RELATED []
is_a: PRO:000003244 ! RAF proto-oncogene serine/threonine-protein kinase

[Term]
id: PRO:000003246
name: RAF proto-oncogene serine/threonine-protein kinase isoform 1 unmodified form
def: "A RAF proto-oncogene serine/threonine-protein kinase isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000003245 ! RAF proto-oncogene serine/threonine-protein kinase isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000003247
name: RAF proto-oncogene serine/threonine-protein kinase isoform 1 phosphorylated form
def: "A RAF proto-oncogene serine/threonine-protein kinase isoform 1 that has been post-translationally modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000003245 ! RAF proto-oncogene serine/threonine-protein kinase isoform 1

[Term]
id: PRO:000003248
name: RAF proto-oncogene serine/threonine-protein kinase isoform 2
def: "A RAF proto-oncogene serine/threonine-protein kinase that is a translation product of a mature transcript of the RAF1 gene. Represented by the sequence UniProtKB:P04049-2." [PRO:CNA]
comment: Category=sequence.
synonym: "RAF-1 isoform 1A" EXACT []
is_a: PRO:000003244 ! RAF proto-oncogene serine/threonine-protein kinase

[Term]
id: PRO:000003249
name: RAF proto-oncogene serine/threonine-protein kinase isoform 1 phosphorylated 1
def: "A RAF proto-oncogene serine/threonine-protein kinase isoform 1 phosphorylated that has been phosphorylated in two consecutive Tyr residues by active Src kinases. Example:UniProtKB:P04049-1, Tyr-340/Tyr-341, MOD:00048." [PMID:7692235]
comment: Category=modification.
synonym: "RAF-1 active form" EXACT []
is_a: PRO:000003247 ! RAF proto-oncogene serine/threonine-protein kinase isoform 1 phosphorylated form

[Term]
id: PRO:000003250
name: RAF proto-oncogene serine/threonine-protein kinase isoform 1 phosphorylated 2
def: "A RAF proto-oncogene serine/threonine-protein kinase isoform 1 phosphorylated that has been phosphorylated in two consecutive Ser residues by PAK1. Example:UniProtKB:P04049-1, Ser-338/Ser-339, MOD:00046." [PMID:15849194, PRO:JAN]
comment: Category=modification.
is_a: PRO:000003247 ! RAF proto-oncogene serine/threonine-protein kinase isoform 1 phosphorylated form

[Term]
id: PRO:000003251
name: Bcl2 antagonist of cell death isoform 3
def: "A Bcl2 antagonist of cell death that is a translation product of a mature transcript of the BAD gene. Represented by the sequence UniProtKB:O35147-2." [PRO:JAN]
comment: Category=sequence.
synonym: "BAD isoform beta" EXACT []
is_a: PRO:000002184 ! Bcl2 antagonist of cell death

[Term]
id: PRO:000003252
name: antithrombin-III
def: "A protein that is a translation product of the SERPINC1 gene." [PRO:CNA]
comment: Category=gene.
synonym: "antithrombin III" EXACT []
synonym: "AT3" RELATED []
synonym: "ATIII" EXACT []
synonym: "SERPINC" RELATED []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003253
name: antithrombin-III isoform 1
def: "An antithrombin-III that is a translation product of a mature transcript of the SERPINC1 gene. Represented by the sequence UniProtKB:P01008-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000003252 ! antithrombin-III

[Term]
id: PRO:000003254
name: antithrombin-III isoform 1 unmodified form
def: "An antithrombin-III isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:CNA]
comment: Category=modification.
synonym: "antithrombin-III precursor" EXACT []
intersection_of: PRO:000003253 ! antithrombin-III isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000003255
name: antithrombin-III isoform 1 cleaved and glycosylated form
def: "An antithrombin-III isoform 1 that has been processed by proteolytic cleavage and has been post-translationally modified to include glysosylated residues." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000003253 ! antithrombin-III isoform 1

[Term]
id: PRO:000003256
name: antithrombin-III isoform 1 cleaved and glycosylated 1
def: "An antithrombin-III isoform 1 cleaved and glycosylated form whose signal peptide has been removed and is N-glycosylated in the Asn residue within the four glycosylation patterns N-{P}-[ST]-{P}.\n." [PMID:17330941, UniProtKB:P01008]
comment: Category=modification.
synonym: "antithrombin-III secreted" EXACT []
is_a: PRO:000003255 ! antithrombin-III isoform 1 cleaved and glycosylated form

[Term]
id: PRO:000003257
name: interferon regulatory factor 3 isoform 1
def: "An interferon regulatory factor 3 that is a translation product of a mature transcript of the IRF3 gene. Represented by the sequence UniProtKB:Q14653-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000002045 ! interferon regulatory factor 3

[Term]
id: PRO:000003258
name: interferon regulatory factor 3 isoform 1 unmodified form
def: "An interferon regulatory factor 3 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification
intersetion_of: PRO:000003257

[Term]
id: PRO:000003259
name: interferon regulatory factor 3 isoform 1 phosphorylated form
def: "An interferon regulatory factor 3 isoform 1 that has been post-translationally modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000003257 ! interferon regulatory factor 3 isoform 1

[Term]
id: PRO:000003260
name: interferon regulatory factor 3 isoform 1 phosphorylated 1
def: "An interferon regulatory factor 3 isoform 1 phosphorylated form that has been phosphorylated upon stimulation by virus infection or treatment with double-stranded RNA or LPS. Example:UniProtKB:Q14653-1, Ser-385/Ser-386, MOD:00046." [PMID:14703513, TLRs:AMM]
comment: Category=modification.
synonym: "IRF3 active form" EXACT []
is_a: PRO:000003259 ! interferon regulatory factor 3 isoform 1 phosphorylated form

[Term]
id: PRO:000003261
name: interferon regulatory factor 7 isoform 1
comment: Category=sequence.
is_a: PRO:000002049 ! interferon regulatory factor 7

[Term]
id: PRO:000003262
name: collagen alpha chain
def: "A protein that is a component of collagen. Collagens are trimeric molecules in which each chain comprises a repeating Gly-X-Y triplet, in which X and Y can be any residue but are usually proline and hydroxyproline, respectively. This results in a left-handed helix that combines with other two to form a triple-helical structure." [PFam:PF01391, PMID:15788652, PMID:1639194]
comment: Category=family.
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003263
name: collagen type I alpha chain
def: "A collagen alpha chain that is a translation product of the COL1A1 or COL1A2 genes." [PRO:CNA]
comment: Category=family.
is_a: PRO:000003262 ! collagen alpha chain

[Term]
id: PRO:000003264
name: collagen alpha-1(I) chain
def: "A collagen type I alpha chain that is a translation product of the COL1A1 gene." [PRO:CNA]
comment: Category=gene.
synonym: " alpha-1 type I collagen" EXACT []
synonym: "COL1A1" RELATED []
is_a: PRO:000003263 ! collagen type I alpha chain

[Term]
id: PRO:000003265
name: collagen alpha-2(I) chain
def: "A collagen type I alpha chain that is a translation product of the COL1A2 gene." [PRO:CNA]
comment: Category=gene.
synonym: "alpha-2 type 1 collagen " EXACT []
synonym: "COL1A2" RELATED []
is_a: PRO:000003263 ! collagen type I alpha chain

[Term]
id: PRO:000003266
name: collagen type II alpha chain
def: "A collagen alpha chain that is a translation product of the COL2A1 gene." [PRO:CNA]
comment: Category=gene.
synonym: "alpha-1 type II collagen " EXACT []
synonym: "COL2A1" RELATED []
synonym: "collagen alpha-1(II) chain " EXACT []
is_a: PRO:000003262 ! collagen alpha chain

[Term]
id: PRO:000003267
name: apoptosis regulator BAX isoform 1 phosphorylated form
def: "An apoptosis regulator BAX isoform 1 that has been modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000002299 ! apoptosis regulator BAX isoform 1

[Term]
id: PRO:000003268
name: apoptosis regulator BAX isoform 1 phosphorylated 1
def: "An apoptosis regulator BAX isoform 1 phosphorylated form that has been phosphorylated on a Ser residue by AKT activation. Example:Q07813-1, Ser-184, MOD:00046." [PMID:14766748, PRO:JAN]
comment: Category=modification.
is_a: PRO:000003267 ! apoptosis regulator BAX isoform 1 phosphorylated form

[Term]
id: PRO:000003269
name: Bcl2 antagonist of cell death isoform 1 phosphorylated 6
def: "A Bcl2 antagonist of cell death isoform 1 phosphorylated form that has been phosphorylated by cdc-2. Example:Q61337-1, Ser128/Ser-136, MOD:00046." [PMID:12049737, PRO:JAN]
comment: Category=modification.
is_a: PRO:000003084 ! Bcl2 antagonist of cell death isoform 1 phosphorylated form

[Term]
id: PRO:000003270
name: CDK2-related kinase
def: "A protein that is cyclin-dependent kinase. The activated form phosphorylates target substrates on Ser or Thr residues followed by a proline. The core domain architecture consists of a copy of the Protein kinase domain (PF00069)." [PRO:CNA]
comment: Category=family.
synonym: "kinase-related transforming protein " RELATED []
xref: PIRSF:PIRSF501117
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003271
name: cell division control protein 2 homolog
def: "A CDK2-related kinase that is a translation product of the CDC2 gene." [PRO:CNA]
comment: Category=gene.
synonym: "cdc2" RELATED []
synonym: "cdk1" EXACT []
synonym: "cyclin-dependent kinase 1" EXACT []
synonym: "p34 protein kinase" EXACT []
is_a: PRO:000003270 ! CDK2-related kinase

[Term]
id: PRO:000003272
name: insulin receptor-related receptor
def: "A protein with a core domain composition consisting of a Receptor L domain (PF01030) followed by a Furin-like cysteine rich region (PF00757) and a second copy of the Receptor L domain (PF01030), two to four copies of the Fibronectin type 3 domain (PF00041) and a copy of the Protein tyrosine kinase(PF07714) domain at the C-terminus." [PRO:JAN]
comment: Category=family.
synonym: "insulin receptor family" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003273
name: insulin-like growth factor 1 receptor
def: "An insulin receptor-related receptor that is a translation product of the IGF1R gene." [PRO:JAN]
comment: Category=gene.
synonym: "CD221" EXACT []
synonym: "IGF-I receptor" EXACT []
synonym: "IGF1R" RELATED []
synonym: "insulin-like growth factor I receptor" EXACT []
is_a: PRO:000003272 ! insulin receptor-related receptor

[Term]
id: PRO:000003274
name: insulin-like growth factor 1 receptor isoform 1
def: "An insulin receptor-related receptor 1 that is a translation product of a mature transcript of the IGF1R gene. Represented by the sequence UniProtKB:P08069-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000003273 ! insulin-like growth factor 1 receptor

[Term]
id: PRO:000003275
name: insulin-like growth factor 1 receptor isoform 1 cleaved form
def: "An insulin-like growth factor 1 receptor isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000003274 ! insulin-like growth factor 1 receptor isoform 1
intersection_of: has_modification PRO:000002971 ! cleaved peptide bond

[Term]
id: PRO:000003276
name: insulin-like growth factor 1 receptor isoform 1 cleaved 1
def: "An insulin-like growth factor 1 receptor isoform 1 cleaved form whose signal peptide has been removed and has been furthered process to yield the N-terminal mature chain." [PMID:8257688, PRO:JAN]
comment: Category=modification.
synonym: "insulin-like growth factor 1 receptor alpha chain" EXACT []
is_a: PRO:000003275 ! insulin-like growth factor 1 receptor isoform 1 cleaved form

[Term]
id: PRO:000003277
name: insulin-like growth factor 1 receptor isoform 1 cleaved 2
def: "An insulin-like growth factor 1 receptor isoform 1 cleaved form whose signal peptide has been removed and has been furthered process to yield the C-terminal mature chain." [PRO:JAN]
comment: Category=modification.
synonym: "insulin-like growth factor 1 receptor beta chain" EXACT []
is_a: PRO:000003275 ! insulin-like growth factor 1 receptor isoform 1 cleaved form

[Term]
id: PRO:000003278
name: serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform
def: "A protein that is a translation product of the PPP3CA gene." [PRO:CNA]
comment: Category=gene.
synonym: "calcineurin alpha subunit" EXACT []
synonym: "calmodulin-dependent calcineurin A subunit alpha isoform" EXACT []
synonym: "CALNA" RELATED []
synonym: "CAM-PRP catalytic subunit" EXACT []
synonym: "CNA" RELATED []
synonym: "PPP3CA" RELATED []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003279
name: interferon regulatory factor 7 isoform 1 unmodified form
def: "An interferon regulatory factor 7 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:CNA]
comment: Category=modification.
intersection_of: PRO:000003261 ! interferon regulatory factor 7 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000003280
name: interferon regulatory factor 7 isoform 1 phosphorylated form
def: "An interferon regulatory factor 7 isoform 1 that has been post-translationally modified to include a phosphoarylated residue." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000003261 ! interferon regulatory factor 7 isoform 1

[Term]
id: PRO:000003281
name: interferon regulatory factor 7 isoform 1 phosphorylated 1
def: "An interferon regulatory factor 7 isoform 1 phosphorylated form that has been activated by phosphorylation on the Ser residues located in the C-terminal region." [PMID:14517278, TLR:AMM]
comment: Category=modification.
synonym: "IRF-7 active form" EXACT []
synonym: "IRF-7 phosphorylated" EXACT []
is_a: PRO:000003280 ! interferon regulatory factor 7 isoform 1 phosphorylated form

[Term]
id: PRO:000003282
name: dual specificity mitogen-activated protein kinase kinase 6
def: "A protein that is a translation product of the MAP2K6 gene." [TLR:AMM]
comment: Category=gene.
synonym: "MAP kinase kinase 6 " EXACT []
synonym: "MAP2K6" RELATED []
synonym: "MAPK/ERK kinase 6" EXACT []
synonym: "MAPKK 6 " EXACT []
synonym: "MEK6" RELATED []
synonym: "MKK6" RELATED []
synonym: "PRKMK6" RELATED []
synonym: "SAPKK3" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003283
name: dual specificity mitogen-activated protein kinase kinase 4
def: "A protein that is a translation product of the MAP2K4 gene." [TLR:AMM]
comment: Category=gene.
synonym: " SERK1" RELATED []
synonym: "c-Jun N-terminal kinase kinase 1" EXACT []
synonym: "JNK-activating kinase 1" EXACT []
synonym: "JNKK" EXACT []
synonym: "JNKK1" RELATED []
synonym: "MAP kinase kinase 4" EXACT []
synonym: "MAP2K4" RELATED []
synonym: "MKK4" RELATED []
synonym: "PRKMK4" RELATED []
synonym: "SAPK/ERK kinase 1" EXACT []
synonym: "SEK1" RELATED []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003284
name: dual specificity mitogen-activated protein kinase kinase 3
def: "A protein that is a translation product of the MAP2K3 gene." [TLR:AMM]
comment: Category=gene.
synonym: "MAP kinase kinase 3" EXACT []
synonym: "MAP2K3" RELATED []
synonym: "MAPK/ERK kinase 3" EXACT []
synonym: "MAPKK 3" EXACT []
synonym: "MEK3" RELATED []
synonym: "MKK3" RELATED []
synonym: "PRKMK3" RELATED []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003285
name: TRAF-interacting protein with FHA domain-containing protein
def: "A protein that is a translation product of the TIFA or TIFAB gene." [PRO:CNA]
comment: Category=family.
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003286
name: TRAF-interacting protein with FHA domain-containing protein A
def: "A TRAF-interacting protein with FHA domain-containing protein that is a translation product of the TIFA gene." [TLR:AMM]
comment: Category=gene.
synonym: "Putative MAPK-activating protein PM14 " EXACT []
synonym: "Putative NF-kappa-B-activating protein 20" EXACT []
synonym: "T2BP" RELATED []
synonym: "TIFA" RELATED []
synonym: "TRAF2-binding protein" EXACT []
is_a: PRO:000003285 ! TRAF-interacting protein with FHA domain-containing protein

[Term]
id: PRO:000003287
name: TRAF-interacting protein with FHA domain-containing protein B
def: "A TRAF-interacting protein with FHA domain-containing protein that is a translation product of the TIFAB gene." [TLR:AMM]
comment: Category=gene.
synonym: "TIFA-like protein" EXACT []
synonym: "TIFAB" RELATED []
is_a: PRO:000003285 ! TRAF-interacting protein with FHA domain-containing protein

[Term]
id: PRO:000003288
name: typical ubiquitin-conjugating enzyme E2
def: "A protein that is a stand alone version of the Ubiquitin-conjugating enzyme (PF00179) domain. This class is called typical because it contains an essential Cys residue and hence the catalytic activity required to form a thiol-ester with ubiquitin in the second step of ubiquitination." [PRO:CNA]
comment: Category=family.
synonym: "UBC" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003289
name: ubiquitin-conjugating enzyme E2 N
def: "A typical ubiquitin-conjugating enzyme E2 that is a translation product of the UBE2N gene." [TLR:AMM]
comment: Category=gene.
synonym: "Bendless-like ubiquitin-conjugating enzyme" EXACT []
synonym: "Ubc13" EXACT []
synonym: "Ubiquitin carrier protein N" EXACT []
synonym: "Ubiquitin-protein ligase N" EXACT []
is_a: PRO:000003288 ! typical ubiquitin-conjugating enzyme E2

[Term]
id: PRO:000003290
name: ubiquitin-conjugating enzyme variant
def: "A protein that contains a central Ubiquitin-conjugating enzyme (PF00179) domain that has significant similarity to true ubiquitin-conjugating enzymes (Ubcs) . However, unlike typical Ubcs, this class lacks the essential Cys residue and hence the catalytic activity required to form a thiol-ester with ubiquitin in the second step of ubiquitination." [PMID:11406273, PMID:9705497]
comment: Category=family.
synonym: "UEV" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003291
name: ubiquitin-conjugating enzyme E2 variant 1
def: "A ubiquitin-conjugating enzyme variant that is a translation product of the UBE2V1 gene." [TLR:AMM]
comment: Category=gene.
synonym: "CROC-1" EXACT []
synonym: "UBE2V1" RELATED []
synonym: "UEV-1" EXACT []
is_a: PRO:000003290 ! ubiquitin-conjugating enzyme variant

[Term]
id: PRO:000003292
name: NF-kappaB inhibitor
def: "A protein that is a translation product of the NFKBIA, NFKBIB, or NFKBIE gene. It contains multiple copies (5-6) of the Ankyrin repeat (PF00023)." [PRO:CNA]
comment: Category=family.
xref: PIRSF:PIRSF036322
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003293
name: NF-kappa-B inhibitor alpha
def: "A NF-kappa-B inhibitor that is a translation product of the NFKBIA gene." [PMID:19302050, TLR:AMM]
comment: Category=gene.
synonym: " I-kappa-B-alpha" EXACT []
synonym: "IkappaBalpha" EXACT []
synonym: "IkB-alpha" EXACT []
synonym: "Ikba" RELATED []
synonym: "NFKBIA" RELATED []
is_a: PRO:000003292 ! NF-kappaB inhibitor

[Term]
id: PRO:000003294
name: NF-kappa-B inhibitor beta
def: "A NF-kappa-B inhibitor that is a translation product of the NFKBIB gene." [PMID:19302050, TLR:AMM]
comment: Category=gene.
synonym: "I-kappa-B-beta" EXACT []
synonym: "IkB-B" EXACT []
synonym: "IkB-beta" EXACT []
synonym: "Ikbb" RELATED []
synonym: "NF-kappa-BIB" EXACT []
synonym: "NFKBIB" RELATED []
is_a: PRO:000003292 ! NF-kappaB inhibitor

[Term]
id: PRO:000003295
name: NF-kappa-B inhibitor epsilon
def: "A NF-kappa-B inhibitor that is a translation product of the NFKBIE gene." [PMID:19302050, TLR:AMM]
comment: Category=gene.
synonym: "I-kappa-B-epsilon" EXACT []
synonym: "IkappaBepsilon" EXACT []
synonym: "IkB-E" EXACT []
synonym: "IKBE" RELATED []
synonym: "NF-kappa-BIE" EXACT []
synonym: "NFKBIE" RELATED []
is_a: PRO:000003292 ! NF-kappaB inhibitor

[Term]
id: PRO:000003296
name: lymphocyte antigen 96
def: "A protein that is a translation product of the LY96 gene." [TLR:AMM]
comment: Category=gene.
synonym: "ESOP-1" EXACT []
synonym: "ESOP1" RELATED []
synonym: "LY96" RELATED []
synonym: "MD2" RELATED []
synonym: "Protein MD-2" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003297
name: lymphocyte antigen 96 isoform 1
def: "A lymphocyte antigen 96 that is a translation product of a mature transcript of the LY96 gene. Represented by the sequence UniProtKB:Q9Y6Y9-1." [TLR:AMM]
comment: Category=sequence.
is_a: PRO:000003296 ! lymphocyte antigen 96

[Term]
id: PRO:000003298
name: lymphocyte antigen 96 isoform 1 cleaved and glycosylated form
def: "A lymphocyte antigen 96 isoform 1 that has been processed by proteolytic cleavage and post-translationally modified to include glycosylated residues." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000003297 ! lymphocyte antigen 96 isoform 1

[Term]
id: PRO:000003299
name: lymphocyte antigen 96 isoform 1 cleaved and glycosylated 1
def: "A lymphocyte antigen 96 isoform 1 cleaved and glycosylated form that is the mature form of the protein with N-glycosylation and removal of the signal peptide." [PMID:11593030, PMID:17569869, TLR:AMM]
comment: Category=modification.
synonym: "lymphocyte antigen 96" RELATED []
synonym: "lymphocyte antigen 96 mature protein" EXACT []
synonym: "lymphocyte antigen 96 secreted form" EXACT []
synonym: "secreted MD-2" EXACT []
is_a: PRO:000003298 ! lymphocyte antigen 96 isoform 1 cleaved and glycosylated form

[Term]
id: PRO:000003300
name: TRAF family member-associated NF-kappa-B activator isoform 1 ubiquitinated 1
def: "A TRAF family member-associated NF-kappa-B activator isoform 1 ubiquitinated form that has been post-translationally modified to include ubiquitinated residues. Example:UniProtKB:Q92844-1, MOD:01148" [PRO:TLR\:AMM]
comment: Category=modification.
is_a: PRO:000003193 ! TRAF family member-associated NF-kappa-B activator isoform 1

[Term]
id: PRO:000003301
name: TNF receptor-associated factor 6 isoform 1 ubiquitinated 1
def: "A TNF receptor-associated factor 6 that has been post-translationally modified to include a ubiquitinated residue. Example:UniProtKB:P70196-1, Lys-124, MOD:01148." [PRO:HJD]
comment: Category=modification.
is_a: PRO:000002381 ! TNF receptor-associated factor 6 isoform 1

[Term]
id: PRO:000003302
name: phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1
def: "A protein that is a translation product of the INPP5D gene." [PRO:HJD]
comment: Category=gene. (keywords: ^Q9ES52^).
synonym: "7a33, Ship, Ship1" RELATED []
synonym: "Inositol polyphosphate-5-phosphatase of 145 kDa" EXACT []
synonym: "INPP5D" RELATED []
synonym: "p150Ship" EXACT []
synonym: "SH2 domain-containing inositol phosphatase 1" EXACT []
synonym: "SH2 domain-containing inositol-5'-phosphatase 1" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003303
name: phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1 isoform 1
def: "A phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1 that is a translation product of a matured transcript of the INPP5D gene. Represented by the sequence UniProtKB:Q9ES52-1." [PRO:HJD]
comment: Category=sequence.
is_a: PRO:000003302 ! phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1

[Term]
id: PRO:000003304
name: phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1 isoform 1 unmodified form
def: "A phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1 isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:HJD]
comment: Category=modification.
intersection_of: PRO:000003303 ! phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1 isoform 1
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000003305
name: phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1 isoform 2
def: "A phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1 that is a translation product of a matured transcript of the INPP5D gene. Represented by the sequence UniProtKB:Q9ES52-2." [PRO:HJD]
comment: Category=sequence.
is_a: PRO:000003302 ! phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1

[Term]
id: PRO:000003306
name: phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1 isoform 2 unmodified form
def: "A phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1 isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:HJD]
comment: Category=modification.
intersection_of: PRO:000003305 ! phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1 isoform 2
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000003307
name: phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1 isoform 3
def: "A phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1 that is a translation product of a matured transcript of the INPP5D gene. Represented by the sequence UniProtKB:Q9ES52-3." [PRO:HJD]
comment: Category=sequence.
is_a: PRO:000003302 ! phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1

[Term]
id: PRO:000003308
name: phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1 isoform 3 unmodified form
def: "A phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1 isoform 3 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:HJD]
comment: Category=modification.
intersection_of: PRO:000003307 ! phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1 isoform 3
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000003309
name: phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1 isoform 4
def: "A phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1 that is a translation product of a matured transcript of the INPP5D gene. Represented by the sequence UniProtKB:Q9ES52-4." [PRO:HJD]
comment: Category=sequence.
is_a: PRO:000003302 ! phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1

[Term]
id: PRO:000003310
name: phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1 isoform 4 unmodified form
def: "A phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1 isoform 4 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:HJD]
comment: Category=modification.
intersection_of: PRO:000003309 ! phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1 isoform 4
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000003311
name: phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1 isoform 5
def: "A phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1 that is a translation product of a matured transcript of the INPP5D gene. Represented by the sequence UniProtKB:Q9ES52-5." [PRO:HJD]
comment: Category=sequence.
is_a: PRO:000003302 ! phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1

[Term]
id: PRO:000003312
name: phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1 isoform 5 unmodified form
def: "A phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1 that is unmodified." [PRO:HJD]
comment: Category=modification.
intersection_of: PRO:000003311 ! phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1 isoform 5
intersection_of: lacks_modification PRO:000002967 ! post-translational protein modification

[Term]
id: PRO:000003313
name: phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1 isoform 2 phosphorylated 1
def: "A phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1 phosphorylated form that is phosphorylated on Tyr-residues located in the C-terminal Proline rich domain. Example:UniProtKB:Q9ES52-2, MOD:00048." [PMID:8643691, PRO:HJD]
comment: Category=modification.
synonym: "p150 SHIP tyrosine phosphorylated " EXACT []
is_a: PRO:000003314 ! phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1 isoform 2 phosphorylated form

[Term]
id: PRO:000003314
name: phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1 isoform 2 phosphorylated form
def: "A phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1 isoform 2 that has been post-translationally modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000003305 ! phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1 isoform 2

[Term]
id: PRO:000003315
name: phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1 isoform 6
def: "A phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1 that is a translation product of a matured transcript of the INPP5D gene. Represented by the sequence UniProtKB:Q9ES52-6." [PRO:HJD]
comment: Category=sequence.
synonym: "s-SHIPD183" EXACT []
is_a: PRO:000003302 ! phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1

[Term]
id: PRO:000003316
name: syntaxin binding protein
def: "A protein that is a translation product of the STXBP1 or STXBP2 or STXBP3 gene. This class is related to the fungal sec-1 protein." [PRO:CNA]
comment: Category=family.
xref: PANTHER:PTHR11679\:SF7
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003317
name: syntaxin-binding protein 1
def: "A syntaxin-binding protein that is a translation product of the STXBP1 gene." [MGI:107363, PRO:HJD]
comment: Category=gene.
synonym: "N-Sec1" EXACT []
synonym: "p67" RELATED []
synonym: "STXBP1" RELATED []
synonym: "Unc-18 homolog" EXACT []
synonym: "Unc-18-1" EXACT []
synonym: "Unc-18A " EXACT []
synonym: "Unc18a" RELATED []
is_a: PRO:000003316 ! syntaxin binding protein

[Term]
id: PRO:000003318
name: phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1 isoform 3 phosphorylated form
def: "A phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1 isoform 3 that has been post-translationally modified to include a phosphorylated residue." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000003307 ! phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1 isoform 3

[Term]
id: PRO:000003319
name: phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1 isoform 3 phosphorylated 1
def: "A phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1 isoform 3 phosphorylated form that has been phosphorylated in the two NPXY motifs present in the C-terminal Proline rich domain." [PMID:10068665, PRO:HJD]
comment: Category=modification.
synonym: "135 kD SHIP tyrosine phosphorylated" EXACT []
is_a: PRO:000003318 ! phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1 isoform 3 phosphorylated form

[Term]
id: PRO:000003320
name: lysine-specific histone demethylase 1B
def: "A protein that is a translation product of the KDM1B gene." [MGI:2145261, PRO:HJD]
comment: Category=gene.
synonym: "AOF1" RELATED []
synonym: "Flavin-containing amine oxidase domain-containing protein 1" EXACT []
synonym: "Lsd2" RELATED []
synonym: "lysine-specific histone demethylase 2" EXACT []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003321
name: lysine-specific histone demethylase 1B isoform 1
def: "A lysine-specific histone demethylase 1B that is a translation product of a mature transcript of the KDM1B gene. Represented by the sequence UniProtKB:Q8CIG3-1." [PMID:19727073, PRO:HJD, UniProtKB:Q8CIG3-1]
comment: Category=sequence.
is_a: PRO:000003320 ! lysine-specific histone demethylase 1B

[Term]
id: PRO:000003322
name: syntaxin-binding protein 1 isoform 1
def: "A syntaxin-binding protein 1 that is a translation product of a mature transcript of the STXBP1 gene. Represented by the sequence UniProtKB:O08599-1." [PRO:HJD, UniProtKB:O08599-1]
comment: Category=sequence.
is_a: PRO:000003317 ! syntaxin-binding protein 1

[Term]
id: PRO:000003323
name: syntaxin-binding protein 1 isoform 2
def: "A syntaxin-binding protein 1 that is a translation product of a mature transcript of the STXBP1 gene. Represented by the sequence UniProtKB:O08599-2." [PRO:HJD, UniProtKB:O08599-2]
comment: Category=sequence.
is_a: PRO:000003317 ! syntaxin-binding protein 1

[Term]
id: PRO:000003324
name: suppressor of fused homolog
def: "A protein that is a translation product of the SUFU gene." [MGI:1345643, PRO:HJD]
comment: Category=gene.
synonym: "SUFU" RELATED []
xref: PIRSF:PIRSF011844
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003325
name: suppressor of fused homolog isoform 1
def: "A suppressor of fused homolog that is a translation product of a mature transcript of the SUFU gene. Represented by the sequence UniProtKB:Q9Z0P7-1." [PRO:HJD, UniProtKB:Q9Z0P7-1]
comment: Category=sequence.
is_a: PRO:000003324 ! suppressor of fused homolog

[Term]
id: PRO:000003326
name: suppressor of fused homolog isoform 2
def: "A suppressor of fused homolog that is a translation product of a mature transcript of the SUFU gene. Represented by the sequence UniProtKB:Q9Z0P7-3." [PRO:HJD, UniProtKB:Q9Z0P7-3]
comment: Category=sequence.
is_a: PRO:000003324 ! suppressor of fused homolog

[Term]
id: PRO:000003327
name: suppressor of fused homolog isoform 3
def: "A suppressor of fused homolog that is a translation product of a mature transcript of the SUFU gene. Represented by the sequence UniProtKB:Q9Z0P7-4." [PRO:HJD, UniProtKB:Q9Z0P7-4]
comment: Category=sequence.
synonym: "SU(FU)-XL" EXACT []
is_a: PRO:000003324 ! suppressor of fused homolog

[Term]
id: PRO:000003328
name: collagen alpha-1(III) chain
def: "A collagen alpha chain that is a translation product of the COL3A1 gene." [PRO:CNA]
comment: Category=gene.
synonym: "COL3A1" RELATED []
is_a: PRO:000003262 ! collagen alpha chain

[Term]
id: PRO:000003329
name: collagen alpha-1(III) chain isoform 1
def: "A collagen alpha-1(III) chain that is a translation product of a mature transcript of the COL3A1 gene. Represented by the sequence UniProtKB:P02461-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000003328 ! collagen alpha-1(III) chain

[Term]
id: PRO:000003330
name: collagen alpha-1(III) chain isoform 1 unmodified form
def: "A collagen alpha-1(III) chain that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:CNA]
comment: Category=modification.
synonym: "collagen alpha-1(III) chain precursor" EXACT []
synonym: "procollagen chain" BROAD []
is_a: PRO:000003329 ! collagen alpha-1(III) chain isoform 1

[Term]
id: PRO:000003331
name: collagen alpha-2(V) chain
def: "A collagen type V alpha chain that is a translation product of the COL5A2 gene." [PRO:CNA]
comment: Category=gene.
synonym: "COL5A2" RELATED []
is_a: PRO:000003387 ! collagen type V alpha chain

[Term]
id: PRO:000003332
name: collagen alpha-2(V) chain isoform 1
def: "A collagen alpha-2(V) chain that is a translation product of a mature transcript of the COL5A2 gene. Represented by the sequence UniProtKB:P05997-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000003331 ! collagen alpha-2(V) chain

[Term]
id: PRO:000003333
name: collagen alpha-2(V) chain isoform 1 unmodified form
def: "A collagen alpha-2(V) chain isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:CNA]
comment: Category=modification.
synonym: "collagen alpha-2(V) chain precursor" EXACT []
is_a: PRO:000003332 ! collagen alpha-2(V) chain isoform 1

[Term]
id: PRO:000003334
name: collagen alpha-5(IV) chain
def: "A collagen alpha chain that is a translation product of the COL4A5 gene." [PRO:CNA]
comment: Category=gene.
synonym: "COL4A5" RELATED []
is_a: PRO:000003388 ! collagen type IV alpha chain

[Term]
id: PRO:000003335
name: collagen alpha-5(IV) chain isoform 1
def: "A collagen alpha-5(IV) chain that is a translation product of a mature transcript of the COL4A5 gene. Represented by the sequence UniProtKB:P29400-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000003334 ! collagen alpha-5(IV) chain

[Term]
id: PRO:000003336
name: collagen alpha-5(IV) chain isoform 1 unmodified form
def: "A collagen alpha-5(IV) chain isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:CNA]
comment: Category=modification.
synonym: "collagen alpha-5(IV) chain precursor" EXACT []
is_a: PRO:000003335 ! collagen alpha-5(IV) chain isoform 1

[Term]
id: PRO:000003337
name: collagen alpha-4(IV) chain
def: "A collagen alpha chain that is a translation product of the COL4A4 gene." [PRO:CNA]
comment: Category=gene.
synonym: "COL4A4" RELATED []
is_a: PRO:000003388 ! collagen type IV alpha chain

[Term]
id: PRO:000003338
name: collagen alpha-4(IV) chain isoform 1
def: "A collagen alpha-4(IV) chain that is a translation product of a matured transcript of the COL4A4 gene. Represented by the sequence UniProtKB:P53420-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000003337 ! collagen alpha-4(IV) chain

[Term]
id: PRO:000003339
name: collagen alpha-4(IV) chain isoform 1 unmodified form
def: "A collagen alpha-4(IV) chain isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:CNA]
comment: Category=modification.
synonym: "collagen alpha-4(IV) chain precursor" EXACT []
is_a: PRO:000003338 ! collagen alpha-4(IV) chain isoform 1

[Term]
id: PRO:000003340
name: collagen alpha-4(IV) chain isoform 1 cleaved 1
def: "A collagen alpha-4(IV) chain isoform 1 cleaved form where the signal peptide has been removed from the precursor yielding the mature protein. Example:UniProtKB:P53420-1, 39-1690." [PRO:CNA]
comment: Category=modification.
synonym: "collagen alpha-4(IV) chain" EXACT []
synonym: "collagen alpha-4(IV) chain mature" EXACT []
is_a: PRO:000003383 ! collagen alpha-4(IV) chain isoform 1 cleaved form

[Term]
id: PRO:000003341
name: collagen alpha-3(VI) chain
def: "A collagen type VI alpha chain that is a translation product of the COL6A3 gene." [PRO:CNA]
comment: Category=gene.
synonym: "COL6A3" RELATED []
is_a: PRO:000003386 ! collagen type VI alpha chain

[Term]
id: PRO:000003342
name: collagen alpha-3(VI) chain isoform 1
def: "A collagen alpha-3(VI) chain that is a translation product of a mature transcript of the COL6A3 gene. Represented by the sequence UniProtKB:P12111-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000003341 ! collagen alpha-3(VI) chain

[Term]
id: PRO:000003343
name: collagen alpha-3(VI) chain isoform 1 unmodified form
def: "A collagen alpha-3(VI) chain isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000003342 ! collagen alpha-3(VI) chain isoform 1

[Term]
id: PRO:000003344
name: collagen alpha-3(VI) chain isoform 1 cleaved 1
def: "A collagen alpha-3(VI) chain isoform 1 cleaved for where the signal peptide has been removed from the precursor yielding the mature protein. Example: UniProtKB:P12111-1, 26-3177." [PRO:CNA]
comment: Category=modification.
synonym: "collagen alpha-3(VI) chain" EXACT []
synonym: "collagen alpha-3(VI) chain mature" EXACT []
is_a: PRO:000003382 ! collagen alpha-3(VI) chain isoform 1 cleaved form

[Term]
id: PRO:000003345
name: collagen alpha-1(V) chain
def: "A collagen type V alpha chain that is a translation product of the COL5A1 gene." [PRO:CNA]
comment: Category=gene.
synonym: "COL5A1" RELATED []
is_a: PRO:000003387 ! collagen type V alpha chain

[Term]
id: PRO:000003346
name: collagen alpha-1(V) chain isoform 1
def: "A collagen alpha-1(V) chain that is a translation product of a mature transcript of the COL5A1 gene. Represented by the sequence UniProtKB:P20908-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000003345 ! collagen alpha-1(V) chain

[Term]
id: PRO:000003347
name: collagen alpha-1(V) chain isoform 1 unmodified form
def: "A collagen alpha-1(V) chain that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:CNA]
comment: Category=modification.
synonym: "collagen alpha-1(V) chain precursor" EXACT []
is_a: PRO:000003346 ! collagen alpha-1(V) chain isoform 1

[Term]
id: PRO:000003348
name: collagen alpha-1(V) chain isoform 1 modified form
def: "A collagen alpha-1(V) chain isoform 1 cleaved form where the signal peptide and the C- terminal propeptide has been removed yielding the mature protein. Example: UniProtKB:P20908-1, 38-1605." [PRO:CNA]
comment: Category=modification.
synonym: "collagen alpha-1(V) chain mature" EXACT []
is_a: PRO:000003369 ! collagen alpha-1(V) chain isoform 1 cleaved form

[Term]
id: PRO:000003349
name: collagen alpha-1(VII) chain
def: "A collagen alpha chain that is a translation product of the COL7A1 gene." [PRO:CNA]
comment: Category=gene.
synonym: "COL7A1" RELATED []
synonym: "Long-chain collagen" EXACT []
is_a: PRO:000003262 ! collagen alpha chain

[Term]
id: PRO:000003350
name: collagen alpha-1(VII) chain isoform 1
def: "A collagen alpha-1(VII) chain that is a translation product of a mature transcript of the COL7A1 gene. Represented by the sequence UniProtKB:Q02388-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000003349 ! collagen alpha-1(VII) chain

[Term]
id: PRO:000003351
name: collagen alpha-1(VII) chain isoform 1 unmodified form
def: "A collagen alpha-1(VII) chain isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:CNA]
comment: Category=modification.
synonym: "collagen alpha-1(VII) chain precursor" EXACT []
synonym: "procollagen chain" BROAD []
is_a: PRO:000003350 ! collagen alpha-1(VII) chain isoform 1

[Term]
id: PRO:000003352
name: collagen alpha-1(VII) chain isoform 1 cleaved 1
def: "A collagen alpha-1(VII) chain isoform 1 cleaved form where the signal peptide has been removed from the precursor yielding the mature protein. Example: UniProtKB:Q02388-1, 17-2944." [PRO:CNA]
comment: Category=modification.
synonym: "collagen alpha-1(VII) chain mature" EXACT []
is_a: PRO:000003378 ! collagen alpha-1(VII) chain isoform 1 cleaved form

[Term]
id: PRO:000003353
name: collagen alpha-1(VI) chain
def: "A collagen type VI alpha chain that is a translation product of the COL6A1 gene." [PRO:CNA]
comment: Category=gene.
synonym: "COL6A1" RELATED []
is_a: PRO:000003386 ! collagen type VI alpha chain

[Term]
id: PRO:000003354
name: collagen alpha-1(VI) chain isoform 1
def: "A collagen alpha-1(VI) chain that is a translation product of a mature transcript of the COL6A1 gene. Represented by the sequence UniProtKB:P12109-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000003353 ! collagen alpha-1(VI) chain

[Term]
id: PRO:000003355
name: collagen alpha-1(VI) chain isoform 1 unmodified form
def: "A collagen alpha-1(VI) chain isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:CNA]
comment: Category=modification.
synonym: "collagen alpha-1(VI) chain precursor" EXACT []
is_a: PRO:000003354 ! collagen alpha-1(VI) chain isoform 1

[Term]
id: PRO:000003356
name: collagen alpha-1(VI) chain isoform 1 cleaved 1
def: "A collagen alpha-1(VI) chain isoform 1 cleaved form where the signal peptide has been removed yielding the mature protein. Example:UniProtKB:P12109-1, 20-1028." [PRO:CNA]
comment: Category=modification.
synonym: "collagen alpha-1(VI) chain mature" EXACT []
is_a: PRO:000003377 ! collagen alpha-1(VI) chain isoform 1 cleaved form

[Term]
id: PRO:000003357
name: collagen alpha-2(VI) chain
def: "A collagen type VI alpha chain that is a translation product of the COL6A2 gene." [PRO:CNA]
comment: Category=gene.
synonym: "COL6A2" RELATED []
is_a: PRO:000003386 ! collagen type VI alpha chain

[Term]
id: PRO:000003358
name: collagen alpha-2(VI) chain isoform 1
def: "A collagen alpha-2(VI) chain that is a translation product of a mature transcript of the COL6A2 gene. Represented by the sequence UniProtKB:P12110-1." [PRO:CNA]
comment: Category=sequence.
synonym: "collagen alpha-2(VI) isoform 2C2 " EXACT []
synonym: "isoform 2C2" EXACT []
is_a: PRO:000003357 ! collagen alpha-2(VI) chain

[Term]
id: PRO:000003359
name: collagen alpha-2(VI) chain isoform 1 unmodified form
def: "A collagen alpha-2(VI) chain isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:CNA]
comment: Category=modification.
synonym: "collagen alpha-2(VI) chain precursor" EXACT []
is_a: PRO:000003358 ! collagen alpha-2(VI) chain isoform 1

[Term]
id: PRO:000003360
name: collagen alpha-2(VI) chain isoform 1 cleaved 1
def: "A collagen alpha-2(VI) chain isoform 1 cleaved form where the signal peptide has been removed from the precursor yielding the mature protein. Example: UniProtKB:P12110-1, 21-1019." [PRO:CNA]
comment: Category=modification.
synonym: "collagen alpha-2(VI) chain" EXACT []
synonym: "collagen alpha-2(VI) chain mature" EXACT []
is_a: PRO:000003381 ! collagen alpha-2(VI) chain isoform 1 cleaved form

[Term]
id: PRO:000003361
name: chondrocalcin
def: "A protein that is a translation product of the COL2A1 gene." [PRO:CNA]
comment: Category=gene. (keywords: ^P02458^).
synonym: "Alpha-1 type II collagen" EXACT []
synonym: "COL2A1" RELATED []
is_a: PRO:000000001 ! protein

[Term]
id: PRO:000003362
name: collagen type II alpha chain isoform 1
def: "A collagen type II alpha chain that is a translation product of a mature transcript of the COL2A1 gene. Represented by the sequence UniProtKB:P02458-1." [PRO:CNA]
comment: Category=sequence.
synonym: "collagen alpha-1(II) chain isoform 1" EXACT []
is_a: PRO:000003266 ! collagen type II alpha chain

[Term]
id: PRO:000003363
name: collagen type II alpha chain isoform 2 cleaved form
def: "A collagen type II alpha chain isoform 2 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000003365 ! collagen type II alpha chain isoform 2

[Term]
id: PRO:000003364
name: collagen alpha-1(I) chain isoform 1 cleaved form
def: "A collagen alpha-1(I) chain isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000003370 ! collagen alpha-1(I) chain isoform 1

[Term]
id: PRO:000003365
name: collagen type II alpha chain isoform 2
def: "A collagen type II alpha chain that is a translation product of a mature transcript of the COL2A1 gene. Represented by the sequence UniProtKB:P02458-2." [PRO:CNA]
comment: Category=sequence.
synonym: "collagen alpha-1(II) chain isoform 2" EXACT []
is_a: PRO:000003266 ! collagen type II alpha chain

[Term]
id: PRO:000003366
name: collagen type II alpha chain isoform 2 unmodified form
def: "A collagen type II alpha chain isoform 2 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:CNA]
comment: Category=modification.
synonym: "collagen type II alpha chain isoform 2 precursor" EXACT []
synonym: "procollagen chain" BROAD []
is_a: PRO:000003365 ! collagen type II alpha chain isoform 2

[Term]
id: PRO:000003367
name: chondrocalcin
def: "A collagen type II alpha chain isoform 2 cleaved form that is the released C-terminal region in the collagen type II alpha chain processing. Example: UniprotKB:P02458-2, 1242-1487." [PMID:3800925, PRO:CNA]
comment: Category=modification.
is_a: PRO:000003363 ! collagen type II alpha chain isoform 2 cleaved form

[Term]
id: PRO:000003368
name: collagen type II alpha chain isoform 2 cleaved 1
def: "A collagen type II alpha chain isoform 2 whose signal peptide, N-terminal propeptide removed and C-terminal chondrocalcin sequence have been removed yielding the mature protein. Example: UniProtKB:P02458-2, 182-1241." [PRO:CNA]
comment: Category=modification.
synonym: "collagen alpha-1(II) chain" EXACT []
synonym: "collagen alpha-1(II) chain mature" EXACT []
is_a: PRO:000003363 ! collagen type II alpha chain isoform 2 cleaved form

[Term]
id: PRO:000003369
name: collagen alpha-1(V) chain isoform 1 cleaved form
def: "A collagen alpha-1(V) chain isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000003346 ! collagen alpha-1(V) chain isoform 1

[Term]
id: PRO:000003370
name: collagen alpha-1(I) chain isoform 1
def: "A collagen alpha-1(I) chain that is a translation product of a mature transcript of the COL1A1 gene. Represented by the sequence UniProtKB:P02452-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000003264 ! collagen alpha-1(I) chain

[Term]
id: PRO:000003371
name: collagen alpha-1(I) chain isoform 1 unmodified form
def: "A collagen alpha-1(I) chain isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:CNA]
comment: Category=modification.
synonym: "collagen alpha-1(I) chain precursor" EXACT []
synonym: "procollagen chain" BROAD []
is_a: PRO:000003370 ! collagen alpha-1(I) chain isoform 1

[Term]
id: PRO:000003372
name: collagen alpha-1(I) chain isoform 1 cleaved 1
def: "A collagen alpha-1(I) chain cleaved form where the signal peptide and the N- and C- termini propeptides have been removed yielding the mature protein. Example: UniProtKB:P02452-1, 162-1218." [PRO:CNA]
comment: Category=modification.
synonym: "collagen alpha-1(I) chain" EXACT []
synonym: "collagen alpha-1(I) chain mature" EXACT []
is_a: PRO:000003364 ! collagen alpha-1(I) chain isoform 1 cleaved form

[Term]
id: PRO:000003373
name: collagen alpha-2(I) chain isoform 1cleaved form
def: "A collagen alpha-2(I) chain isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000003374 ! collagen alpha-2(I) chain isoform 1

[Term]
id: PRO:000003374
name: collagen alpha-2(I) chain isoform 1
def: "A collagen alpha-2(I) chain that is a translation product of a mature transcript of the COL1A2 gene. Represented by the sequence UniProtKB:P08123-1." [PRO:CNA]
comment: Category=sequence.
is_a: PRO:000003265 ! collagen alpha-2(I) chain

[Term]
id: PRO:000003375
name: collagen alpha-2(I) chain isoform 1 unmodified form
def: "A collagen alpha-2(I) chain isoform 1 that has not been subjected to any co- or post-translational residue modification or peptide bond cleavage." [PRO:CNA]
comment: Category=modification.
synonym: "collagen alpha-2(I) chain precursor" EXACT []
synonym: "procollagen chain" BROAD []
is_a: PRO:000003374 ! collagen alpha-2(I) chain isoform 1

[Term]
id: PRO:000003376
name: collagen alpha-2(I) chain isoform 1 modified form
def: "A collagen alpha-2(I) chain isoform 1 cleaved form where the signal peptide has been removed from the precursor yielding the mature protein. Example: UniProtKB:P08123-1, 80-1102." [PRO:CNA]
comment: Category=modification.
synonym: "collagen alpha-2(I) chain mature" EXACT []
is_a: PRO:000003373 ! collagen alpha-2(I) chain isoform 1cleaved form

[Term]
id: PRO:000003377
name: collagen alpha-1(VI) chain isoform 1 cleaved form
def: "A collagen alpha-1(VI) chain isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000003354 ! collagen alpha-1(VI) chain isoform 1

[Term]
id: PRO:000003378
name: collagen alpha-1(VII) chain isoform 1 cleaved form
def: "A collagen alpha-1(VII) chain isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000003350 ! collagen alpha-1(VII) chain isoform 1

[Term]
id: PRO:000003379
name: collagen alpha-2(V) chain isoform 1 cleaved form
def: "A collagen alpha-2(V) chain isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000003332 ! collagen alpha-2(V) chain isoform 1

[Term]
id: PRO:000003380
name: collagen alpha-2(V) chain isoform 1 cleaved 1
def: "A collagen alpha-2(V) chain cleaved form where the signal peptide and C-terminal propeptide have been removed from the precursor yielding the mature protein. Example: UniProtKB:P05997-1, 27-1229." [PRO:CNA]
comment: Category=modification.
synonym: "collagen alpha-2(V) chain" EXACT []
synonym: "collagen alpha-2(V) chain mature" EXACT []
is_a: PRO:000003379 ! collagen alpha-2(V) chain isoform 1 cleaved form

[Term]
id: PRO:000003381
name: collagen alpha-2(VI) chain isoform 1 cleaved form
def: "A collagen alpha-2(VI) chain isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000003358 ! collagen alpha-2(VI) chain isoform 1

[Term]
id: PRO:000003382
name: collagen alpha-3(VI) chain isoform 1 cleaved form
def: "A collagen alpha-3(VI) chain isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000003342 ! collagen alpha-3(VI) chain isoform 1

[Term]
id: PRO:000003383
name: collagen alpha-4(IV) chain isoform 1 cleaved form
def: "A collagen alpha-4(IV) chain isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000003338 ! collagen alpha-4(IV) chain isoform 1

[Term]
id: PRO:000003384
name: collagen alpha-5(IV) chain isoform 1 cleaved form
def: "A collagen alpha-5(IV) chain isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA]
comment: Category=modification.
is_a: PRO:000003335 ! collagen alpha-5(IV) chain isoform 1

[Term]
id: PRO:000003385
name: collagen alpha-5(IV) chain isoform 1 cleaved 1
def: "A collagen alpha-5(IV) chain isoform 1 cleaved form where the signal peptide has been removed from the precursor yielding the mature protein. Example: UniProtKB:P29400-1, 27-1685." [PRO:CNA]
comment: Category=modification.
synonym: "collagen alpha-5(IV) chain" EXACT []
synonym: "collagen alpha-5(IV) chain mature" EXACT []
is_a: PRO:000003384 ! collagen alpha-5(IV) chain isoform 1 cleaved form

[Term]
id: PRO:000003386
name: collagen type VI alpha chain
def: "A collagen alpha chain that is a translation product of the COL6A1 or COL6A2 or COL6A3 gene." [PMID:15788652 , PRO:CNA]
comment: Category=family.
is_a: PRO:000003262 ! collagen alpha chain

[Term]
id: PRO:000003387
name: collagen type V alpha chain
def: "A collagen alpha chain that is a translation product of the COL5A1 or COL5A2 or COL5A3 gene." [PMID:15788652, PRO:CNA]
comment: Category=family.
is_a: PRO:000003262 ! collagen alpha chain

[Term]
id: PRO:000003388
name: collagen type IV alpha chain
def: "A collagen alpha chain that is a translation product of any of the COL4A1 to COL4A6 gene." [PMID:15788652, PRO:CNA]
comment: Category=family.
is_a: PRO:000003262 ! collagen alpha chain

[Typedef]
id: has_modification
name: has_modification
is_transitive: true

[Typedef]
id: lacks_modification
name: lacks_modification
is_transitive: true